BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62] (143 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62] Length = 143 Score = 300 bits (767), Expect = 1e-83, Method: Compositional matrix adjust. Identities = 143/143 (100%), Positives = 143/143 (100%) Query: 1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI Sbjct: 1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60 Query: 61 VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120 VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS Sbjct: 61 VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120 Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143 VQPVTTDEYLEVCRMGKLSNPPL Sbjct: 121 VQPVTTDEYLEVCRMGKLSNPPL 143 >gi|254780416|ref|YP_003064829.1| putative ferredoxin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Score = 24.6 bits (52), Expect = 0.66, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 83 ECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122 EC+D C VC CPV + P L + L ++S + Q Sbjct: 39 ECID-CGVCEPECPVDAIKPDTEPGL-ELWLKINSEYATQ 76 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 23.9 bits (50), Expect = 1.2, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 127 DEYLEVCRMGKLSNPP 142 DEYL + ++G+ NPP Sbjct: 174 DEYLTITQIGERLNPP 189 >gi|254780801|ref|YP_003065214.1| hypothetical protein CLIBASIA_03460 [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 23.9 bits (50), Expect = 1.3, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 53 HSNKGREIVGIFEVITCTYPDPTA 76 SNK EIV +F+VI + TA Sbjct: 83 QSNKVSEIVSLFDVIETVSREKTA 106 >gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 23.5 bits (49), Expect = 1.6, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Query: 1 MAYWLVKSEPSEWSW-----------KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKG 49 M W + S+W++ +Q+++ +R+Y +NN K+ +G G Sbjct: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 22.7 bits (47), Expect = 2.7, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 100 MAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRM 135 + I NP S ++ RL + +T ++ LE+ R+ Sbjct: 656 IMINCNPETVSTDYDIADRLYFESLTEEDILEILRV 691 >gi|254780861|ref|YP_003065274.1| NADH dehydrogenase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 163 Score = 22.3 bits (46), Expect = 3.5, Method: Compositional matrix adjust. Identities = 7/20 (35%), Positives = 11/20 (55%) Query: 88 CAVCSMPCPVSLMAIKANPR 107 C +C CP + I++ PR Sbjct: 66 CKLCEAICPAQAITIESGPR 85 >gi|254780618|ref|YP_003065031.1| F0F1 ATP synthase subunit delta [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 21.6 bits (44), Expect = 6.1, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 112 ILIVSSRLSVQPVTTDEYLEVC 133 IL+ + RLSV P + VC Sbjct: 86 ILVANGRLSVLPAIIKSFRAVC 107 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.133 0.433 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,400 Number of Sequences: 1233 Number of extensions: 3331 Number of successful extensions: 12 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 9 length of query: 143 length of database: 328,796 effective HSP length: 66 effective length of query: 77 effective length of database: 247,418 effective search space: 19051186 effective search space used: 19051186 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 34 (17.7 bits)