RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62] (143 letters) >gnl|CDD|179133 PRK00809, PRK00809, hypothetical protein; Provisional. Length = 144 Score = 36.5 bits (85), Expect = 0.003 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 14/81 (17%) Query: 1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN----- 55 M YWL + E +W++ +DK W GV + +N + K++ GDK Y S Sbjct: 1 MTYWLCITN--EDNWEVIKDKN----VW-GV-PERYKNTIEKVKPGDKLIIYVSQEYGAE 52 Query: 56 -KGREIVGIFEVITCTYPDPT 75 +IVGI+EV++ Y D T Sbjct: 53 RLPGKIVGIYEVVSEWYEDST 73 >gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase. Length = 1012 Score = 27.4 bits (61), Expect = 1.3 Identities = 9/24 (37%), Positives = 10/24 (41%) Query: 73 DPTAEQSSCWECVDICAVCSMPCP 96 P E C EC +C C CP Sbjct: 875 FPEQESQRCLECSYVCEKCVDVCP 898 >gnl|CDD|150586 pfam09930, DUF2162, Predicted transporter (DUF2162). Members of this family of bacterial proteins are thought to be membrane transporters, but their exact function has not, as yet, been elucidated. Length = 228 Score = 26.9 bits (60), Expect = 1.8 Identities = 11/46 (23%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Query: 88 CAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVC 133 S PCPV L A+ + I++++ L + PV + + Sbjct: 101 FLAMSAPCPVCLGAVILS------IMLLAPSLGLSPVALGLVVGLA 140 >gnl|CDD|162660 TIGR02013, rpoB, DNA-directed RNA polymerase, beta subunit. This model describes orthologs of the beta subunit of Bacterial RNA polymerase. The core enzyme consists of two alpha chains, one beta chain, and one beta' subunit. Length = 1065 Score = 26.2 bits (58), Expect = 3.1 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Query: 31 VRNYQARNNMRKMRVGDKGFFYHSNKG 57 V+ Y A+ RK++VGDK H NKG Sbjct: 827 VKVYIAQK--RKIQVGDKMAGRHGNKG 851 >gnl|CDD|179919 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional. Length = 695 Score = 26.1 bits (58), Expect = 3.4 Identities = 11/30 (36%), Positives = 14/30 (46%), Gaps = 5/30 (16%) Query: 71 YPDPTAEQSSCWECVDICAVCSMPCPVSLM 100 P P EQ C+ C C+ CP SL+ Sbjct: 363 LPPPPPEQP----CIR-CGACADACPASLL 387 >gnl|CDD|132422 TIGR03379, glycerol3P_GlpC, glycerol-3-phosphate dehydrogenase, anaerobic, C subunit. Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species. Length = 397 Score = 25.9 bits (57), Expect = 4.4 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 4/19 (21%) Query: 88 CAVCSMPCPVSLMAIKANP 106 C VC++ CPV+ KANP Sbjct: 10 CTVCTVYCPVA----KANP 24 >gnl|CDD|181983 PRK09603, PRK09603, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed. Length = 2890 Score = 25.7 bits (56), Expect = 4.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 41 RKMRVGDKGFFYHSNKG 57 RK++VGDK H NKG Sbjct: 1086 RKLKVGDKMAGRHGNKG 1102 >gnl|CDD|183966 PRK13309, ureC, urease subunit alpha; Reviewed. Length = 572 Score = 25.6 bits (56), Expect = 5.3 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Query: 19 QDKGRVGEAWTGVRNYQARNNMRKMR 44 Q GRVGE W +R Q + M+ R Sbjct: 367 QAMGRVGENW--LRAIQTADAMKAAR 390 >gnl|CDD|149365 pfam08269, Cache_2, Cache domain. Length = 95 Score = 25.3 bits (56), Expect = 5.5 Identities = 6/18 (33%), Positives = 11/18 (61%) Query: 35 QARNNMRKMRVGDKGFFY 52 QA+ +R +R G+F+ Sbjct: 43 QAKALLRALRYDGDGYFF 60 >gnl|CDD|162872 TIGR02470, sucr_synth, sucrose synthase. This model represents sucrose synthase, an enzyme that, despite its name, generally uses rather produces sucrose. Sucrose plus UDP (or ADP) becomes D-fructose plus UDP-glucose (or ADP-glucose), which is then available for cell