Query gi|254781041|ref|YP_003065454.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus Liberibacter asiaticus str. psy62] Match_columns 129 No_of_seqs 106 out of 995 Neff 6.8 Searched_HMMs 39220 Date Mon May 30 03:30:55 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781041.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR02970 succ_dehyd_cytB succ 100.0 0 0 273.6 14.7 119 6-124 1-122 (123) 2 PRK09487 sdhC succinate dehydr 100.0 3.8E-44 0 260.4 15.2 124 2-125 3-127 (129) 3 cd03499 SQR_TypeC_SdhC Succina 100.0 1.1E-42 0 252.5 13.9 117 8-124 1-117 (117) 4 KOG0449 consensus 100.0 2.1E-35 5.4E-40 212.7 7.6 122 2-123 43-166 (168) 5 pfam01127 Sdh_cyt Succinate de 100.0 1.1E-32 2.8E-37 197.9 14.3 118 4-121 1-121 (122) 6 COG2009 SdhC Succinate dehydro 100.0 2.2E-27 5.6E-32 168.9 14.0 122 6-127 1-127 (132) 7 cd03501 SQR_TypeA_SdhC_like Su 99.8 1.4E-18 3.5E-23 120.9 11.8 98 23-121 1-98 (101) 8 cd03493 SQR_QFR_TM Succinate:q 99.7 1.2E-16 3.1E-21 110.2 10.1 97 27-123 1-97 (98) 9 cd03500 SQR_TypeA_SdhD_like Su 99.0 6.1E-09 1.6E-13 68.2 12.0 78 23-100 2-80 (106) 10 COG2142 SdhD Succinate dehydro 98.5 2.1E-06 5.3E-11 54.4 11.0 76 26-103 17-92 (117) 11 TIGR02968 succ_dehyd_anc succi 98.2 4.4E-05 1.1E-09 47.1 12.1 79 26-106 8-86 (105) 12 cd03497 SQR_TypeB_1_TM Succina 98.2 0.00015 3.7E-09 44.3 13.7 109 12-121 80-199 (207) 13 cd03498 SQR_TypeB_2_TM Succina 97.9 0.0012 3E-08 39.3 13.8 101 19-120 86-196 (209) 14 cd03494 SQR_TypeC_SdhD Succina 97.8 0.001 2.6E-08 39.6 12.0 70 27-98 3-72 (99) 15 PRK09488 sdhD succinate dehydr 97.7 0.0012 3.2E-08 39.2 12.1 72 25-98 15-86 (115) 16 cd03495 SQR_TypeC_SdhD_like Su 97.7 0.00054 1.4E-08 41.2 9.2 76 26-103 3-78 (100) 17 cd03526 SQR_QFR_TypeB_TM Succi 97.6 0.0023 5.8E-08 37.8 11.3 93 6-100 74-168 (199) 18 cd03498 SQR_TypeB_2_TM Succina 97.0 0.024 6.1E-07 32.2 11.5 96 30-125 6-111 (209) 19 cd03526 SQR_QFR_TypeB_TM Succi 95.4 0.18 4.6E-06 27.4 11.7 67 28-94 4-72 (199) 20 cd03497 SQR_TypeB_1_TM Succina 95.2 0.2 5.1E-06 27.1 11.5 66 27-92 8-76 (207) 21 cd00581 QFR_TypeB_TM Quinol:fu 94.7 0.19 4.8E-06 27.3 7.2 62 30-91 6-76 (206) 22 TIGR02046 sdhC_b558_fam succin 94.3 0.36 9.3E-06 25.7 13.8 112 4-117 87-217 (233) 23 PRK13554 fumarate reductase cy 93.1 0.59 1.5E-05 24.6 9.2 90 6-95 5-105 (241) 24 cd00546 QFR_TypeD_subunitC Qui 93.0 0.59 1.5E-05 24.6 7.2 90 24-113 20-114 (124) 25 pfam02967 consensus 89.8 1.4 3.5E-05 22.6 8.7 78 17-94 13-100 (223) 26 PRK13553 fumarate reductase cy 88.7 1.7 4.3E-05 22.1 8.9 78 18-95 17-104 (252) 27 COG3029 FrdC Fumarate reductas 88.2 1.8 4.6E-05 21.9 6.2 83 1-85 1-84 (129) 28 pfam02313 Fumarate_red_D Fumar 87.9 1.9 4.8E-05 21.8 8.2 46 54-99 48-93 (118) 29 PRK13603 fumarate reductase su 81.6 3.8 9.7E-05 20.2 7.3 89 25-113 21-114 (126) 30 PRK04987 fumarate reductase su 79.6 4.5 0.00011 19.8 12.5 91 24-114 23-118 (129) 31 cd00547 QFR_TypeD_subunitD Qui 79.3 4.6 0.00012 19.7 8.5 44 54-97 44-87 (115) 32 pfam02300 Fumarate_red_C Fumar 79.1 4.6 0.00012 19.7 12.1 106 7-114 8-118 (128) 33 PRK05470 fumarate reductase su 57.2 14 0.00037 17.0 9.8 47 52-98 46-92 (118) 34 PRK13867 type IV secretion sys 35.6 15 0.00037 17.0 0.7 28 3-33 7-36 (63) 35 pfam02941 FeThRed_A Ferredoxin 32.0 16 0.00042 16.7 0.5 11 6-16 41-51 (67) 36 pfam10573 UPF0561 Uncharacteri 26.1 34 0.00086 15.0 1.3 17 5-21 58-74 (126) 37 TIGR00947 2A73 inorganic carbo 24.0 25 0.00063 15.7 0.2 23 15-37 7-29 (467) 38 pfam00584 SecE SecE/Sec61-gamm 23.4 54 0.0014 13.8 4.5 41 83-128 8-48 (56) 39 PRK05740 secE preprotein trans 23.2 55 0.0014 13.8 9.5 47 77-128 68-114 (124) No 1 >TIGR02970 succ_dehyd_cytB succinate dehydrogenase, cytochrome b556 subunit; InterPro: IPR014314 In E. coli and many other bacteria, two small, hydrophobic, mutually homologous subunits of succinate dehydrogenase (a TCA cycle enzyme) are SdhC and SdhD. This entry is the SdhC, the cytochrome b subunit, called b556 in bacteria and b560 in mitochondria. SdhD (see IPR014312 from INTERPRO) is called the hydrophobic membrane anchor subunit, although both SdhC and SdhD participate in anchoring the complex. In some bacteria, this cytochrome b subunit is replaced my a member of the cytochrome b558 family (see IPR011138 from INTERPRO).. Probab=100.00 E-value=0 Score=273.57 Aligned_cols=119 Identities=33% Similarity=0.627 Sum_probs=117.2 Q ss_pred CCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHH--HHHHHH-HCCCHHHHHHHHHHHHHHH Q ss_conf 4989997735102666599999999999999999999999999985163035--546753-0683169999999999999 Q gi|254781041|r 6 NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL--SSLRCY-MDGSVFEVCLFLYTWAVIH 82 (129) Q Consensus 6 ~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~--~~~~~~-~~~~~~k~~~~~~~~~~~y 82 (129) ++||+|||||+||+|+||++||+|||||+++++++++++|++..+..+||+| +.+++. ++++++|++.+++.++++| T Consensus 1 ~~RP~sphL~~yr~p~~a~~SIlHRitG~~Lf~~l~~~~w~L~~~l~s~~~f~~~~~~~~l~~~~~~kl~l~~~~~a~~y 80 (123) T TIGR02970 1 KQRPLSPHLQIYRFPITAILSILHRITGVLLFFGLPFLLWLLSLSLSSPESFLNATVQALLLSSPLGKLILFGLLWALLY 80 (123) T ss_pred CCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99998998642201523677779999999999999999999999850788999999999897317999999999999999 Q ss_pred HHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999989999985212335899999999999999999999999 Q gi|254781041|r 83 HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124 (129) Q Consensus 83 H~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~~~~ 124 (129) |++||||||+||+|+|+|+++++++++++++++++.++..|+ T Consensus 81 H~~~GIRHL~~D~G~G~~~~~~~~~a~~v~~~~~vl~~~~~~ 122 (123) T TIGR02970 81 HLLAGIRHLLWDLGYGLELKSARISAWVVLVLSLVLTVLAGI 122 (123) T ss_pred HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999889999987288865567888999999999999999984 No 2 >PRK09487 sdhC succinate dehydrogenase cytochrome b556 large membrane subunit; Provisional Probab=100.00 E-value=3.8e-44 Score=260.43 Aligned_cols=124 Identities=19% Similarity=0.344 Sum_probs=119.4 Q ss_pred CCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHH Q ss_conf 62004989997735102666599999999999999999999999999985163035546753068316999999999999 Q gi|254781041|r 2 SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVI 81 (129) Q Consensus 2 ~~m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~ 81 (129) +|||+|||+|||||+||+|+||++||+||+||+++++++++..|++..+..+||+|+.++..++++++|++.++..++++ T Consensus 3 ~~m~~~RPls~~L~~~r~pitai~SIlHRiSGv~lf~~~~~~~~~l~~sl~s~~~f~~~~~~~~~~~~k~il~~~~~al~ 82 (129) T PRK09487 3 RNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQAAAIMDSFFVKFIMWGILTALA 82 (129) T ss_pred CCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 53457999998853035439999999999999999999999999999995496879999999977999999999999999 Q ss_pred HHHHHHHHHHHHHCCH-HCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999989999985212-3358999999999999999999999999 Q gi|254781041|r 82 HHMLGGIRYLIWDVSL-CLDKKIATQMAKINIIASILTVLIVWII 125 (129) Q Consensus 82 yH~~nGiRHL~wD~g~-g~~~~~~~~s~~~vl~~sil~~~~~~~i 125 (129) ||++||+|||+||+|+ |+++++++.+++++++++++.+++.