HHsearch alignment for GI: 254781041 and conserved domain: TIGR02046

>TIGR02046 sdhC_b558_fam succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family; InterPro: IPR011138 This family contains succinate dehydrogenase subunit C of Bacillus subtilis, designated cytochrome b-558, and related sequences that include a fumarate reductase subunit C. This family is only weakly similar to the main group of succinate dehydrogenase cytochrome b subunits described by IPR000701 from INTERPRO, so that some members score above the gathering threshold and some do not ..
Probab=94.26  E-value=0.36  Score=25.73  Aligned_cols=112  Identities=15%  Similarity=0.097  Sum_probs=78.1

Q ss_pred             CCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-------------------CHHHHHHHHH
Q ss_conf             004989997735102666599999999999999999999999999985163-------------------0355467530
Q gi|254781041|r    4 IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE-------------------HTLSSLRCYM   64 (129)
Q Consensus         4 m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~-------------------~~~~~~~~~~   64 (129)
T Consensus        87 ~~~ar~~~-Y~~~~~~~-~~~~s~~m~~~GIi~l~Fi~~H~~~f~~~~~~~~~~~~~~a~~~~DGfdhP~~~y~~~v~~F  164 (233)
T TIGR02046        87 KRAARPVR-YAHKSRAK-ASWASRTMLVTGIIVLLFIGLHLLDFTLGAQLAEAFEMGVAKFRIDGFDHPADIYEMVVLTF  164 (233)
T ss_pred             HHCCCCCC-CCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             86027888-53257001-14898899998799999999999999999874677778888867787666068999999986


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             68316999999999999999998999998521233589999999999999999
Q gi|254781041|r   65 DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL  117 (129)
Q Consensus        65 ~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil  117 (129)
T Consensus       165 s~p~~~~~YiVa~l~L~fH~~HG~wSa~qTLG~n~t~~~~~ik~~s~v~al~i  217 (233)
T TIGR02046       165 SSPIVLSIYIVAMLALGFHLSHGLWSAAQTLGLNSTIRSQRIKAVSNVVALVI  217 (233)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             07168899999999999999999999999817988006788899999999999