BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781041|ref|YP_003065454.1| succinate dehydrogenase
protein, cytochrome b subunit [Candidatus Liberibacter asiaticus str.
psy62]
         (129 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781041|ref|YP_003065454.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040718|gb|ACT57514.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 129

 Score =  262 bits (670), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL
Sbjct: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL
Sbjct: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120

Query: 121 IVWIIKDIV 129
           IVWIIKDIV
Sbjct: 121 IVWIIKDIV 129


>gi|315122380|ref|YP_004062869.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495782|gb|ADR52381.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 129

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/128 (64%), Positives = 101/128 (78%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K+NRPLSPHLQIY+LIPTM +SIVHRITGS VY GTP +V WFF +A G++TL   
Sbjct: 1   MSDLKSNRPLSPHLQIYKLIPTMLISIVHRITGSAVYFGTPALVLWFFAVAEGKYTLGLW 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           R Y D   F + LFLYTW+ IHHMLGGIRYL+WD S  L+KK++  MAKINIIASI  V 
Sbjct: 61  RSYTDCGFFSIFLFLYTWSAIHHMLGGIRYLMWDSSFLLEKKVSITMAKINIIASIFIVS 120

Query: 121 IVWIIKDI 128
           ++WI+K+I
Sbjct: 121 VIWIVKNI 128


>gi|90421134|ref|ZP_01229036.1| succinate dehydrogenase, cytochrome b subunit [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334626|gb|EAS48406.1| succinate dehydrogenase, cytochrome b subunit [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 130

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 83/124 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K  RPLSPHL IYR  PTM +SI+HRITGS +Y+GT + V+W    A+G    S  
Sbjct: 1   MSDLKTARPLSPHLSIYRFRPTMAMSILHRITGSALYVGTLLFVWWLIAAASGPEAFSYA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             +    +  + LF YTWA++HHM GGIR+LIWD  + L K+ +T++A+  ++AS+   L
Sbjct: 61  SAFFGSIIGRIILFGYTWALLHHMFGGIRHLIWDTGIGLSKETSTKLAQATLVASLALTL 120

Query: 121 IVWI 124
           I+W+
Sbjct: 121 ILWV 124


>gi|86359478|ref|YP_471370.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium
           etli CFN 42]
 gi|190893746|ref|YP_001980288.1| succinate dehydrogenase, cytochrome b subunit [Rhizobium etli CIAT
           652]
 gi|218515347|ref|ZP_03512187.1| succinate dehydrogenase protein, cytochrome b subunit [Rhizobium
           etli 8C-3]
 gi|86283580|gb|ABC92643.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium
           etli CFN 42]
 gi|190699025|gb|ACE93110.1| succinate dehydrogenase protein, cytochrome b subunit [Rhizobium
           etli CIAT 652]
          Length = 131

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 91/129 (70%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQ+Y+LIPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQVYKLIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQASYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+L+WD+    +K+++T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHLMWDLGYGFEKEVSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|327188889|gb|EGE56081.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium
           etli CNPAF512]
          Length = 146

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 89/125 (71%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQ+Y+LIPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 16  MANVTNNRPLSPHLQVYKLIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQASYDWA 75

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+L+WD+    +K+++T++A  NII S+   +
Sbjct: 76  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHLMWDLGYGFEKEVSTKLAIANIIGSLCLTV 135

Query: 121 IVWII 125
           +VW++
Sbjct: 136 LVWVV 140


>gi|222087469|ref|YP_002546006.1| succinate dehydrogenase, cytochrome b556 subunit [Agrobacterium
           radiobacter K84]
 gi|221724917|gb|ACM28073.1| succinate dehydrogenase, cytochrome b556 subunit [Agrobacterium
           radiobacter K84]
          Length = 133

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 82/125 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  NRPLSPHLQIY+ IPTM +SIVHRITG  +Y GT +V +W    A G+     +
Sbjct: 2   MANVTQNRPLSPHLQIYKPIPTMIMSIVHRITGGALYFGTVLVAWWLIAAATGQGYFELV 61

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              M   +  + LF YTWA++HHMLGG+R+ +WD+     K+ +T++AK  ++ S+    
Sbjct: 62  NWIMGTIIGRLVLFGYTWALLHHMLGGLRHFMWDLGYGFGKEFSTKLAKATLVGSLCLTA 121

Query: 121 IVWII 125
           +VWII
Sbjct: 122 LVWII 126


>gi|227823652|ref|YP_002827625.1| putative succinate dehydrogenase membrane anchor subunit
           [Sinorhizobium fredii NGR234]
 gi|227342654|gb|ACP26872.1| putative succinate dehydrogenase membrane anchor subunit
           [Sinorhizobium fredii NGR234]
          Length = 130

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 84/129 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  +RPLSPHLQIY+ IPTM +SIVHRITG  +Y GT +V +W    A+G      +
Sbjct: 1   MTNVTRSRPLSPHLQIYKPIPTMVMSIVHRITGGALYFGTILVAWWLIAAASGAAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  + ++ LF YTWA++HHMLGGIR+ IWD+    +K  AT+MAK  +  S+   L
Sbjct: 61  NWLFGTLIGKLVLFGYTWALVHHMLGGIRHFIWDLGYGYEKHFATKMAKGTLAGSVALTL 120

Query: 121 IVWIIKDIV 129
           ++WI+  +V
Sbjct: 121 LLWIVGSLV 129


>gi|325294014|ref|YP_004279878.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium sp.
           H13-3]
 gi|325061867|gb|ADY65558.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium sp.
           H13-3]
          Length = 130

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 85/129 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM  SIVHRITG+ +Y GT +V +W   +A+G      +
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVASIVHRITGAALYFGTLLVAWWLIALASGPAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              M   + ++ L  YTWA++HHMLGG+R+ +WD+    +K   T++AK   +ASI    
Sbjct: 61  SWAMGTIIGKLILIGYTWALVHHMLGGLRHFMWDLGHGFEKNFNTKLAKATFVASICLTA 120

Query: 121 IVWIIKDIV 129
           ++W+I  IV
Sbjct: 121 LIWVIALIV 129


>gi|159185307|ref|NP_355582.2| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           tumefaciens str. C58]
 gi|159140565|gb|AAK88367.2| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 130

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 84/129 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM  SIVHRITG  +Y GT +V +W   +A+G      +
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVASIVHRITGGALYFGTLLVAWWLIALASGPAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              M   +  + L  YTWA++HHMLGG+R+ +WD+    DK   T++AK + +ASI    
Sbjct: 61  NWAMGTIIGRLILIGYTWALVHHMLGGLRHFMWDLGHGFDKHFTTKLAKASWVASICLTA 120

Query: 121 IVWIIKDIV 129
           ++W+I  IV
Sbjct: 121 LIWVIVLIV 129


>gi|209551264|ref|YP_002283181.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|241206664|ref|YP_002977760.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|209537020|gb|ACI56955.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|240860554|gb|ACS58221.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 131

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 87/129 (67%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQGSYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+ +WD+     K+ +T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHFMWDLGYGFGKEFSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|116254178|ref|YP_770016.1| succinate dehydrogenase cytochrome b556 subunit [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258826|emb|CAK09932.1| putative succinate dehydrogenase cytochrome b556 subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 131