|+. T Consensus 83 yH~~~GIRHL~~D~G~~~e~l~~~~~sa~iv~~l~~vltvl~~i~ 127 (129) T PRK09487 83 YHIVVGIRHLLMDFGYLEETLEAGKRSAKVSFVITVVLSLLAGVL 127 (129) T ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999986899999802003127998899999999999999999999 No 3 >cd03499 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this family reduce high potential quinones such as ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Proteins in this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. The heme and quinone binding sites reside in the transmembrane subunits. The SdhC or CybL protein is one of the two transmembrane subunits of bacterial and eukaryotic SQRs. The two-electron oxidation of succinate in the flavoprotein a Probab=100.00 E-value=1.1e-42 Score=252.52 Aligned_cols=117 Identities=35% Similarity=0.666 Sum_probs=114.8 Q ss_pred CCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 89997735102666599999999999999999999999999985163035546753068316999999999999999998 Q gi|254781041|r 8 RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGG 87 (129) Q Consensus 8 RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nG 87 (129) ||+|||||+||+|+||++||+||+||++++++++++.+++.....+||.|+.++...+++++|++++++++++.||++|| T Consensus 1 RP~sPhL~iyk~~~ta~~SI~HRiSGv~l~~~~~~~~~~l~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~yH~~~G 80 (117) T cd03499 1 RPLSPHLTIYRPPLTAILSILHRITGVALFLGLPLLLWWLLASLSSPESFESVSALLGSWLGKLVLFGLTWALFYHLLNG 80 (117) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99897433045169999999999999999999999999999980287789999999615799999999999999999866 Q ss_pred HHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999985212335899999999999999999999999 Q gi|254781041|r 88 IRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124 (129) Q Consensus 88 iRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~~~~ 124 (129) +||++||+|+|+|+|++|++|+++++++++.++++|+ T Consensus 81 iRHL~wD~g~g~~~~~~~~s~~~v~~~s~~~t~~~~~ 117 (117) T cd03499 81 IRHLIWDLGKGLELKTVYKSGYAVLVLSVVLTVLLGI 117 (117) T ss_pred HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 8999998113564999999999999999999999979 No 4 >KOG0449 consensus Probab=100.00 E-value=2.1e-35 Score=212.66 Aligned_cols=122 Identities=28% Similarity=0.329 Sum_probs=96.8 Q ss_pred CCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHCCCHHHHHHHH-HCCCHHHHHHHHHHHH Q ss_conf 6200498999773510266659999999999999999999999-9999985163035546753-0683169999999999 Q gi|254781041|r 2 SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVV-FWFFCIANGEHTLSSLRCY-MDGSVFEVCLFLYTWA 79 (129) Q Consensus 2 ~~m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~-~~l~~~~~~~~~~~~~~~~-~~~~~~k~~~~~~~~~ 79 (129) +|++.|||+||||+||+||+||..||+|||||+++..+..++. ..+......++.++.+... ++....-.+|+.++++ T Consensus 43 ~~~r~~RPlSPHLTIYqpQLt~~LS~~hRiSG~~la~gv~~~G~~~l~~~g~~~~~v~~~~~~~~~~~~~~~~K~~iayp 122 (168) T KOG0449 43 KNQRSNRPLSPHLTIYQPQLTWMLSIFHRISGVVLAGGVWLVGVSGLLGMGDITATVSKVYQLKLPTAVQWPAKFSIAYP 122 (168) T ss_pred HHHHCCCCCCCCEEEECHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHH T ss_conf 66652899998530634128999999875513001446999888998457516888888897316456775689999999 Q ss_pred HHHHHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999998999998521233589999999999999999999999 Q gi|254781041|r 80 VIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123 (129) Q Consensus 80 ~~yH~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~~~ 123 (129) +.||..||||||+||.|++++++++|++||++++++++++..+. T Consensus 123 ~a~Ht~ngiRHLiwd~~k~L~i~~vY~tGy~v~alt~vls~~l~ 166 (168) T KOG0449 123 FAYHTGNGIRHLIWDLGKELTIKGVYKTGYAVLALTVVLSAYLA 166 (168) T ss_pred HHHHHHCCHHHHHHHHCCCCCCCCEEEECHHHHHHHHHHHHHHH T ss_conf 99997153233445531455300111201168999999999996 No 5 >pfam01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit. This family includes a transmembrane protein from both the Succinate dehydrogenase and Fumarate reductase complexes. Probab=100.00 E-value=1.1e-32 Score=197.85 Aligned_cols=118 Identities=30% Similarity=0.531 Sum_probs=104.3 Q ss_pred CCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHCCCHHHHH-HHHHCCCHHHHHHHHHHHHH Q ss_conf 00498999773510266659999999999999999999999999998--5163035546-75306831699999999999 Q gi|254781041|r 4 IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI--ANGEHTLSSL-RCYMDGSVFEVCLFLYTWAV 80 (129) Q Consensus 4 m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~--~~~~~~~~~~-~~~~~~~~~k~~~~~~~~~~ 80 (129) |++|||+|||+|+||+|.++..||+||+||++++++...+..|+... ...+++|+.+ ...+++++.++.++++.+++ T Consensus 1 ~~~~rp~sphl~i~~~~~~~~~si~hRiTGv~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~ 80 (122) T pfam01127 1 MRKNRPLSPHLGLYRAHLGTILSILHRITGVALAVLLIHLLLWLLLLALLLGPDSYARVVVAWLSSPFKLILLLLLLLAL 80 (122) T ss_pred CCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999975615652357987999999999999999999999999875794789999999871299999999999999 Q ss_pred HHHHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999989999985212335899999999999999999999 Q gi|254781041|r 81 IHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121 (129) Q Consensus 81 ~yH~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~ 121 (129) .||+.||+||++||+|+|+|+|+.+++++++++.+++.++. T Consensus 81 ~yH~~~GiRhli~D~g~g~~~~~~~~~~~~v~~~~~~~~~~ 121 (122) T pfam01127 81 FYHAANGLRHLIWDVGKGLELKTARKTGLLVLALSLVLTLL 121 (122) T ss_pred HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 99998679999997223665999999999999999999988 No 6 >COG2009 SdhC Succinate dehydrogenase/fumarate reductase, cytochrome b subunit [Energy production and conversion] Probab=99.95 E-value=2.2e-27 Score=168.87 Aligned_cols=122 Identities=31% Similarity=0.509 Sum_probs=103.4 Q ss_pred CCCCCCCCCCEECCCHHHHHHHHHHHHHHHHH--HHHHHHHH--HHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHH Q ss_conf 49899977351026665999999999999999--99999999--999985163035546753068316999999999999 Q gi|254781041|r 6 NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY--LGTPVVVF--WFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVI 81 (129) Q Consensus 6 ~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~--~~~~~~~~--~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~ 81 (129) ++||.|||+|+||+|+++..|++||+||+++. ....++.. |+.....+++.++.+.....+++.++.++++.+++. T Consensus 1 ~~r~~~~~l~~~~~~~~~~~silHRitGv~l~~Fl~~hil~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~ 80 (132) T COG2009 1 RKRPVSPHLQIYRPPITMYASILHRISGVILAFFLFVHILLASSWLAGSASFNAAFEFYHALLGSFIVKLVLLGLVLALL 80 (132) T ss_pred CCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH T ss_conf 99887875141206779999999997999999999999999999988887579999999963676799999999999999 Q ss_pred HHHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHHH-HHHHHHHHH Q ss_conf 9999989999985212335899999999999999999-999999975 Q gi|254781041|r 82 HHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT-VLIVWIIKD 127 (129) Q Consensus 82 yH~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil~-~~~~~~i~~ 127 (129) ||.+||+||++||+|++++.+....+++.....+.+. ++..|.