HHsearch alignment of GI: 254781041 and MMDB domain: 2wdq_C_

>2wdq_C (C:) Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C*
Probab=100.00  E-value=2.2e-43  Score=255.92  Aligned_cols=125  Identities=18%  Similarity=0.341  Sum_probs=120.1

Q ss_pred             CCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             96200498999773510266659999999999999999999999999998516303554675306831699999999999
Q gi|254781041|r    1 MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAV   80 (129)
Q Consensus         1 m~~m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~   80 (129)
                      +.|||+|||+||||||||+|++|++||+||+||++++++++++.+++.....+||+|+.+...++++++|++++++.+++
T Consensus         2 a~~~~~~RP~sPhL~iYr~~~~~~~SIlHRiTG~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~   81 (129)
T 2wdq_C            2 IRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTAL   81 (129)
T ss_dssp             ------CCCBCCCGGGSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHSHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             10014699999985624632999999999999999999999999999997223027999999997799999999999999


Q ss_pred             HHHHHHHHHHHHHHCCHHCC-HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999989999985212335-8999999999999999999999999
Q gi|254781041|r   81 IHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTVLIVWII  125 (129)
Q Consensus        81 ~yH~~nGiRHL~wD~g~g~~-~~~~~~s~~~vl~~sil~~~~~~~i  125 (129)
                      .||++||+||++||+|+|++ +++++++++++++++++.++..|+.
T Consensus        82 ~yH~~nGiRHL~~D~g~g~~~~~~~~~s~~~v~~~s~~~t~~~~~~  127 (129)
T 2wdq_C           82 AYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITVVLSLLAGVL  127 (129)
T ss_dssp             HHHHHHHHHHHHHHTTSSCCSHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999983999999823003468999999999999999999999999