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 87/129 (67%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMIMSIVHRITGGALYVGTILVAWWLIAAASGQGSYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+ +WD+     K+ +T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHFMWDLGYGFGKEFSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|15966825|ref|NP_387178.1| succinate dehydrogenase cytochrome B-556 subunit transmembrane
           protein [Sinorhizobium meliloti 1021]
 gi|307301653|ref|ZP_07581412.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti BL225C]
 gi|307316323|ref|ZP_07595767.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti AK83]
 gi|15076097|emb|CAC47651.1| Probable succinate dehydrogenase cytochrome B-556 subunit
           transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898163|gb|EFN28905.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti AK83]
 gi|306903351|gb|EFN33940.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti BL225C]
          Length = 130

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 83/125 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  +RPLSPHLQIY+ IPTM +SI+HRITG  +Y GT +V +W    A+G      +
Sbjct: 1   MTNVTRSRPLSPHLQIYKPIPTMIMSIMHRITGGALYFGTVLVAWWLIAAASGTAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  + +V LF YTWA++HH+LGGIR+L WD+    +K  AT+MAK  I+AS    L
Sbjct: 61  NWLFGTFIGKVVLFGYTWALVHHLLGGIRHLAWDLGYGYEKHFATRMAKAMIVASATLTL 120

Query: 121 IVWII 125
           ++W++
Sbjct: 121 VIWVV 125


>gi|218682066|ref|ZP_03529667.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium etli
           CIAT 894]
          Length = 131

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 86/129 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQGSYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + +  L  YTWA++HHMLGG R+ +WD+     K+ +T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKFVLLGYTWALLHHMLGGFRHFMWDLGYGFGKEFSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|150398156|ref|YP_001328623.1| succinate dehydrogenase cytochrome b556 subunit [Sinorhizobium
           medicae WSM419]
 gi|150029671|gb|ABR61788.1| Succinate dehydrogenase cytochrome b556 subunit [Sinorhizobium
           medicae WSM419]
          Length = 130

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 84/125 (67%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  +RPLSPHLQIY+ IPTM +SI+HRITG  +Y GT +V +W    A+G      +
Sbjct: 1   MTNVTRSRPLSPHLQIYKPIPTMIMSIMHRITGGALYFGTVLVAWWLIAAASGTAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             +    + +V LF YTWA++HH+LGGIR+L WD+    +K  AT++AK  I+AS    L
Sbjct: 61  NWFFGTLIGKVVLFGYTWALMHHLLGGIRHLGWDLGYGYEKHFATRVAKAMIVASAALTL 120

Query: 121 IVWII 125
           ++WI+
Sbjct: 121 VIWIV 125


>gi|114707253|ref|ZP_01440151.1| succinate dehydrogenase cytochrome B-556 subunit protein
           [Fulvimarina pelagi HTCC2506]
 gi|114537449|gb|EAU40575.1| succinate dehydrogenase cytochrome B-556 subunit protein
           [Fulvimarina pelagi HTCC2506]
          Length = 129

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 53/124 (42%), Positives = 79/124 (63%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K+NRPLSPHL IY+  PTM +SIVHRITG  +Y GT ++V+W    A+GE    + 
Sbjct: 1   MSDVKSNRPLSPHLSIYKFRPTMAMSIVHRITGGALYFGTILIVWWLIAAASGEAAFETA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             +    +  + L  Y+WA+ HH LGGIR+ IWD    L K+ +T+ A++ ++ S+    
Sbjct: 61  SWFFGSFIGILILMGYSWALFHHALGGIRHFIWDTGHGLSKETSTKFAQMTLVGSLGLTA 120

Query: 121 IVWI 124
           I+W+
Sbjct: 121 ILWL 124


>gi|218507957|ref|ZP_03505835.1| succinate dehydrogenase protein, cytochrome b subunit [Rhizobium
           etli Brasil 5]
          Length = 111

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 79/111 (71%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQ+Y+LIPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQVYKLIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQASYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN 111
              +   + ++ L  YTWA++HHMLGG R+L+WD+    +K+++T++A  N
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHLMWDLGYGFEKEVSTKLAIAN 111


>gi|254470646|ref|ZP_05084049.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudovibrio sp.
           JE062]
 gi|211959788|gb|EEA94985.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudovibrio sp.
           JE062]
          Length = 132

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 81/128 (63%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           + +K NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ FW  C A G  +     
Sbjct: 4   ADLKANRPLSPHLQIYKPIVTMVMSILHRITGAALYFGTILMAFWLVCAAAGPESYQFAM 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 + ++ LF +TWA++HHMLGG+R+ +WD+    D   A  MA+  II S+   +I
Sbjct: 64  DVFGSFLGQLVLFGFTWALVHHMLGGLRHFVWDMGHGFDLSAANWMARATIIGSVSLTVI 123

Query: 122 VWIIKDIV 129
           +WII  IV
Sbjct: 124 LWIIGFIV 131


>gi|222150048|ref|YP_002551005.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           vitis S4]
 gi|221737030|gb|ACM37993.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           vitis S4]
          Length = 130

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 76/115 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++   RPLSPHLQIY+L+PTM +SIVHRITG  +Y GT +V +W    + G      +
Sbjct: 1   MANVTKQRPLSPHLQIYKLVPTMLMSIVHRITGGALYFGTALVAWWLIAASTGADYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
             +M   + ++ LF ++WA+IHHMLGG+R+  WD+   L+K   T++AK   +AS
Sbjct: 61  SWFMGTFIGKIILFGFSWALIHHMLGGMRHFAWDLGYGLEKHFNTKLAKATAVAS 115


>gi|163761421|ref|ZP_02168495.1| putative succinate dehydrogenase cytochrome b556 subunit [Hoeflea
           phototrophica DFL-43]
 gi|162281416|gb|EDQ31713.1| putative succinate dehydrogenase cytochrome b556 subunit [Hoeflea
           phototrophica DFL-43]
          Length = 163

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 78/124 (62%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  NRPLSPHL IY+ IPTM +SI+HR+TG  +Y GT +V +W    A+G      +
Sbjct: 33  MTNVTQNRPLSPHLSIYKQIPTMVMSILHRLTGMALYAGTILVAWWLIAAASGPEYFDWV 92

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+LGGIR+ IWD     D + +T+MA   I  S++  +
Sbjct: 93  NGIFGSLLGRLVLFGYTWALVHHLLGGIRHFIWDTGHGFDPQTSTKMAWATITGSVILTV 152

Query: 121 IVWI 124
           ++WI
Sbjct: 153 LIWI 156


>gi|304394275|ref|ZP_07376198.1| succinate dehydrogenase, cytochrome b556 subunit [Ahrensia sp.
           R2A130]
 gi|303293715|gb|EFL88092.1| succinate dehydrogenase, cytochrome b556 subunit [Ahrensia sp.
           R2A130]
          Length = 138

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 76/121 (62%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPHL+IY+ IPTM +SI+HR+TG+ +Y GT +V +W    A+G     +   
Sbjct: 9   TTRKPRPLSPHLEIYKPIPTMVMSILHRVTGAALYFGTILVAWWLLAAASGPEAFETASN 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +       + LF YT A+IHHMLGG+++L+ D    LDK   T+MAK   + SI+  +++
Sbjct: 69  FFGSWFGRLVLFGYTLALIHHMLGGMKHLVQDTGRGLDKDFTTKMAKAQPVLSIIITVLI 128