+.. T Consensus 81 ~H~~nGIR~l~~d~g~~~~~~~~~~~~~~~~~~~~v~~~~l~~~~~~ 127 (132) T COG2009 81 YHGLNGIRHLLWDFGYGLELKGVGYTGAALVFFSAVTLTLLLWVIVW 127 (132) T ss_pred HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99998799999997411153202156899999999999999999999 No 7 >cd03501 SQR_TypeA_SdhC_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase C (SdhC)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this subfamily reduce low potential quinones such as menaquinone and thermoplasmaquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are similar to the Thermoplasma acidophilum SQR and are classified as Type A because they contain two transmembrane subunits as well as two heme groups. Although there are no structures available for this subfamily, the presence of two hemes has been proven spectroscopically for T. acidophilum. The two membrane anchor subunits are similar to the SdhD and SdhC subunits of bacteria Probab=99.79 E-value=1.4e-18 Score=120.89 Aligned_cols=98 Identities=22% Similarity=0.349 Sum_probs=89.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCHH Q ss_conf 99999999999999999999999999985163035546753068316999999999999999998999998521233589 Q gi|254781041|r 23 MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102 (129) Q Consensus 23 ~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~~~ 102 (129) |+++++||+||+++++.+++..+.+.....+||.|+.+.+..+++++|+.++++..+..||.+||+|+++.|+|.+- .+ T Consensus 1 mwA~~lHRiTGv~l~~fL~~Hi~~ls~~~~~p~~y~~~~~~~~~p~~~~~e~gLv~a~~fHa~NGiRiil~Df~~~g-~~ 79 (101) T cd03501 1 MWAWVLHRITGVVILFYLFLHVLDLSSLRRGPETYNAVIATYKSPIFKLGEFGLVAAVVFHALNGIRLILVDFGSGG-PR 79 (101) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HH T ss_conf 98999999999999999999999999984499999999999718279999999999999997403999999983044-78 Q ss_pred HHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999 Q gi|254781041|r 103 IATQMAKINIIASILTVLI 121 (129) Q Consensus 103 ~~~~s~~~vl~~sil~~~~ 121 (129) ..|...|++++++++..+. T Consensus 80 ~qk~l~~~v~~l~~v~~i~ 98 (101) T cd03501 80 YQRQLFYIVLVLTVVLIVA 98 (101) T ss_pred HHHHHHHHHHHHHHHHHHH T ss_conf 8999999999999999960 No 8 >cd03493 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction. SQR, also called succinate dehydrogenase or Complex II, is part of the citric acid cycle and the aerobic respiratory chain, while QFR is involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQRs may reduce either high or low potential quinones while QFRs oxidize only low potential quinols. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit(s) containing the electron donor/acceptor (quinol or quinone). The reversible reduction of Probab=99.70 E-value=1.2e-16 Score=110.22 Aligned_cols=97 Identities=25% Similarity=0.459 Sum_probs=92.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCHHHHHH Q ss_conf 99999999999999999999999851630355467530683169999999999999999989999985212335899999 Q gi|254781041|r 27 IVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQ 106 (129) Q Consensus 27 I~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~~~~~~~ 106 (129) ++||+||+++.+..+.+.+++.....+++.++.....++++..+.+..+..+++.||..||+||++||+|++.+.+..+. T Consensus 1 ~~~Ritgv~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~H~~~Gir~~~~D~~~~~~~~~~~~ 80 (98) T cd03493 1 ILHRITGVALLLFLPLHLLGLLALLGGPYAFAEVVAFLSSPLGKLLYLLLLLALLYHALNGIRHLIWDYGKGLELKLRKA 80 (98) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCHHHHHHHCCCCCCHHHHHH T ss_conf 92113779999999999999999806989999999999269999999999999999974072677442011466899999 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999 Q gi|254781041|r 107 MAKINIIASILTVLIVW 123 (129) Q Consensus 107 s~~~vl~~sil~~~~~~ 123 (129) +++++.+++++.++..+ T Consensus 81 ~~~~~~~~~~~~~~~~~ 97 (98) T cd03493 81 LGYAVLALSVLLTVLLL 97 (98) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 99999999999999997 No 9 >cd03500 SQR_TypeA_SdhD_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase D (SdhD)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this subfamily reduce low potential quinones such as menaquinone and thermoplasmaquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are similar to the Thermoplasma acidophilum SQR and are classified as Type A because they contain two transmembrane subunits as well as two heme groups. Although there are no structures available for this subfamily, the presence of two hemes has been proven spectroscopically for T. acidophilum. The two membrane anchor subunits are similar to the SdhD and SdhC subunits of bacterial Probab=99.04 E-value=6.1e-09 Score=68.19 Aligned_cols=78 Identities=14% Similarity=0.136 Sum_probs=67.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCC Q ss_conf 999999999999999999999999999851630-355467530683169999999999999999989999985212335 Q gi|254781041|r 23 MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH-TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100 (129) Q Consensus 23 ~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~-~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~ 100 (129) +....+||+||+.+.+.+....+.......+++ .|+.+..-+++|..|...++..+.-.||-.||+|..+-|...+-. T Consensus 2 ~~~W~~~RiSGv~Lv~ll~~H~~~~h~~~~~~~i~f~~V~~r~~~P~w~~~d~llL~lal~HG~NGlR~il~Dy~~~~~ 80 (106) T cd03500 2 SLAWLFQRITGVFLVFLLAGHFWVQHMDNGGDVIDFAFVANRLASPLWKVWDLLLLVLALLHGGNGLRNILLDYVRRPR 80 (106) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCH T ss_conf 2999999999999999999999999961667646699999987695999999999999999824117897998736822 No 10 >COG2142 SdhD Succinate dehydrogenase, hydrophobic anchor subunit [Energy production and conversion] Probab=98.52 E-value=2.1e-06 Score=54.36 Aligned_cols=76 Identities=17% Similarity=0.275 Sum_probs=61.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCHHH Q ss_conf 999999999999999999999999851630355467530683169999999999999999989999985212335899 Q gi|254781041|r 26 SIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKI 103 (129) Q Consensus 26 SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~~~~ 103 (129) ..+-|+||+++.+....+.+.. ....+..|+.....+.+++.|....+..++..||..||.|+.+-|+-+++..+. T Consensus 17 ~l~qRvTav~Lv~l~~~~l~~~--l~~~~~~y~~~~~~~a~p~~~v~~lL~l~~~l~H~~~Glr~Ii~DYi~~~~~r~ 92 (117) T COG2142 17 WLLQRVTAVILVLLVIWHLYFL--LTWLNATYAAWVAFLANPFWKVFLLLLLVAALIHAWNGLRVIIEDYIKPEKLRL 92 (117) T ss_pred HHHHHHHHHHHHHHHHHHHHHH--HHCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999--980799799999999688999999999999999999616999999973398999 No 11 >TIGR02968 succ_dehyd_anc succinate dehydrogenase, hydrophobic membrane anchor protein; InterPro: IPR014312 In Escherichia coli and many other bacteria, two small, hydrophobic, mutually homologous subunits of succinate dehydrogenase (a TCA cycle enzyme) are SdhC and SdhD. This entry is the SdhD, the hydrophobic membrane anchor protein. SdhC is apocytochrome b558, which also plays a role in anchoring the complex.. Probab=98.23 E-value=4.4e-05 Score=47.10 Aligned_cols=79 Identities=20% Similarity=0.207 Sum_probs=64.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCHHHHH Q ss_conf 99999999999999999999999985163035546753068316999999999999999998999998521233589999 Q gi|254781041|r 26 SIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIAT 105 (129) Q Consensus 26 SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~~~~~~ 105 (129) .+.-|+|++++....+.+.. ......+.+|+..++.++++..|+.......+..+|.-=|+|..+.|+=+..-++-.