wall (or starch) biosynthesis. The enzyme is homologous to sucrose phosphate synthase, which catalyzes the penultimate step in sucrose synthesis. Sucrose synthase is found, so far, exclusively in plants and cyanobacteria. Length = 784 Score = 25.4 bits (56), Expect = 6.1 Identities = 9/38 (23%), Positives = 18/38 (47%) Query: 96 PVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVC 133 P +A++ + + + LSV+ +T EYL+ Sbjct: 61 PWVALAVRPRIGVWEYVRVNVEELSVEELTISEYLDFK 98 >gnl|CDD|177740 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit. Length = 276 Score = 25.1 bits (55), Expect = 6.2 Identities = 8/15 (53%), Positives = 11/15 (73%), Gaps = 1/15 (6%) Query: 82 WECVDICAVCSMPCP 96 +EC+ +CA CS CP Sbjct: 187 YECI-LCACCSTSCP 200 >gnl|CDD|185649 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional. Length = 522 Score = 25.1 bits (55), Expect = 7.0 Identities = 7/28 (25%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Query: 12 EWSWKMQQ---DKGRVGEAWTGVRNYQA 36 EW+WK+ Q + ++G++N Sbjct: 444 EWAWKIFQAIEKHCKTENGYSGLKNVLT 471 >gnl|CDD|182113 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional. Length = 1019 Score = 24.6 bits (54), Expect = 9.0 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 77 EQSSCWECVDICAVCSMPCP 96 E + C EC +C C CP Sbjct: 884 EAARCLECNYVCEKCVDVCP 903 >gnl|CDD|181782 PRK09331, PRK09331, Sep-tRNA:Cys-tRNA synthetase; Provisional. Length = 387 Score = 24.5 bits (54), Expect = 9.2 Identities = 7/15 (46%), Positives = 7/15 (46%) Query: 50 FFYHSNKGREIVGIF 64 F Y K R I GI Sbjct: 335 FLYEELKKRGIHGIK 349 >gnl|CDD|118696 pfam10168, Nup88, Nuclear pore component. Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein has no obvious structural motifs but is the region for binding to Nup98, one of the components of the nuclear pore. the C-terminal end is a predicted coiled-coil domain. Nup88 is overexpressed in tumour cells. Length = 717 Score = 24.5 bits (53), Expect = 9.6 Identities = 14/56 (25%), Positives = 18/56 (32%), Gaps = 16/56 (28%) Query: 63 IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSR 118 I E I CT P C +P PV I + + MI I + Sbjct: 424 IVEHILCTKPLS----------------CELPNPVRGFWILQDLLGAGMICITGTY 463 >gnl|CDD|150558 pfam09899, DUF2126, Putative amidoligase enzyme (DUF2126). Members of this family of bacterial domains are predominantly found in transglutaminase and transglutaminase-like proteins. Their exact function is, as yet, unknown, but they are likely to act as amidoligase enzymes Protein in this family are found in conserved gene neighborhoods encoding a glutamine amidotransferase-like thiol peptidase (in proteobacteria) or an Aig2 family cyclotransferase protein (in firmicutes). Length = 817 Score = 24.5 bits (54), Expect = 9.9 Identities = 9/16 (56%), Positives = 10/16 (62%), Gaps = 1/16 (6%) Query: 22 GRVGEAWTGVRNYQAR 37 G GEA GVR Y+A Sbjct: 713 GTPGEAVAGVR-YRAW 727 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.133 0.433 Gapped Lambda K H 0.267 0.0658 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,262,005 Number of extensions: 121177 Number of successful extensions: 230 Number of sequences better than 10.0: 1 Number of HSP's gapped: 230 Number of HSP's successfully gapped: 22 Length of query: 143 Length of database: 5,994,473 Length adjustment: 84 Effective length of query: 59 Effective length of database: 4,179,401 Effective search space: 246584659 Effective search space used: 246584659 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.0 bits)