Query: 123 W 123
           W
Sbjct: 129 W 129


>gi|13473609|ref|NP_105177.1| succinate dehydrogenase membrane anchor subunit [Mesorhizobium loti
           MAFF303099]
 gi|14024359|dbj|BAB50963.1| succinate dehydrogenase membrane anchor subunit [Mesorhizobium loti
           MAFF303099]
          Length = 139

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 75/120 (62%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHL IYR   TM +SI+HRITG  +Y GT +V  W    A+ + T   +    
Sbjct: 12  RRERPLSPHLTIYRPPITMTMSIIHRITGGALYFGTLLVAIWLMAAASSQATFDWVNWAF 71

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF YTWA++HHMLGG+R+L+WD    L+K  A+++A   ++ S+L  L++WI
Sbjct: 72  GTWLGRLILFGYTWALMHHMLGGVRHLVWDTGAGLEKHTASKIAWATLVGSVLLTLLIWI 131


>gi|319780753|ref|YP_004140229.1| succinate dehydrogenase cytochrome b556 subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166641|gb|ADV10179.1| succinate dehydrogenase, cytochrome b556 subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 139

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 74/125 (59%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RP+SPHL +YR   TM +SI+HRITG  +Y GT +V  W    A+ + T        
Sbjct: 12  RRERPISPHLTVYRPPITMTMSIIHRITGGALYFGTLLVALWLMAAASSQATFDWANWAF 71

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF YTWA++HHMLGG+R+LIWD    L+K  A+++A   +  SIL  L++WI
Sbjct: 72  GTWLGRIILFGYTWALMHHMLGGVRHLIWDTGAGLEKHTASKIAWATLAGSILLTLLIWI 131

Query: 125 IKDIV 129
              + 
Sbjct: 132 AGTMA 136


>gi|260464202|ref|ZP_05812395.1| succinate dehydrogenase, cytochrome b556 subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259030005|gb|EEW31288.1| succinate dehydrogenase, cytochrome b556 subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 139

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 75/123 (60%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++ +  RPLSPHL IYR   TM +SI+HRITG  +Y GT +V  W    A+ +     + 
Sbjct: 9   ANARRERPLSPHLTIYRPPITMTMSIIHRITGGALYFGTLLVAIWLMAAASSQGAFDWVN 68

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + LF YTWA++HHMLGG+R+L+WD    L+K  A+++A   +  SIL  L+
Sbjct: 69  WAFGTWLGRLILFGYTWALMHHMLGGVRHLVWDTGAGLEKDTASKIAWATLAGSILLTLL 128

Query: 122 VWI 124
           +W+
Sbjct: 129 IWV 131


>gi|170746891|ref|YP_001753151.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653413|gb|ACB22468.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 133

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 2/123 (1%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           +P+SPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G    S +  +  GS
Sbjct: 11  QPMSPHLQIYRWTWTMAMSVFHRITGTALYGGTALVAIWLVALASGPVGYSYVAGFF-GS 69

Query: 68  VF-EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           +F  + LF+YTW ++HHMLGGIR+LIWD  +  D+     MA++ +I S+   L++W + 
Sbjct: 70  IFGRLILFVYTWILMHHMLGGIRHLIWDTGVGFDRDKRLSMARLTLIGSVALTLVIWAVA 129

Query: 127 DIV 129
            +V
Sbjct: 130 LLV 132


>gi|17986443|ref|NP_539077.1| succinate dehydrogenase cytochrome B-556 subunit [Brucella
           melitensis bv. 1 str. 16M]
 gi|23502755|ref|NP_698882.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           1330]
 gi|62290760|ref|YP_222553.1| SdhC, succinate dehydrogenase, cytochrome b556 subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700671|ref|YP_415245.1| succinate dehydrogenase, cytochrome subunit B [Brucella melitensis
           biovar Abortus 2308]
 gi|161619821|ref|YP_001593708.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella canis
           ATCC 23365]
 gi|163843927|ref|YP_001628331.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           ATCC 23445]
 gi|225853341|ref|YP_002733574.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis ATCC 23457]
 gi|254690049|ref|ZP_05153303.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 6 str. 870]
 gi|254694537|ref|ZP_05156365.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|254696162|ref|ZP_05157990.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254700548|ref|ZP_05162376.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis bv.
           5 str. 513]
 gi|254704918|ref|ZP_05166746.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis bv.
           3 str. 686]
 gi|254707568|ref|ZP_05169396.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           pinnipedialis M163/99/10]
 gi|254708895|ref|ZP_05170706.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           pinnipedialis B2/94]
 gi|254713680|ref|ZP_05175491.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           M644/93/1]
 gi|254715969|ref|ZP_05177780.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           M13/05/1]
 gi|254717971|ref|ZP_05179782.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp.
           83/13]
 gi|254731080|ref|ZP_05189658.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 4 str. 292]
 gi|256030421|ref|ZP_05444035.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           pinnipedialis M292/94/1]
 gi|256045512|ref|ZP_05448395.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256059880|ref|ZP_05450067.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella neotomae
           5K33]
 gi|256112239|ref|ZP_05453160.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|256258302|ref|ZP_05463838.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 9 str. C68]
 gi|256370306|ref|YP_003107817.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella microti
           CCM 4915]
 gi|260169332|ref|ZP_05756143.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp.
           F5/99]
 gi|294851145|ref|ZP_06791818.1| succinate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|306838923|ref|ZP_07471750.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. NF
           2653]
 gi|306842942|ref|ZP_07475576.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO2]
 gi|306843359|ref|ZP_07475960.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO1]
 gi|17982039|gb|AAL51341.1| succinate dehydrogenase cytochrome b-556 subunit [Brucella
           melitensis bv. 1 str. 16M]
 gi|23348773|gb|AAN30797.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           1330]
 gi|62196892|gb|AAX75192.1| SdhC, succinate dehydrogenase, cytochrome b556 subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616772|emb|CAJ11859.1| Succinate dehydrogenase, cytochrome b subunit [Brucella melitensis
           biovar Abortus 2308]
 gi|161336632|gb|ABX62937.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella canis
           ATCC 23365]
 gi|163674650|gb|ABY38761.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           ATCC 23445]
 gi|225641706|gb|ACO01620.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis ATCC 23457]
 gi|256000469|gb|ACU48868.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella microti
           CCM 4915]
 gi|294819734|gb|EFG36733.1| succinate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|306276050|gb|EFM57750.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO1]
 gi|306286870|gb|EFM58395.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO2]
 gi|306405993|gb|EFM62245.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. NF
           2653]
 gi|326409905|gb|ADZ66970.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis M28]
 gi|326539618|gb|ADZ87833.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis M5-90]
          Length = 132

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 77/124 (62%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++  
Sbjct: 5   TVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTINA 64

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  ++V
Sbjct: 65  LFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATILV 124