- T Consensus 8 w~~QR~TAv~~~~y~~~~~~--~~~~~~~~~Y~~w~~~f~~~~~~~~~~l~l~~~~~HawiGm~~v~~DYv~~~~lRl~l 85 (105) T TIGR02968 8 WLLQRVTAVVLALYTIFLIG--FLLALPGATYEAWRALFAHPWMKIFTLLALLALLYHAWIGMRVVLEDYVKPEGLRLVL 85 (105) T ss_pred HHHHHHHHHHHHHHHHHHHH--HHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH T ss_conf 99999999999999999999--9995589998999999866499999999999999973872676544223637999999 Q ss_pred H Q ss_conf 9 Q gi|254781041|r 106 Q 106 (129) Q Consensus 106 ~ 106 (129) . T Consensus 86 ~ 86 (105) T TIGR02968 86 Q 86 (105) T ss_pred H T ss_conf 9 No 12 >cd03497 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Bacillus subtilis SQR reduces low potential quinones such as menaquinone. SQR is also called succinate dehydrogenase (Sdh) or Complex II and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside on the transmembrane subunit. The transmembrane subunit of Bacillus subtilis SQR is also called Sdh cytochrome b558 subunit. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, Probab=98.17 E-value=0.00015 Score=44.27 Aligned_cols=109 Identities=13% Similarity=0.245 Sum_probs=84.8 Q ss_pred CCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHH---------CCCHHHHHHHHHCCCHHHHHHHHHHHHH Q ss_conf 77351026665999999999999999999999999999--851---------6303554675306831699999999999 Q gi|254781041|r 12 PHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFC--IAN---------GEHTLSSLRCYMDGSVFEVCLFLYTWAV 80 (129) Q Consensus 12 phL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~--~~~---------~~~~~~~~~~~~~~~~~k~~~~~~~~~~ 80 (129) |+-..|+..-+ +.+.+-|+||+++.+++....+-+-. ... .++.|+...+.+++++...+=.....+. T Consensus 80 ~n~~~y~~~rN-w~~~~qr~TGii~l~FIi~Hv~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~Yii~~la~ 158 (207) T cd03497 80 SNTGRYDYFRN-WMYTLQRITGIILLVFIAWHVWHTRFAEALGHVDIQTPEAGEANLSAMRNALASPLMLIFYIIGVLAA 158 (207) T ss_pred CCCCCCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHH T ss_conf 66676641401-99999999999999999999999999886065444667621358999999960809999999999999 Q ss_pred HHHHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999989999985212335899999999999999999999 Q gi|254781041|r 81 IHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121 (129) Q Consensus 81 ~yH~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~ 121 (129) .+|+.||+-=...+.|.-.+.++.+...++.....++++.. T Consensus 159 ~fHlanGlwSf~~twGit~sprsq~~~~~v~~~v~v~l~~~ 199 (207) T cd03497 159 VFHFANGLWTFLITWGITVSPRSQRVSTYVCLLVFVVVSFM 199 (207) T ss_pred HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999889999999833068999999999999999999999 No 13 >cd03498 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. C. glutamicum SQR reduces low potential quinones such as menaquinone. SQR is also called succinate dehydrogenase (Sdh) or Complex II and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunit. The transmembrane subunit of members of this subfamily is also called Sdh cytochrome b558 subunit based on the Bacillus subtilis protein. The structural arrangem Probab=97.87 E-value=0.0012 Score=39.30 Aligned_cols=101 Identities=13% Similarity=0.059 Sum_probs=71.4 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----------CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 66659999999999999999999999999998516----------30355467530683169999999999999999989 Q gi|254781041|r 19 LIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG----------EHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGI 88 (129) Q Consensus 19 ~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~----------~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGi 88 (129) .+-+.+.|-+-|+||+++..++.....-+-..... .|.|+.....+++++...+=.....++.+|+.+|+ T Consensus 86 ~~~~s~asr~M~~tG~ill~Fiv~Hl~~f~~~~~~~~~~~~~~~~~d~y~~v~~~F~~p~~~~~Yvvam~~L~~HL~HG~ 165 (209) T cd03498 86 KKLASLASRTMIWSGLIILLFIILHLLDFTFGVVGPVSPPMGVGRGDVYELLVASFQQPWIAALYVLAMVALGLHLSHGF 165 (209) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH T ss_conf 65456999999999999999999999998512115544666665015999999995164999999999999999999899 Q ss_pred HHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 99998521233589999999999999999999 Q gi|254781041|r 89 RYLIWDVSLCLDKKIATQMAKINIIASILTVL 120 (129) Q Consensus 89 RHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~ 120 (129) .-...+.|.. +.+..+....+....++++.+ T Consensus 166 ~Sa~qTlG~~-~~~~~~~~~~i~~~~a~~i~~ 196 (209) T cd03498 166 WSAFQTLGLN-NPRYRPALKAVGRVVAILIAG 196 (209) T ss_pred HHHHHHCCCC-CHHHHHHHHHHHHHHHHHHHH T ss_conf 9999982799-813589999999999999999 No 14 >cd03494 SQR_TypeC_SdhD Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. E. coli SQR, a member of this subfamily, reduces the high potential quinine, ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. SdhD and SdhC are the two transmembrane proteins of bacterial SQRs. They contain heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD an Probab=97.76 E-value=0.001 Score=39.63 Aligned_cols=70 Identities=19% Similarity=0.199 Sum_probs=58.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH Q ss_conf 999999999999999999999998516303554675306831699999999999999999899999852123 Q gi|254781041|r 27 IVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC 98 (129) Q Consensus 27 I~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g 98 (129) ...|+|++++......+...+ ...+|-+|+..+.+++++..|........+..+|.-=|+|+...|+=+. T Consensus 3 l~QRvTAvil~~Y~~~l~~~~--~~~~~~~y~~W~~~f~~~~~ki~t~l~~~sl~~HAWIGlw~V~tDYi~~ 72 (99) T cd03494 3 LVQRVTAVIMALYTIFLVGFL--LASPPLTYEAWSGLFSSLWMKIFTLLALLALLLHAWIGLWDILTDYVKP 72 (99) T ss_pred HHHHHHHHHHHHHHHHHHHHH--HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH T ss_conf 999999999999999999999--9869999999999997489999999999999999999688767872580 No 15 >PRK09488 sdhD succinate dehydrogenase cytochrome b556 small membrane subunit; Provisional Probab=97.74 E-value=0.0012 Score=39.19 Aligned_cols=72 Identities=21% Similarity=0.192 Sum_probs=59.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH Q ss_conf 99999999999999999999999998516303554675306831699999999999999999899999852123 Q gi|254781041|r 25 VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC 98 (129) Q Consensus 25 ~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g 98 (129) -.+..|+|++++......+... .....|-+|+..+.++++...|+.-.....++.+|..=|+|+...|+=+. T Consensus 15 DWl~QRvsAvim~~Y~~~l~~f--~~~~~~~~y~~W~~~F~~~~mkift~l~~lsl~~HAWIGlw~V~tDYik~ 86 (115) T PRK09488 15 DFILVRATAIVLTLYIIYMVGF--FATSGELTYEVWRGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKP 86 (115) T ss_pred HHHHHHHHHHHHHHHHHHHHHH--HHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH T ss_conf 9999999999999999999999--99779999999999985689999999999999999997576657865364 No 16 >cd03495 SQR_TypeC_SdhD_like Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E. coli SdhD subunit. One characterized protein is the respiratory Complex II SdhD subunit of the only eukaryotic member, Reclinomonas americana. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. It is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. E. coli SQR is classified as Type C SQRs because it contains two transmembrane subunits and one heme group. The SdhD and SdhC subunits are membrane anchor subunits containing heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is Probab=97.66 E-value=0.00054 Score=41.19 Aligned_cols=76 Identities=13% Similarity=0.054 Sum_probs=60.