Query: 123 WIIK 126
           W++ 
Sbjct: 125 WVVA 128


>gi|260546025|ref|ZP_05821765.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260562821|ref|ZP_05833307.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|260567607|ref|ZP_05838077.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|260755583|ref|ZP_05867931.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 6 str. 870]
 gi|260758809|ref|ZP_05871157.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 4 str. 292]
 gi|260760533|ref|ZP_05872876.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260884609|ref|ZP_05896223.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 9 str. C68]
 gi|261214856|ref|ZP_05929137.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|261217733|ref|ZP_05932014.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M13/05/1]
 gi|261315053|ref|ZP_05954250.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M163/99/10]
 gi|261316390|ref|ZP_05955587.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis B2/94]
 gi|261321419|ref|ZP_05960616.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M644/93/1]
 gi|261751052|ref|ZP_05994761.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           5 str. 513]
 gi|261755614|ref|ZP_05999323.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           3 str. 686]
 gi|261758847|ref|ZP_06002556.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|265982914|ref|ZP_06095649.1| succinate dehydrogenase cytochrome b556 subunit [Brucella sp.
           83/13]
 gi|265987463|ref|ZP_06100020.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M292/94/1]
 gi|265991935|ref|ZP_06104492.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993667|ref|ZP_06106224.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|265999292|ref|ZP_05465704.2| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|260096132|gb|EEW80008.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260152837|gb|EEW87929.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|260157125|gb|EEW92205.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|260669127|gb|EEX56067.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 4 str. 292]
 gi|260670965|gb|EEX57786.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260675691|gb|EEX62512.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 6 str. 870]
 gi|260874137|gb|EEX81206.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 9 str. C68]
 gi|260916463|gb|EEX83324.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|260922822|gb|EEX89390.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M13/05/1]
 gi|261294109|gb|EEX97605.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M644/93/1]
 gi|261295613|gb|EEX99109.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis B2/94]
 gi|261304079|gb|EEY07576.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M163/99/10]
 gi|261738831|gb|EEY26827.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|261740805|gb|EEY28731.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           5 str. 513]
 gi|261745367|gb|EEY33293.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           3 str. 686]
 gi|262764648|gb|EEZ10569.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003001|gb|EEZ15294.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093078|gb|EEZ17228.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659660|gb|EEZ29921.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M292/94/1]
 gi|264661506|gb|EEZ31767.1| succinate dehydrogenase cytochrome b556 subunit [Brucella sp.
           83/13]
          Length = 142

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 77/123 (62%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++  
Sbjct: 15  TVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTINA 74

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  ++V
Sbjct: 75  LFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATILV 134

Query: 123 WII 125
           W++
Sbjct: 135 WVV 137


>gi|261220959|ref|ZP_05935240.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           B1/94]
 gi|265996918|ref|ZP_06109475.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M490/95/1]
 gi|260919543|gb|EEX86196.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           B1/94]
 gi|262551386|gb|EEZ07376.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M490/95/1]
          Length = 142

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 77/123 (62%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++  
Sbjct: 15  TVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTINA 74

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  ++V
Sbjct: 75  LFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATILV 134

Query: 123 WII 125
           W++
Sbjct: 135 WVV 137


>gi|256158405|ref|ZP_05456303.1| Succinate dehydrogenase [Brucella ceti M490/95/1]
 gi|256253825|ref|ZP_05459361.1| Succinate dehydrogenase [Brucella ceti B1/94]
          Length = 132

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 77/124 (62%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++  
Sbjct: 5   TVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTINA 64

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  ++V
Sbjct: 65  LFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATILV 124

Query: 123 WIIK 126
           W++ 
Sbjct: 125 WVVA 128


>gi|182679666|ref|YP_001833812.1| succinate dehydrogenase, cytochrome b556 subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182635549|gb|ACB96323.1| succinate dehydrogenase, cytochrome b556 subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 137

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 75/125 (60%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             + N RPLSPHL IYR + TM +SIVHRITG+ +YLGT ++ ++    A+G    ++  
Sbjct: 9   GRVGNQRPLSPHLLIYRPMLTMMMSIVHRITGAALYLGTLLLAWYLIAAASGPEAFATAS 68

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
            + +  + ++ L  +TWA+ HH LGG+R++IWD     D      +A+  +I  IL  L 
Sbjct: 69  IFFNSILGKLILLGFTWALFHHFLGGVRHMIWDAGYGFDAAGREFLAQATLIGGILLTLF 128

Query: 122 VWIIK 126
           VWI+ 
Sbjct: 129 VWILA 133


>gi|239833035|ref|ZP_04681364.1| succinate dehydrogenase, cytochrome b556 subunit [Ochrobactrum
           intermedium LMG 3301]
 gi|239825302|gb|EEQ96870.1| succinate dehydrogenase, cytochrome b556 subunit [Ochrobactrum
           intermedium LMG 3301]
          Length = 152

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 77/123 (62%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++  
Sbjct: 25  TVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAAVSEECFNTVNA 84

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + LF YTWA++HH+ GG+R+LIWD    L+K  A+++A   ++ S++  ++V
Sbjct: 85  LFSSWIGRLILFGYTWALLHHLAGGVRHLIWDTGAGLEKHTASRIAWTTVVFSVIATILV 144

Query: 123 WII 125
           W++
Sbjct: 145 WVV 147


>gi|148560663|ref|YP_001259728.1| succinate dehydrogenase, cytochrome subunit B [Brucella ovis ATCC
           25840]
 gi|189024973|ref|YP_001935741.1| Succinate dehydrogenase [Brucella abortus S19]
 gi|225628104|ref|ZP_03786139.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           str. Cudo]
 gi|237816266|ref|ZP_04595259.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           str. 2308 A]
 gi|261323851|ref|ZP_05963048.1| succinate dehydrogenase cytochrome B subunit [Brucella neotomae
           5K33]
 gi|297247147|ref|ZP_06930865.1| succinate dehydrogenase cytochrome b-556 subunit [Brucella abortus
           bv. 5 str. B3196]
 gi|148371920|gb|ABQ61899.1| succinate dehydrogenase, cytochrome B subunit [Brucella ovis ATCC
           25840]
 gi|189020545|gb|ACD73267.1| Succinate dehydrogenase [Brucella abortus S19]
 gi|225616929|gb|EEH13976.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           str. Cudo]
 gi|237788333|gb|EEP62548.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           str. 2308 A]
 gi|261299831|gb|EEY03328.1| succinate dehydrogenase cytochrome B subunit [Brucella neotomae
           5K33]
 gi|297174316|gb|EFH33663.1| succinate dehydrogenase cytochrome b-556 subunit [Brucella abortus
           bv. 5 str. B3196]
          Length = 187

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 77/123 (62%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++  
Sbjct: 60  TVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTINA 119

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  ++V
Sbjct: 120 LFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATILV 179

Query: 123 WII 125
           W++
Sbjct: 180 WVV 182


>gi|75676982|ref|YP_319403.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|74421852|gb|ABA06051.1| succinate dehydrogenase subunit C [Nitrobacter winogradskyi Nb-255]
          Length = 141

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 75/124 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M +++  RPLSPHLQIYR   TM +SIVHR TG  +Y GT ++V+W   +++G    +++
Sbjct: 8   MMTVRIERPLSPHLQIYRWTLTMTLSIVHRATGVALYFGTLLLVWWLMAVSSGPGAYAAV 67

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           + +       +  F YTWA++HHMLGG+R+L+WD+           + +  +I  IL   
Sbjct: 68  QSFTSSWAGRLIAFGYTWALMHHMLGGVRHLVWDLGYGFQPTEREWLTRATLIGGILLTA 127

Query: 121 IVWI 124
           ++WI
Sbjct: 128 LLWI 131


>gi|158425367|ref|YP_001526659.1| succinate dehydrogenase cytochrome b-556 subunit [Azorhizobium
           caulinodans ORS 571]
 gi|158332256|dbj|BAF89741.1| succinate dehydrogenase cytochrome b-556 subunit [Azorhizobium
           caulinodans ORS 571]
          Length = 133