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCHHH Q ss_conf 999999999999999999999999851630355467530683169999999999999999989999985212335899 Q gi|254781041|r 26 SIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKI 103 (129) Q Consensus 26 SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~~~~ 103 (129) .+..|+|++++....+.+.+.+. ....++|+.+.+.+++++...........-.||+-.|++..+-|+=.+...|. T Consensus 3 W~~QRitAi~lipL~~wfi~~~~--~~~~~~y~~v~~~~~~p~~~il~~l~i~~~~~H~~lG~qvIIEDYIh~~~~k~ 78 (100) T cd03495 3 WWAQRVTAVALVPLVLWFVFSVA--LLLGASYAEVVAWLAHPFNAILLILTLVSAFYHARLGMQVVIEDYVHSEGLRL 78 (100) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH--HHCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHH T ss_conf 69999999999999999999999--87499999999999792999999999999999997088464102347843999 No 17 >cd03526 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction. SQR, also called succinate dehydrogenase or Complex II, is part of the citric acid cycle and the aerobic respiratory chain, while QFR is involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Type B proteins contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunits. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron donor/acc Probab=97.57 E-value=0.0023 Score=37.76 Aligned_cols=93 Identities=11% Similarity=0.010 Sum_probs=67.1 Q ss_pred CCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHH Q ss_conf 4989997735102666599999999999999999999999999985--16303554675306831699999999999999 Q gi|254781041|r 6 NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA--NGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHH 83 (129) Q Consensus 6 ~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~--~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH 83 (129) +.||..-|-+ |+ .-..+.+-+-|+||++++++.....+-..... ..++.++...+.+.++..-.+-.....+..+| T Consensus 74 ~a~~~~~~~~-~~-~~~t~~~~~Qr~TG~il~~fi~~Hl~~~~~~~~~~~~~~~~~~~~~f~~p~~~~~Ylv~l~a~~~H 151 (199) T cd03526 74 QALTFKTHKD-LM-HGDTTLWWIQAMTGFAMLFFGSVHLYIMMTQAQPDRTIGFVMSSNRMSSEWMWPLYIVLLFAVELH 151 (199) T ss_pred HHHHHHHHHH-CC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHH T ss_conf 8753316775-05-540699999999999999999999999996235788777899999994743999999999999999 Q ss_pred HHHHHHHHHHHCCHHCC Q ss_conf 99989999985212335 Q gi|254781041|r 84 MLGGIRYLIWDVSLCLD 100 (129) Q Consensus 84 ~~nGiRHL~wD~g~g~~ 100 (129) ..||+-=+....|.-.. T Consensus 152 ~~~Glws~~vtWGw~~~ 168 (199) T cd03526 152 GSVGLYSFAVTWGWFDG 168 (199) T ss_pred HHHHHHHHHHHHHCCCC T ss_conf 99879999999853568 No 18 >cd03498 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. C. glutamicum SQR reduces low potential quinones such as menaquinone. SQR is also called succinate dehydrogenase (Sdh) or Complex II and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunit. The transmembrane subunit of members of this subfamily is also called Sdh cytochrome b558 subunit based on the Bacillus subtilis protein. The structural arrangem Probab=96.96 E-value=0.024 Score=32.19 Aligned_cols=96 Identities=13% Similarity=0.165 Sum_probs=68.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CHHCCH- Q ss_conf 9999999999999999999985163035546753068--31699999999999999999899999852-----123358- Q gi|254781041|r 30 RITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG--SVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDK- 101 (129) Q Consensus 30 RitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~--~~~k~~~~~~~~~~~yH~~nGiRHL~wD~-----g~g~~~- 101 (129) =+||.++.+++......=.....+||.|+.....+++ ++......++..++..|...|++--.-.- .|..+. T Consensus 6 A~TGl~l~~Flv~Hl~gNl~~~~G~eafN~ya~~L~~~~~ll~i~~~~Ll~~~~~Hi~~ai~l~~~nr~ar~~~Y~~~~~ 85 (209) T cd03498 6 ALTGLFLVLFLLVHLLGNLKIFFGPEAFNAYAEFLHTLNPLLWIARLVLLVAAVLHIVFGLQLTIRNRAARPVRYAVKNR 85 (209) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC T ss_conf 69999999999999999999972999999999998407729999999999999999999999998845447876400167 Q ss_pred --HHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf --999999999999999999999999 Q gi|254781041|r 102 --KIATQMAKINIIASILTVLIVWII 125 (129) Q Consensus 102 --~~~~~s~~~vl~~sil~~~~~~~i 125 (129) ++...+....+...++..+++|=+ T Consensus 86 ~~~~s~asr~M~~tG~ill~Fiv~Hl 111 (209) T cd03498 86 KKLASLASRTMIWSGLIILLFIILHL 111 (209) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 65456999999999999999999999 No 19 >cd03526 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction. SQR, also called succinate dehydrogenase or Complex II, is part of the citric acid cycle and the aerobic respiratory chain, while QFR is involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Type B proteins contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunits. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron donor/acc Probab=95.39 E-value=0.18 Score=27.40 Aligned_cols=67 Identities=15% Similarity=0.054 Sum_probs=55.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCH--HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999998516303554675306831--69999999999999999989999985 Q gi|254781041|r 28 VHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSV--FEVCLFLYTWAVIHHMLGGIRYLIWD 94 (129) Q Consensus 28 ~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~--~k~~~~~~~~~~~yH~~nGiRHL~wD 94 (129) ++=+||+++..++......-.....|||.|+....++++.. .......+..++.+|..-|+|-..-+ T Consensus 4 ~qSlTGl~L~lFl~~Hm~~N~~i~~g~e~fn~~a~~l~~~p~l~~~~~~~i~~~~l~H~~~a~~~~~~~ 72 (199) T cd03526 4 LQSATGLFLGLFMIGHLFFNSTILLGDNVMNWVAKKFELLPIVVSFLAAFIFAVFIAHAFLGVRKFPIY 72 (199) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 998999999999999999999999199999999999865759999999999999999999999998997 No 20 >cd03497 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Bacillus subtilis SQR reduces low potential quinones such as menaquinone. SQR is also called succinate dehydrogenase (Sdh) or Complex II and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside on the transmembrane subunit. The transmembrane subunit of Bacillus subtilis SQR is also called Sdh cytochrome b558 subunit. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, Probab=95.24 E-value=0.2 Score=27.12 Aligned_cols=66 Identities=17% Similarity=0.140 Sum_probs=52.2 Q ss_pred HHHHHHHHH-HHHHHHHHHHHHHHHHHCCCHHHHHHHHHCC-CHHHHHH-HHHHHHHHHHHHHHHHHHH Q ss_conf 999999999-9999999999999985163035546753068-3169999-9999999999999899999 Q gi|254781041|r 27 IVHRITGSV-VYLGTPVVVFWFFCIANGEHTLSSLRCYMDG-SVFEVCL-FLYTWAVIHHMLGGIRYLI 92 (129) Q Consensus 27 I~HRitGi~-l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~-~~~k~~~-~~~~~~~~yH~~nGiRHL~ 92 (129) =+|-.+|++ +.+++......=..+..|+|.|+....++++ +..+.++ +++..|+.+|..-|+.-.. T Consensus 8 rlhSL~GvipvglFLi~Hl~~Nl~a~~G~e~FN~~a~fm~slP~l~~ie~~~i~lpll~Hai~Gi~i~~ 76 (207) T cd03497 8 RLHSLLGVVPIGLFLIEHLLTNSSAASGPEGFNAAVNFMHSLPGLLLIEIFGIFLPLLFHAIYGIYIAF 76 (207) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999999981989999999998859619999999999999999999999999 No 21 >cd00581 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinone oxidoreductase (SQR). QFRs oxidize low potential quinols such as menaquinol and rhodoquinol and are involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunit. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron donor (quinol). The Probab=94.70 E-value=0.19 Score=27.28 Aligned_cols=62 Identities=15% Similarity=0.125 Sum_probs=32.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHC---------CCHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999998516303554675306---------83169999999999999999989999 Q gi|254781041|r 30 RITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD---------GSVFEVCLFLYTWAVIHHMLGGIRYL 91 (129) Q Consensus 30 RitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~---------~~~~k~~~~~~~~~~~yH~~nGiRHL 91 (129) -+||+++..++........+...|||.++.+..+++ .++.+++.......+..|..-..|.+ T Consensus 6 s~TGl~LalFm~~Hm~fvSSILlg~~a~~~va~f~E~~~~~~~g~p~v~~~~~~~I~~~f~~Ha~lA~RK~ 76 (206) T cd00581 6 SATGLFLALFMWAHMLFVSSILLGKEAMYWVARFFEGAFFFGHGYPWVVSVVAAIVFALFVAHAFLALRKF 76 (206) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 88899999999999999999971899999999998510302788448999999999999999999999866 No 22 >TIGR02046 sdhC_b558_fam succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family; InterPro: IPR011138 This family contains succinate dehydrogenase subunit C of Bacillus subtilis, designated cytochrome b-558, and related sequences that include a fumarate reductase subunit C. This family is only weakly similar to the main group of succinate dehydrogenase cytochrome b subunits described by IPR000701 from INTERPRO, so that some members score above the gathering threshold and some do not .. Probab=94.26 E-value=0.36 Score=25.73 Aligned_cols=112 Identities=15% Similarity=0.097 Sum_probs=78.1 Q ss_pred CCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-------------------CHHHHHHHHH Q ss_conf 004989997735102666599999999999999999999999999985163-------------------0355467530 Q gi|254781041|r 4 IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE-------------------HTLSSLRCYM 64 (129) Q Consensus 4 m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~-------------------~~~~~~~~~~ 64 (129) .|+-||.+ =-..=|++ +.++|-+-|.||++...++....+-+......+ |.|+.+...+ T Consensus 87 ~~~ar~~~-Y~~~~~~~-~~~~s~~m~~~GIi~l~Fi~~H~~~f~~~~~~~~~~~~~~a~~~~DGfdhP~~~y~~~v~~F 164 (233) T TIGR02046 87 KRAARPVR-YAHKSRAK-ASWASRTMLVTGIIVLLFIGLHLLDFTLGAQLAEAFEMGVAKFRIDGFDHPADIYEMVVLTF 164 (233) T ss_pred HHCCCCCC-CCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH T ss_conf 86027888-53257001-14898899998799999999999999999874677778888867787666068999999986 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHH Q ss_conf 68316999999999999999998999998521233589999999999999999 Q gi|254781041|r 65 DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117 (129) Q Consensus 65 ~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil 117 (129) +++.....=..+..++.+|+-+|+-=.+.-.|.+.+.-..+..+...+...++ T Consensus 165 s~p~~~~~YiVa~l~L~fH~~HG~wSa~qTLG~n~t~~~~~ik~~s~v~al~i 217 (233) T TIGR02046 165 SSPIVLSIYIVAMLALGFHLSHGLWSAAQTLGLNSTIRSQRIKAVSNVVALVI 217 (233) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH T ss_conf 07168899999999999999999999999817988006788899999999999 No 23 >PRK13554 fumarate reductase cytochrome b-556 subunit; Provisional Probab=93.13 E-value=0.59 Score=24.59 Aligned_cols=90 Identities=12% Similarity=0.056 Sum_probs=69.5 Q ss_pred CCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCC-----------CHHHHHHH Q ss_conf 4989997735102666599999999999999999999999999985163035546753068-----------31699999 Q gi|254781041|r 6 NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG-----------SVFEVCLF 74 (129) Q Consensus 6 ~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~-----------~~~k~~~~ 74 (129) ..-|..-|-...--|.++..-...-+||+++..++........+...|+|.++.+..+++. ++.+++-. T Consensus 5 ~~~~~~~~~~~~g~~w~A~lD~~QS~TG~~LalFm~~HM~fvSSILlg~~a~~~Va~f~E~~~~~~~G~g~p~v~s~~~~ 84 (241) T PRK13554 5 TRVHTAVNTGPFGHPWSAKADKLQSATGIMLGCFLLLHMHFESSILLGKEAFYHVVQFLEGGMFSSTGHGFPIVTKVFSV 84 (241) T ss_pred CCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH T ss_conf 00451021787899860789999987889999999999998999752898999999998442776269887026889999 Q ss_pred HHHHHHHHHHHHHHHHHHHHC Q ss_conf 999999999999899999852 Q gi|254781041|r 75 LYTWAVIHHMLGGIRYLIWDV 95 (129) Q Consensus 75 ~~~~~~~yH~~nGiRHL~wD~ 95 (129) +....+.-|.+-..|.+=..+ T Consensus 85 ~I~~lf~vHa~lA~RKfP~~~ 105 (241) T PRK13554 85 FMLLVVIVHAAVALRRFPAQL 105 (241) T ss_pred HHHHHHHHHHHHHHHHCCCCH T ss_conf 999999999999986678058 No 24 >cd00546 QFR_TypeD_subunitC Quinol:fumarate reductase (QFR) Type D subfamily, 15kD hydrophobic subunit C; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine oxidoreductase (SQR). QFRs oxidize low potential quinols such as menaquinol and are involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type D as they contain two transmembrane subunits (C and D) and no heme groups. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron donor (quinol). The quinone binding site resides in the transmembrane subunits. Probab=93.03 E-value=0.59 Score=24.58 Aligned_cols=90 Identities=8% Similarity=0.099 Sum_probs=63.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH--HHHC---CHH Q ss_conf 99999999999999999999999999851630355467530683169999999999999999989999--9852---123 Q gi|254781041|r 24 FVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYL--IWDV---SLC 98 (129) Q Consensus 24 ~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL--~wD~---g~g 98 (129) ..-.++-.|.+....+...+.+++.++..|||+++.+..+..+++.-+.-.....+-.||...=..-. .++. |+- T Consensus 20 r~YMlRE~T~v~~~~f~lvLl~Gl~~L~~g~~aw~~f~~flqnP~vv~lniiaL~a~L~Ha~TwF~~~Pk~m~i~v~g~~ 99 (124) T cd00546 20 RFYMLREATAVPTVWFSLVLLYGLFALGSGPESWAGFVSFLQNPIVVLLNIIALAAALLHAKTWFEMAPKVMNIIVKGER 99 (124) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCHHEEEEECCEE T ss_conf 99999888379999999999999999806989999999998385999999999999999999999974230042178867 Q ss_pred CCHHHHHHHHHHHHH Q ss_conf 358999999999999 Q gi|254781041|r 99 LDKKIATQMAKINII 113 (129) Q Consensus 99 ~~~~~~~~s~~~vl~ 113 (129) .+.+...+..|.+.+ T Consensus 100 ~~~~~iv~~~wa~~~ 114 (124) T cd00546 100 VPPEAITKALWAVTA 114 (124) T ss_pred CCHHHHHHHHHHHHH T ss_conf 878999999999999 No 25 >pfam02967 consensus Probab=89.80 E-value=1.4 Score=22.56 Aligned_cols=78 Identities=12% Similarity=0.079 Sum_probs=53.1 Q ss_pred ECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCC----------CHHHHHHHHHHHHHHHHHHH Q ss_conf 02666599999999999999999999999999985163035546753068----------31699999999999999999 Q gi|254781041|r 17 YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG----------SVFEVCLFLYTWAVIHHMLG 86 (129) Q Consensus 17 yk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~----------~~~k~~~~~~~~~~~yH~~n 86 (129) -|...++..-...-+||+++..++........+...|||.++.+..+++. ++.+++..+....+.-|.+- T Consensus 13 kksr~~A~lD~~Qs~TGl~LalFm~~Hm~fvSSILlg~~a~~~va~f~E~~~~~~~gG~p~v~s~~a~~i~~lf~~Ha~l 92 (223) T pfam02967 13 KKSRWPAKLDFLQSLTGLFLALFLWAHMLFVSSILLGKEAMYWVAKFFEGSFFSSEGGYPWVTSIIAAVIFALFLAHAFL 92 (223) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 85676288999998789999999999999999985089899999999855676327995246899999999999999999 Q ss_pred HHHHHHHH Q ss_conf 89999985 Q gi|254781041|r 87 GIRYLIWD 94 (129) Q Consensus 87 GiRHL~wD 94 (129) ..