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR +PTM +SIVHR TG  +Y GT ++++W    A+               
Sbjct: 10  RPLSPHLQIYRPLPTMVMSIVHRATGIALYFGTVLLIWWLLAAASTPSAYGLFTSIAGSW 69

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
           +  + LF YTWA+IHH LGGIR+LIWD       +    +AK+ ++ S+   +IVW+I
Sbjct: 70  IGRLVLFGYTWALIHHALGGIRHLIWDTIRGFGAQERVLLAKLTLVGSVTLTIIVWVI 127


>gi|153008286|ref|YP_001369501.1| succinate dehydrogenase cytochrome b556 subunit [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560174|gb|ABS13672.1| Succinate dehydrogenase cytochrome b556 subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 132

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 76/124 (61%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   + +  
Sbjct: 5   TVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAAVSEECFNFVNA 64

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + LF YTWA++HH+ GG+R+LIWD    L+K  A+++A   ++ S++  ++V
Sbjct: 65  LFSSWIGRLILFGYTWALLHHLAGGVRHLIWDTGAGLEKHTASKIAWATVVFSVIATILV 124

Query: 123 WIIK 126
           W++ 
Sbjct: 125 WVVA 128


>gi|110635575|ref|YP_675783.1| succinate dehydrogenase subunit C [Mesorhizobium sp. BNC1]
 gi|110286559|gb|ABG64618.1| succinate dehydrogenase subunit C [Chelativorans sp. BNC1]
          Length = 134

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 72/121 (59%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           S    RPLSPHLQIYR  PTM +SI HRITG+ +Y G  +   W    A+       +  
Sbjct: 4   STTQARPLSPHLQIYRFTPTMAMSIAHRITGTALYFGILLFALWLLAAASSREQFDFVNG 63

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                +  + +F Y+W +IHHMLGGIR+LIWD    L+K+ + ++A  N+I SIL  LI+
Sbjct: 64  LFGSIIGRIVIFGYSWVLIHHMLGGIRHLIWDTIHGLEKETSRRLAIANLIGSILVTLII 123

Query: 123 W 123
           W
Sbjct: 124 W 124


>gi|188583472|ref|YP_001926917.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           populi BJ001]
 gi|179346970|gb|ACB82382.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           populi BJ001]
          Length = 133

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           +PLSPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G     ++  +    
Sbjct: 11  QPLSPHLQIYRWTWTMAMSVFHRITGTALYGGTFLVAVWLVALASGPRAYDTVAWFFGSL 70

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKD 127
           +    LF YTW ++HHMLGGIR+ IWD     D+     +A+  +I S+   +++W I  
Sbjct: 71  IGRAILFAYTWVLMHHMLGGIRHFIWDAGYGFDRDRRLGLARATLIGSVTLTIVIWAIAL 130

Query: 128 IV 129
           +V
Sbjct: 131 LV 132


>gi|220926986|ref|YP_002502288.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951593|gb|ACL61985.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 133

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 76/120 (63%), Gaps = 2/120 (1%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR   TM +S+ HR+TG  +Y GT +V  W   +A+G+     +  ++ GS
Sbjct: 11  RPLSPHLQIYRWTWTMAMSVAHRLTGIALYGGTALVAIWLVALASGKAAYDPV-AWLYGS 69

Query: 68  VF-EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           +   + +F+YTW ++HHMLGGIR+L+WD    ++      MAK  ++ S++  L++W + 
Sbjct: 70  ILGRLVIFVYTWILMHHMLGGIRHLVWDFGYGMEPGTRIAMAKYTLVGSVVLTLVIWAVA 129


>gi|23011496|ref|ZP_00051838.1| COG2009: Succinate dehydrogenase/fumarate reductase, cytochrome b
           subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 134

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 72/119 (60%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           +PLSPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G     ++  +    
Sbjct: 11  QPLSPHLQIYRWTWTMAMSVFHRITGTALYGGTFLVAVWLVALASGPRAYDAVAWFFGSW 70

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           +  + LF YTW ++HHMLGGIR+ IWD     D+     +A+  +I S++  +++W + 
Sbjct: 71  IGRLILFAYTWVLMHHMLGGIRHFIWDAGYGFDRDRRLGLARATLIGSVVLTVVIWALA 129


>gi|163853006|ref|YP_001641049.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens PA1]
 gi|218531816|ref|YP_002422632.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254562942|ref|YP_003070037.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens DM4]
 gi|163664611|gb|ABY31978.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens PA1]
 gi|218524119|gb|ACK84704.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254270220|emb|CAX26214.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens DM4]
          Length = 133

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 71/122 (58%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           +PLSPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G     ++  +    
Sbjct: 11  QPLSPHLQIYRWTWTMAMSVFHRITGTALYGGTFLVAVWLVALASGPRAYDTVAWFFGSW 70

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKD 127
                LF YTW ++HHMLGG+R+ IWD     D+     +A+  +I S+   +++W I  
Sbjct: 71  AGRAILFAYTWVLLHHMLGGLRHFIWDAGYGFDRDRRLGLARATLIGSVTLTIVIWAIAL 130

Query: 128 IV 129
           +V
Sbjct: 131 LV 132


>gi|240140347|ref|YP_002964826.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens AM1]
 gi|27902656|gb|AAO24619.1| succinate dehydrogenase gamma subunit [Methylobacterium extorquens]
 gi|240010323|gb|ACS41549.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens AM1]
          Length = 133

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 71/122 (58%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           +PLSPHLQIYR   TM +S+ HR+TG+ +Y GT +V  W   +A+G     ++  +    
Sbjct: 11  QPLSPHLQIYRWTWTMAMSVFHRVTGTALYGGTFLVAVWLVALASGPRAYDTVAWFFGSW 70

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKD 127
                LF YTW ++HHMLGG+R+ IWD     D+     +A+  +I SI   +++W I  
Sbjct: 71  AGRAILFAYTWVLLHHMLGGLRHFIWDAGYGFDRDRRLGLARATLIGSITLTIVIWAIAL 130

Query: 128 IV 129
           +V
Sbjct: 131 LV 132


>gi|154245910|ref|YP_001416868.1| succinate dehydrogenase cytochrome b556 subunit [Xanthobacter
           autotrophicus Py2]
 gi|154159995|gb|ABS67211.1| Succinate dehydrogenase cytochrome b556 subunit [Xanthobacter
           autotrophicus Py2]
          Length = 133

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 71/124 (57%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S  + +RPLSPHLQIYR + TM +SIVHRITG  +Y GT ++V+W    A       S R
Sbjct: 4   SPQRIDRPLSPHLQIYRPLFTMVMSIVHRITGVGLYFGTAILVWWLLAAATSPSAFESFR 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + LF YTWA++HH LGG R+ IWD       K    +A+  +  S+   +I
Sbjct: 64  SVAGSPIGLIVLFGYTWALLHHALGGARHFIWDFIHGFGPKERMLLAQATLAGSVALTVI 123

Query: 122 VWII 125
           +W++
Sbjct: 124 LWVV 127


>gi|118590533|ref|ZP_01547935.1| succinate dehydrogenase cytochrome B-556 subunit [Stappia aggregata
           IAM 12614]
 gi|118436996|gb|EAV43635.1| succinate dehydrogenase cytochrome B-556 subunit [Stappia aggregata
           IAM 12614]
          Length = 132