|.+=-. T Consensus 93 A~RKfP~~ 100 (223) T pfam02967 93 AMRKFPAN 100 (223) T ss_pred HHHHCCCC T ss_conf 99766815 No 26 >PRK13553 fumarate reductase cytochrome b-556 subunit; Provisional Probab=88.69 E-value=1.7 Score=22.10 Aligned_cols=78 Identities=10% Similarity=0.089 Sum_probs=61.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCC----------CHHHHHHHHHHHHHHHHHHHH Q ss_conf 2666599999999999999999999999999985163035546753068----------316999999999999999998 Q gi|254781041|r 18 RLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG----------SVFEVCLFLYTWAVIHHMLGG 87 (129) Q Consensus 18 k~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~----------~~~k~~~~~~~~~~~yH~~nG 87 (129) |-+.++..-...-+||++|..++........+...|||.++.+..+++. ++.+++..+....+.-|.+-. T Consensus 17 ksr~~A~lD~~Qs~TGl~LalFm~~Hm~fvSSILlg~~a~~~Va~f~E~~~~~~~gG~p~v~s~~a~~I~~lf~vHa~lA 96 (252) T PRK13553 17 KSRIPAKLDFLQSATGLFLGLFMWAHMFFVSTILISDEAMYKVAKFFEGSFIFDKPGEPALVSFVAAGVIVIFVVHAFLA 96 (252) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 78864899999988899999999999999999850898999999997200240479851236999999999999999999 Q ss_pred HHHHHHHC Q ss_conf 99999852 Q gi|254781041|r 88 IRYLIWDV 95 (129) Q Consensus 88 iRHL~wD~ 95 (129) .|.+=..+ T Consensus 97 ~RKfP~~~ 104 (252) T PRK13553 97 MRKFPINY 104 (252) T ss_pred HHHCCCCH T ss_conf 97668058 No 27 >COG3029 FrdC Fumarate reductase subunit C [Energy production and conversion] Probab=88.22 E-value=1.8 Score=21.92 Aligned_cols=83 Identities=13% Similarity=0.229 Sum_probs=56.3 Q ss_pred CCCCCC-CCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHH Q ss_conf 962004-9899977351026665999999999999999999999999999851630355467530683169999999999 Q gi|254781041|r 1 MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWA 79 (129) Q Consensus 1 m~~m~~-~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~ 79 (129) |+++|. -||+-|.= +|-..--..-.+--+|.+-...+...+.+++.+...+|++++.+.++..+++.-+.-.....+ T Consensus 1 ~skrk~Yvrpm~~tW--Wkkl~fYr~yMlRE~T~ip~vwF~l~L~~gl~al~~gp~~~~~fldFl~NPvVv~lNlitL~a 78 (129) T COG3029 1 TSKRKPYVRPMTRTW--WKKLPFYRFYMLREATAIPAVWFSLELIYGLFALGSGPEAWQGFLDFLANPVVVILNLITLAA 78 (129) T ss_pred CCCCCCCCCCCCHHH--HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCEEEEEHHHHHHH T ss_conf 997661006341678--860837999999873058999999999999999705956788899985498587516999999 Q ss_pred HHHHHH Q ss_conf 999999 Q gi|254781041|r 80 VIHHML 85 (129) Q Consensus 80 ~~yH~~ 85 (129) ..+|.. T Consensus 79 ~LlHt~ 84 (129) T COG3029 79 ALLHTV 84 (129) T ss_pred HHHHHH T ss_conf 999999 No 28 >pfam02313 Fumarate_red_D Fumarate reductase subunit D. Fumarate reductase is a membrane-bound flavoenzyme consisting of four subunits, A-B. A and B comprise the membrane-extrinsic catalytic domain and C and D link the catalytic centres to the electron-transport chain. This family consists of the 13kD hydrophobic subunit D. Probab=87.92 E-value=1.9 Score=21.82 Aligned_cols=46 Identities=9% Similarity=0.142 Sum_probs=41.1 Q ss_pred CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHC Q ss_conf 3035546753068316999999999999999998999998521233 Q gi|254781041|r 54 EHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCL 99 (129) Q Consensus 54 ~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g~ 99 (129) ..+|+.+..+..++++|++......-...|-+--+.|-+=|++..- T Consensus 48 a~~y~~i~aFa~s~iG~l~ll~~i~lplWh~~HRihhglHDlkih~ 93 (118) T pfam02313 48 ALSYDRIIAFAQSWIGKLFLLVLIILPLWHAMHRIHHGLHDLKIHR 93 (118) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCEEC T ss_conf 2589999999970899999999999999999999998776410121 No 29 >PRK13603 fumarate reductase subunit C; Provisional Probab=81.56 E-value=3.8 Score=20.15 Aligned_cols=89 Identities=7% Similarity=-0.032 Sum_probs=59.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH--HHHHHC---CHHC Q ss_conf 99999999999999999999999998516303554675306831699999999999999999899--999852---1233 Q gi|254781041|r 25 VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIR--YLIWDV---SLCL 99 (129) Q Consensus 25 ~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiR--HL~wD~---g~g~ 99 (129) .-.+--.|.+-...+...+.+++.+...|||+++.+.++..+++.-++-.....+-.||.-.=.- -=.++. |.-. T Consensus 21 ~YMlRE~T~vp~vwF~l~L~~Gl~~L~~g~~aw~~fl~flqNPivv~lNiiaL~a~L~Ha~TwF~maPkam~I~vk~e~l 100 (126) T PRK13603 21 RFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHAVTWFGSAPRAMVIQVRGRRV 100 (126) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCC T ss_conf 99997762799999999999999997059889999999971967899999999999998999998663304753658288 Q ss_pred CHHHHHHHHHHHHH Q ss_conf 58999999999999 Q gi|254781041|r 100 DKKIATQMAKINII 113 (129) Q Consensus 100 ~~~~~~~s~~~vl~ 113 (129) +.+...+.-|.+.+ T Consensus 101 ~~~~iv~~~wa~t~ 114 (126) T PRK13603 101 PARAVLAGHYAAWL 114 (126) T ss_pred CHHHHHHHHHHHHH T ss_conf 70577888999999 No 30 >PRK04987 fumarate reductase subunit C; Provisional Probab=79.56 E-value=4.5 Score=19.77 Aligned_cols=91 Identities=8% Similarity=0.073 Sum_probs=65.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH--HHH---CCHH Q ss_conf 99999999999999999999999999851630355467530683169999999999999999989999--985---2123 Q gi|254781041|r 24 FVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYL--IWD---VSLC 98 (129) Q Consensus 24 ~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL--~wD---~g~g 98 (129) ..-.+.-.|++....+...+.+++.+...|||+++.+..+..+++.-+.-.....+-.||...=..-. .+. -|.. T Consensus 23 r~YMlRE~T~v~~~~f~lvLl~Gl~~L~~g~~aw~~fv~flqnPivvilniiaLaa~L~Ha~TwF~~~Pk~m~i~v~~~~ 102 (129) T PRK04987 23 RFYMLREATAVPAVWFSLVLIYGLFALKSGPEAWAGFVSFLQNPVVVILNIITLAAALLHTKTWFEMAPKVMNIIVKDEK 102 (129) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 99999998579999999999999999806988999999998485999999999999999999999985577546726861 Q ss_pred CCHHHHHHHHHHHHHH Q ss_conf 3589999999999999 Q gi|254781041|r 99 LDKKIATQMAKINIIA 114 (129) Q Consensus 99 ~~~~~~~~s~~~vl~~ 114 (129) .+.+...+.-|.+.+. T Consensus 103 l~~~~i~~~~wa~~~~ 118 (129) T PRK04987 103 MGPEPIIKALWAVTAV 118 (129) T ss_pred CCHHHHHHHHHHHHHH T ss_conf 7849999999999999 No 31 >cd00547 QFR_TypeD_subunitD Quinol:fumarate reductase (QFR) Type D subfamily, 13kD hydrophobic subunit D; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine oxidoreductase (SQR). QFRs oxidize low potential quinols such as menaquinol and are involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type D as they contain two transmembrane subunits (C and D) and no heme groups. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron donor (quinol). The quinone binding site resides in the transmembrane subunits. Probab=79.32 E-value=4.6 Score=19.73 Aligned_cols=44 Identities=9% Similarity=0.172 Sum_probs=40.4 Q ss_pred CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH Q ss_conf 30355467530683169999999999999999989999985212 Q gi|254781041|r 54 EHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97 (129) Q Consensus 54 ~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~ 97 (129) ..+|+.+..+..++++|++......-...