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/124 (42%), Positives = 77/124 (62%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           + ++ NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ +W    A G      + 
Sbjct: 4   ADLRGNRPLSPHLQIYKPILTMVMSILHRITGAALYFGTVLLAWWLIAAAAGPSYFDFVN 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + LF +TWA++HHMLGG+R+ IWD+     K+    +AK  II S+   LI
Sbjct: 64  GIYGSIIGRLILFGFTWALVHHMLGGLRHFIWDMGAGFGKEAREWLAKATIIGSVSVTLI 123

Query: 122 VWII 125
           +WII
Sbjct: 124 LWII 127


>gi|92119075|ref|YP_578804.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           hamburgensis X14]
 gi|91801969|gb|ABE64344.1| succinate dehydrogenase subunit C [Nitrobacter hamburgensis X14]
          Length = 132

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (60%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +++  RPLSPHLQIYR   TM +S+VHR TG  +Y GT ++V+W   +++G    ++++ 
Sbjct: 2   TVRIERPLSPHLQIYRWTLTMALSVVHRATGMALYFGTLLLVWWLIAVSSGPGAYAAVQS 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  +  F YTWA++HHML G+R+L+WD+           + +  +I  IL  +++
Sbjct: 62  FTASWIGRLIAFGYTWALMHHMLSGVRHLVWDLGYGFKPAEREWLTRAALIGGILLTVLL 121

Query: 123 WIIKDIV 129
           WI+   V
Sbjct: 122 WIVAYAV 128


>gi|85714477|ref|ZP_01045465.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698924|gb|EAQ36793.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
          Length = 133

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 74/122 (60%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +++  RPLSPHLQIYR   TM +SIVHR TG  +Y GT ++V+W   +++G    ++++ 
Sbjct: 2   TVRIERPLSPHLQIYRWTLTMALSIVHRATGVALYFGTLLLVWWLMAVSSGPGAYAAVQS 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +       +  F YTWA++HHML G+R+L+WD+           + +  +I  IL  +++
Sbjct: 62  FTSSWAGRLIAFGYTWALMHHMLSGVRHLVWDLGYGFKPTEREWLTRAALIGGILLTVLL 121

Query: 123 WI 124
           WI
Sbjct: 122 WI 123


>gi|217979669|ref|YP_002363816.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocella
           silvestris BL2]
 gi|217505045|gb|ACK52454.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocella
           silvestris BL2]
          Length = 131

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 74/123 (60%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S    +RPLSPHLQIYR   TM +SIVHRITG+ +Y GT ++ ++    A+G    ++  
Sbjct: 3   SGGPASRPLSPHLQIYRPTLTMMMSIVHRITGAALYGGTLLLAWFLISAASGPGAFAAAS 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             +     ++ LF +TWA+ HH+LGG+R+LIWD+   LD      +A   +I  I   L+
Sbjct: 63  HVVSSFFGKLVLFGFTWALFHHLLGGVRHLIWDLGYGLDDPEREWLAWATLIGGIALTLL 122

Query: 122 VWI 124
           VW+
Sbjct: 123 VWV 125


>gi|170744094|ref|YP_001772749.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           sp. 4-46]
 gi|168198368|gb|ACA20315.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           sp. 4-46]
          Length = 133

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 2/117 (1%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR   TM +S+ HR+TG  +Y GT +V  W   +A+G+     +  ++ GS
Sbjct: 11  RPLSPHLQIYRWTWTMAMSVAHRLTGIALYGGTALVAVWLVALASGKAAYDPV-AWLYGS 69

Query: 68  VF-EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + +F+YTW ++HHMLGGIR+LIWD    ++      MA+  ++ S +  +++W
Sbjct: 70  ILGRLVIFVYTWILMHHMLGGIRHLIWDFGHGMEPGTRIAMARYTLVGSAVLTVVIW 126


>gi|328541811|ref|YP_004301920.1| Succinate dehydrogenase, cytochrome b556 subunit [polymorphum
           gilvum SL003B-26A1]
 gi|326411563|gb|ADZ68626.1| Succinate dehydrogenase, cytochrome b556 subunit [Polymorphum
           gilvum SL003B-26A1]
          Length = 132

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 77/125 (61%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ +W    A G      +    
Sbjct: 7   QGNRPLSPHLQIYKPILTMVMSILHRITGAALYFGTLLLAWWLIAAAAGPAYFDFVNGIY 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF +TWA++HHMLGGIR+ IWD+     ++    +A+  II S+   +++WI
Sbjct: 67  GSILGRLVLFGFTWALVHHMLGGIRHFIWDMGAGFGREAREWLARATIIGSVAVTILLWI 126

Query: 125 IKDIV 129
           +  +V
Sbjct: 127 VGYMV 131


>gi|298293274|ref|YP_003695213.1| succinate dehydrogenase, cytochrome b556 subunit [Starkeya novella
           DSM 506]
 gi|296929785|gb|ADH90594.1| succinate dehydrogenase, cytochrome b556 subunit [Starkeya novella
           DSM 506]
          Length = 130

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (57%), Gaps = 4/125 (3%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQIYR + TM +SIVHRITG  +Y GT ++V W    A+      ++      
Sbjct: 6   ERPLSPHLQIYRPMLTMMMSIVHRITGVALYFGTLLLVIWLVAAASSPAAFDTVNGLYGS 65

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI-LTVL---IV 122
            +  + L  Y+WA+IHH LGGIR+ IWD       +    MA+  I  SI LTVL   I+
Sbjct: 66  WIGLLVLVGYSWALIHHALGGIRHFIWDTGAGFGPQAREWMARATIGGSIGLTVLLWIII 125

Query: 123 WIIKD 127
           W++K 
Sbjct: 126 WLVKG 130


>gi|307942783|ref|ZP_07658128.1| succinate dehydrogenase, cytochrome b556 subunit [Roseibium sp.
           TrichSKD4]
 gi|307773579|gb|EFO32795.1| succinate dehydrogenase, cytochrome b556 subunit [Roseibium sp.
           TrichSKD4]
          Length = 132

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 75/121 (61%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ +W    A G      +    
Sbjct: 7   RGNRPLSPHLQIYKPILTMVMSILHRITGAALYFGTVLLAWWLIAAAAGPTYFEFVNEIY 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF +TWA++HHMLGG+R+ IWD+     ++    +A+  II S+   +++WI
Sbjct: 67  SSFIGRLILFGFTWALVHHMLGGLRHFIWDMGAGFGREAREWLARATIIGSVGLTILLWI 126

Query: 125 I 125
           I
Sbjct: 127 I 127


>gi|90421600|ref|YP_529970.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB18]
 gi|90103614|gb|ABD85651.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris
           BisB18]
          Length = 132

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 72/124 (58%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPH+Q YR   TM +SIVHR+TG  +Y GT ++ +W   +A G    ++++ 
Sbjct: 2   TARIERPLSPHMQAYRWSLTMALSIVHRLTGITLYFGTLLLAWWLIAVAAGPSAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + LF YTW+++HHML G+R+ IWD+           M    +I  ++  +++
Sbjct: 62  FTGSWIGRLMLFGYTWSLMHHMLSGVRHFIWDLGYGFTAAERESMTWAALIGGVVLTVLL 121

Query: 123 WIIK 126
           WI+ 
Sbjct: 122 WIVA 125


>gi|163869248|ref|YP_001610504.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           tribocorum CIP 105476]
 gi|161018951|emb|CAK02509.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           tribocorum CIP 105476]
          Length = 133

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP SPH+ IYR   TM +SI HRITG  +Y+GT     W   IA GE T  ++   + 
Sbjct: 8   KERPRSPHISIYRWTITMAMSIAHRITGMALYVGTVFFAVWLIAIACGEETFRTVH-EIY 66

Query: 66  GSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVW 123
            S F +C LFLYT A +HHM+GG+R+++WD+  C L K+ AT  A   +  S++    +W
Sbjct: 67  SSWFGLCILFLYTLAGVHHMVGGVRHIVWDLKPCLLAKEKATATAWATVFISLIVTFAIW 126

Query: 124 II 125
           II
Sbjct: 127 II 128


>gi|154251886|ref|YP_001412710.1| succinate dehydrogenase cytochrome b556 subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|154155836|gb|ABS63053.1| Succinate dehydrogenase cytochrome b556 subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 135

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 62/98 (63%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +RPLSPHLQIYR+  TM +SI+HR TG  +Y GT +V +W    A G    ++ +     
Sbjct: 9   SRPLSPHLQIYRVTITMAMSIIHRFTGMGLYAGTALVAWWLVAAATGPEAYATFQAVAGS 68

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA 104
            + ++ LF +TWA++HH+ GG+RYL+WD  +    + A
Sbjct: 69  WIGQLVLFGFTWALLHHLFGGLRYLLWDAIVATSPRSA 106


>gi|146337397|ref|YP_001202445.1| succinate dehydrogenase cytochrome b556 subunit [Bradyrhizobium sp.
           ORS278]
 gi|146190203|emb|CAL74195.1| Succinate dehydrogenase cytochrome b556 subunit [Bradyrhizobium sp.
           ORS278]
          Length = 132

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (55%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPHLQ YR   TM +SIVHR TG  +Y GT ++ +W    A+G    S ++ 
Sbjct: 2   TARIERPLSPHLQTYRWTLTMILSIVHRATGVALYFGTLLLAWWLIAAASGPSAYSYVQG 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +M   +  + +F YTWA++HH+L GIR+ +WD+           +    +I  I   ++V
Sbjct: 62  FMGSFLGRLIVFGYTWALLHHLLSGIRHFVWDLGYGFKPNERETLTWGALIGGISLTVLV 121

Query: 123 WIIKDIV 129
           WI+   V
Sbjct: 122 WIVAYAV 128


>gi|27375623|ref|NP_767152.1| succinate dehydrogenase cytochrome B-556 subunit [Bradyrhizobium
           japonicum USDA 110]
 gi|3169722|gb|AAC17940.1| succinate dehydrogenase membrane anchor subunit [Bradyrhizobium
           japonicum]
 gi|27348760|dbj|BAC45777.1| succinate dehydrogenase cytochrome B-556 subunit [Bradyrhizobium
           japonicum USDA 110]
          Length = 132

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 69/120 (57%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPH+Q+YR   TM +SIVHR TG  +Y GT ++ +W    A+G    S ++ +   
Sbjct: 6   ERPLSPHMQVYRWTLTMALSIVHRATGIALYAGTLLLAWWLIAAASGPAAYSHVQAFTGS 65

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            +  + +F YTWA++HHML GIR+ +WD+           +    +I  I+  +++WI+ 
Sbjct: 66  IIGRLIVFGYTWALMHHMLSGIRHFVWDLGYGFKANEREALTWGALIGGIVLTVLIWIVA 125


>gi|240851320|ref|YP_002972723.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           grahamii as4aup]
 gi|240268443|gb|ACS52031.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           grahamii as4aup]
          Length = 133

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 74/122 (60%), Gaps = 3/122 (2%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP SPH+ IYR   TM +SI HR+TG  +Y+G   +  W   IA GE T  ++   + 
Sbjct: 8   KERPRSPHISIYRWTITMAMSIAHRVTGMALYVGMVFLAVWLIAIACGEETFRTVH-EIY 66

Query: 66  GSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVW 123
            S F +C LFLYT A +HHM+GGIR+++WD+  C L K+ AT  A   +  S++   ++W
Sbjct: 67  SSWFGLCILFLYTLAGVHHMVGGIRHIVWDMMPCLLAKEKATVTAWATVFISLIVTFVIW 126

Query: 124 II 125
           II
Sbjct: 127 II 128


>gi|323138215|ref|ZP_08073287.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocystis sp.
           ATCC 49242]
 gi|322396467|gb|EFX98996.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocystis sp.
           ATCC 49242]
          Length = 135

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 75/129 (58%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           +  +   RPLSPHL +Y+ + TM +SI HRITG+ +Y+G  ++  +    A G    S+ 
Sbjct: 6   LDKLAAKRPLSPHLSVYKPMLTMMMSIAHRITGAGLYVGMALLALFLLGAAMGGWVFSAF 65

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                G +  + +FL TWA+ HH+LGG+R+ +WD  L +D K    +A+  +   +   L
Sbjct: 66  SWLGSGFIGGLIVFLVTWAIFHHLLGGVRHALWDRGLYMDPKGREFLAQATLGGGVTLTL 125

Query: 121 IVWIIKDIV 129
           +VW++K +V
Sbjct: 126 LVWVLKSLV 134


>gi|312112888|ref|YP_004010484.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218017|gb|ADP69385.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 148

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 67/116 (57%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           +P+SPHL IYR    M +SI+HR+TG   Y G+ ++  W    A  E   +++  Y+   
Sbjct: 16  KPMSPHLSIYRFKINMILSIMHRVTGITNYFGSLILAIWIASAATSEQAFNTVSSYLATP 75

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +  V L  +TW+V+HHMLGGIR+ +WDV     K+    ++  ++I SI    I+W
Sbjct: 76  LGLVILIGFTWSVMHHMLGGIRHFVWDVGWGFSKEAVKFLSWASLIGSITLTAIIW 131


>gi|121602258|ref|YP_988426.1| succinate dehydrogenase, cytochrome b556 subunit [Bartonella
           bacilliformis KC583]
 gi|120614435|gb|ABM45036.1| succinate dehydrogenase, cytochrome b556 subunit [Bartonella
           bacilliformis KC583]
          Length = 133

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (60%), Gaps = 3/122 (2%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP SPH+ IYR   TM +SI HRITG  +Y G  ++  W   IA GE    ++   + 
Sbjct: 8   KDRPRSPHVTIYRWSITMAMSIAHRITGIAIYFGISLLAIWLMAIACGESAFKTVN-EIY 66

Query: 66  GSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVW 123
           GS F +C LFL T+A +HHM+G IR+LI ++  C LDKK A  +A  NI  S    +++W
Sbjct: 67  GSFFGLCVLFLCTFAGVHHMVGDIRHLIGELKPCLLDKKQANFIAWANIFISFSATVVIW 126

Query: 124 II 125
           +I
Sbjct: 127 VI 128


>gi|88812336|ref|ZP_01127586.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Nitrococcus mobilis Nb-231]
 gi|88790343|gb|EAR21460.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Nitrococcus mobilis Nb-231]
          Length = 126

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 71/122 (58%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
            ++RPLSPHLQIYR   T+  SI HRITG+++ LGT  V +W   +A+G    ++ R + 
Sbjct: 3   SDDRPLSPHLQIYRFPTTVITSITHRITGALLALGTLGVTYWLIALASGPQVYAAARAFF 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ LF +T+A+ +H+  GIR+L W +    + + A + A    +A+ +  +I W+
Sbjct: 63  GNGFVQLILFFWTYALFYHLCNGIRHLGWAIDYGFELERARKSAVAVFVAAGILTVITWL 122