|-+--++|-+=|++. T Consensus 44 a~sy~~i~aFa~s~iGkl~ll~~i~lplWh~~HRihhglHDlki 87 (115) T cd00547 44 ALSYDRIIAFAQSWIGKLFLLVLIILPMWHAMHRIHHGLHDLKI 87 (115) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 47999999999608999999999999999999999987665141 No 32 >pfam02300 Fumarate_red_C Fumarate reductase subunit C. Fumarate reductase is a membrane-bound flavoenzyme consisting of four subunits, A-B. A and B comprise the membrane-extrinsic catalytic domain and C and D link the catalytic centres to the electron-transport chain. This family consists of the 15kD hydrophobic subunit C. Probab=79.10 E-value=4.6 Score=19.69 Aligned_cols=106 Identities=9% Similarity=0.070 Sum_probs=71.6 Q ss_pred CCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 98999773510266659999999999999999999999999998516303554675306831699999999999999999 Q gi|254781041|r 7 NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLG 86 (129) Q Consensus 7 ~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~n 86 (129) -||+.|+=-. -..-=..-.+.-.|.+....+...+.+++.++..|||+++.+..+..+++.-+.-.....+-.||... T Consensus 8 vR~m~~~WW~--k~~FYr~YMlRE~T~v~~~~f~lvLl~Gl~~L~~G~~aw~~f~~flqnP~vv~lniiaL~a~L~Ha~T 85 (128) T pfam02300 8 VREMKPTWWK--KLDFYRFYMLREGTAVPTVWFSLVLLYGLFALSQGPEAWNGFVSFLQNPVVVILNIIALAAALLHTKT 85 (128) T ss_pred CCCCCCCHHH--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH T ss_conf 4889964665--58489999998883799999999999999998068889999999983859999999999999999999 Q ss_pred HHHHH--HHH---CCHHCCHHHHHHHHHHHHHH Q ss_conf 89999--985---21233589999999999999 Q gi|254781041|r 87 GIRYL--IWD---VSLCLDKKIATQMAKINIIA 114 (129) Q Consensus 87 GiRHL--~wD---~g~g~~~~~~~~s~~~vl~~ 114 (129) =..-. .++ -|...+.+...+..|.+.+. T Consensus 86 wF~~~Pk~m~i~v~g~~l~~~~iv~~~wa~~~~ 118 (128) T pfam02300 86 WFSLAPKAMNIIVKGERLPPEVIVKGLWAATAV 118 (128) T ss_pred HHHHCHHHHHHHCCCCCCCHHHHHHHHHHHHHH T ss_conf 998741641122379038769999999999999 No 33 >PRK05470 fumarate reductase subunit D; Provisional Probab=57.16 E-value=14 Score=17.00 Aligned_cols=47 Identities=13% Similarity=0.149 Sum_probs=41.8 Q ss_pred HCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH Q ss_conf 16303554675306831699999999999999999899999852123 Q gi|254781041|r 52 NGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC 98 (129) Q Consensus 52 ~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nGiRHL~wD~g~g 98 (129) .+..+|+.+..+..++++|++.+........|-+--+-|-+=|++.- T Consensus 46 ~~a~~y~~i~aFa~~~iGkl~ll~~i~lplWh~~HRihHglHDlkih 92 (118) T PRK05470 46 GDALSYERVLAFAQSFIGKLFLLLMIVLPLWHGLHRIHHGMHDLKIH 92 (118) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 76336999999997068999999999999999999999877663000 No 34 >PRK13867 type IV secretion system chaperone VirE1; Provisional Probab=35.62 E-value=15 Score=16.97 Aligned_cols=28 Identities=32% Similarity=0.310 Sum_probs=16.6 Q ss_pred CCCCCCCCCCCCCEECCCHH--HHHHHHHHHHH Q ss_conf 20049899977351026665--99999999999 Q gi|254781041|r 3 SIKNNRPLSPHLQIYRLIPT--MFVSIVHRITG 33 (129) Q Consensus 3 ~m~~~RPlsphL~iyk~~~t--~~~SI~HRitG 33 (129) |.++|||+||- -|||-- --+|..||--| T Consensus 7 nankn~pv~~~---e~p~~~h~ee~s~~~~~ng 36 (63) T PRK13867 7 NANKNRPVSPI---ERPEEIHIEEMSGSHPSNG 36 (63) T ss_pred CCCCCCCCCCC---CCHHHHHHHHHCCCCCCCC T ss_conf 25778765775---4647877988523568898 No 35 >pfam02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain. Probab=31.99 E-value=16 Score=16.71 Aligned_cols=11 Identities=36% Similarity=0.751 Sum_probs=8.9 Q ss_pred CCCCCCCCCCE Q ss_conf 49899977351 Q gi|254781041|r 6 NNRPLSPHLQI 16 (129) Q Consensus 6 ~~RPlsphL~i 16 (129) +.||+||+|.+ T Consensus 41 kGr~ISanlP~ 51 (67) T pfam02941 41 KGRPISANLPF 51 (67) T ss_pred CCCEECCCCCE T ss_conf 69695699879 No 36 >pfam10573 UPF0561 Uncharacterized protein family UPF0561. This family of proteins has no known function. Probab=26.11 E-value=34 Score=14.99 Aligned_cols=17 Identities=35% Similarity=0.585 Sum_probs=14.2 Q ss_pred CCCCCCCCCCCEECCCH Q ss_conf 04989997735102666 Q gi|254781041|r 5 KNNRPLSPHLQIYRLIP 21 (129) Q Consensus 5 ~~~RPlsphL~iyk~~~ 21 (129) +.+||--|.+|+|.|+- T Consensus 58 ~~~r~rkpd~qVY~Pr~ 74 (126) T pfam10573 58 TPRRPRRPDLQVYHPRH 74 (126) T ss_pred CCCCCCCCCCEEECCCC T ss_conf 98888897531544442 No 37 >TIGR00947 2A73 inorganic carbon transporter; InterPro: IPR006007 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate.2 L-glutamate + NADP+ = L-glutamine + 2-oxoglutarate + NADPH + H+ This family includes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including Escherichia coli. Many photosynthetic organisms including cyanobacteria can concentrate CO_2/HCO_3^- against a greater than ten-fold concentration gradient. In cyanobacteria, the CO_2 concentrating mechanism involves: CO_2 conversion to HCO_3^- energy-dependent HCO_3^- transport, and carbonic anhydrase-catalyzed formation of CO_2 from HCO_3^- in the carboxysomes. The gene believed to encode the transporter, possibly a Na^+:HCO_3^- symporter, is designated ictB or ORF467 in Synechococcus sp. strain PCC 7942. The protein is 467 amino acyl residues long and possesses 10 putative transmembrane alpha-helical spanners. . Probab=23.95 E-value=25 Score=15.74 Aligned_cols=23 Identities=26% Similarity=0.205 Sum_probs=19.6 Q ss_pred CEECCCHHHHHHHHHHHHHHHHH Q ss_conf 51026665999999999999999 Q gi|254781041|r 15 QIYRLIPTMFVSIVHRITGSVVY 37 (129) Q Consensus 15 ~iyk~~~t~~~SI~HRitGi~l~ 37 (129) .-|+||--.-.|.+||.-|-.-+ T Consensus 7 ~~y~PQ~WG~~S~LHRL~G~~~~ 29 (467) T TIGR00947 7 AGYSPQEWGRSSVLHRLVGSLRA 29 (467) T ss_pred CCCCCCCCCCCCHHHHHHHHHHH T ss_conf 77787433652046777632788 No 38 >pfam00584 SecE SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex. Probab=23.38 E-value=54 Score=13.85 Aligned_cols=41 Identities=12% Similarity=0.478 Sum_probs=29.8 Q ss_pred HHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999899999852123358999999999999999999999999752 Q gi|254781041|r 83 HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDI 128 (129) Q Consensus 83 H~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~~~~i~~~ 128 (129) ..-+.+|...|- +.++...+..++++.+++.++++|.+..+ T Consensus 8 ~v~~ElkkV~WP-----tr~e~~~~t~~Vi~~~~i~~~~~~~vD~~ 48 (56) T pfam00584 8 EVKAELKKVVWP-----TRKETLKTTVVVLIFVLVMALFLWLVDLV 48 (56) T ss_pred HHHHHHHHCCCC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999997836598-----97999869999999999999999999999 No 39 >PRK05740 secE preprotein translocase subunit SecE; Reviewed Probab=23.25 E-value=55 Score=13.83 Aligned_cols=47 Identities=23% Similarity=0.432 Sum_probs=37.5 Q ss_pred HHHHHHHHHHHHHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999899999852123358999999999999999999999999752 Q gi|254781041|r 77 TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDI 128 (129) Q Consensus 77 ~~~~~yH~~nGiRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~~~~i~~~ 128 (129) .+.|.-..-..+|...|-. .++...+..++++..++.++++|.+-.+ T Consensus 68 ~~~f~~e~~~E~rKVvWPt-----r~Et~~~T~iV~~~vii~~l~lw~~D~~ 114 (124) T PRK05740 68 FFAFAKESRTEVRKVVWPT-----RQETLQTTLIVIAVVIVMALILWGLDSI 114 (124) T ss_pred HHHHHHHHHHHHHHCCCCC-----HHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999573998-----6998879999999999999999999999 Done!