Query: 125 IK 126
             
Sbjct: 123 FA 124


>gi|91974961|ref|YP_567620.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB5]
 gi|91681417|gb|ABE37719.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris
           BisB5]
          Length = 129

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 69/120 (57%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G  + ++L+ +   
Sbjct: 3   DRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWWLIACAAGPASYANLQAFTGS 62

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            +  + LF YTW+++HH+L G+R+ +WD+           +    +I  ++  ++ W+I 
Sbjct: 63  WIGRLILFGYTWSLMHHLLSGVRHFVWDLGYGFKTADREWLTWAALIGGVVLTVLFWVIA 122


>gi|115522538|ref|YP_779449.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisA53]
 gi|115516485|gb|ABJ04469.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris
           BisA53]
          Length = 132

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPH+Q YR   TM +SIVHR TG  +Y GT V+ +W   +  G    ++++ +   
Sbjct: 6   ERPLSPHMQAYRWTLTMTLSIVHRATGVALYFGTLVLAWWLIAVGAGPGAYANVQAFTGS 65

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC---LDKKIATQMAKINIIASILTVLI 121
            + ++ +F YTW+++HH L GIR+ +WD+       D+++ T  A I  +  +LTVL+
Sbjct: 66  WIGKLIMFGYTWSLMHHFLSGIRHFVWDLGYGYKPADRELLTWAALIGGV--VLTVLL 121


>gi|255261406|ref|ZP_05340748.1| succinate dehydrogenase, cytochrome b556 subunit [Thalassiobium sp.
           R2A62]
 gi|255103741|gb|EET46415.1| succinate dehydrogenase, cytochrome b556 subunit [Thalassiobium sp.
           R2A62]
          Length = 127

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (57%), Gaps = 1/119 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI  R+TG+ + +   ++V+WF   A G    ++   ++
Sbjct: 6   RGNRPLSPHLTIYRPQMTSMTSIFVRLTGNALLIAALMIVWWFVAAATGPEAFATADGFL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLIV 122
                ++  F  TWA+ +H+LGG+R+LIWD+   LD + A  M    II S +LTVL V
Sbjct: 66  RSWFGDLVFFASTWAIWYHLLGGLRHLIWDMGYGLDLQSAYNMGYAMIIGSLLLTVLTV 124


>gi|39933296|ref|NP_945572.1| succinate dehydrogenase cytochrome b subunit [Rhodopseudomonas
           palustris CGA009]
 gi|192288649|ref|YP_001989254.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|39652921|emb|CAE25663.1| succinate dehydrogenase membrane anchor/cytochrome b subunit
           [Rhodopseudomonas palustris CGA009]
 gi|192282398|gb|ACE98778.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 132

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 70/124 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G    ++++ 
Sbjct: 2   TARIERPLSPHMQAYRWSLTMTMSIVHRATGIALYSGTLLLAWWLIACAAGPTAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + +F YTW+++HHML G+R+ +WD+           +    +I  I+  +++
Sbjct: 62  FTGSWIGRLIVFGYTWSLMHHMLSGVRHFVWDLGYGFKTADREWLTWAALIGGIVLTVLL 121

Query: 123 WIIK 126
           W+I 
Sbjct: 122 WVIA 125


>gi|49474757|ref|YP_032799.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           quintana str. Toulouse]
 gi|49240261|emb|CAF26731.1| Succinate dehydrogenase cytochrome b560 subunit [Bartonella
           quintana str. Toulouse]
          Length = 133

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (58%), Gaps = 3/126 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           +++   RP SPH+ IYR   TM +SI HRITG  +Y G      W   IA G+    ++ 
Sbjct: 4   TTMIKERPRSPHVSIYRWTITMAMSIAHRITGLGLYFGMIFFTIWLISIACGDEMFRTVH 63

Query: 62  CYMDGSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTV 119
             +  S+  +C LFLYT A +HHM+G IR+++WD++ C LDKK A   A   +  S++  
Sbjct: 64  -EIYSSLPGLCILFLYTLAGVHHMVGDIRHIVWDMNPCLLDKKKAVLTAWATVFISLIVT 122

Query: 120 LIVWII 125
           L +WII
Sbjct: 123 LTIWII 128


>gi|114328744|ref|YP_745901.1| succinate dehydrogenase cytochrome b556 subunit [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316918|gb|ABI62978.1| succinate dehydrogenase cytochrome b556 subunit [Granulibacter
           bethesdensis CGDNIH1]
          Length = 197

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 70/123 (56%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +RPLSPHLQ+YR   TM +SI+HR+TG    +GT ++ +W    A  +H    +  +M  
Sbjct: 74  HRPLSPHLQVYRWPITMALSILHRVTGVAAAIGTLLLTWWLVAAATSDHAYDIVSGFMRS 133

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
               + LF +T A+++H + GIR+L+WD     DK  A + + I +  + L  + +WI  
Sbjct: 134 GFGLLLLFGWTVALVYHFINGIRHLVWDAGYGFDKHEANRSSYIVLGLTALFTVAIWIAA 193

Query: 127 DIV 129
            +V
Sbjct: 194 AVV 196


>gi|49476235|ref|YP_034276.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           henselae str. Houston-1]
 gi|49239043|emb|CAF28343.1| Succinate dehydrogenase cytochrome b560 subunit [Bartonella
           henselae str. Houston-1]
          Length = 133

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (56%), Gaps = 5/123 (4%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL-RCYM 64
             RP SPH+ IYR   TM +SI HRITG  +Y G   +  W   I+ G     ++ R Y 
Sbjct: 8   KQRPRSPHVSIYRWTITMAMSIAHRITGIALYFGMVFLAIWLISISCGVEAFRTVHRIYT 67

Query: 65  DGSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIV 122
             S   +C LFLYT A IHHM+GG+R+++WD+  C L K+ AT  A   +  S++    +
Sbjct: 68  --SFPGLCILFLYTLAGIHHMVGGVRHIVWDIKPCLLAKEKATMTAWATVFISLIITFTI 125

Query: 123 WII 125
           WII
Sbjct: 126 WII 128


>gi|86747453|ref|YP_483949.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris HaA2]
 gi|86570481|gb|ABD05038.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris HaA2]
          Length = 132

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 71/124 (57%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + + +RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G    ++++ 
Sbjct: 2   TARIDRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWWLIACAAGPAAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + LF YTWA++HH+L G+R+ +WD+           +    +I  I+  +++
Sbjct: 62  FTGSWIGRLILFGYTWALMHHLLSGVRHFVWDLGYGFKTADREWLTWAALIGGIVLTVLL 121

Query: 123 WIIK 126
           W++ 
Sbjct: 122 WVVA 125


>gi|319406315|emb|CBI79952.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           sp. AR 15-3]
          Length = 133

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 69/125 (55%), Gaps = 1/125 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++   +RP SPHL +YR   TM +SI HRITG V+Y G   +  W   IA G  T   + 
Sbjct: 4   TTTTKDRPRSPHLSVYRWSITMAISIAHRITGIVLYFGMCFLALWLVSIACGADTFKMVN 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVL 120
                      LF YT A +HHM+G IR+++W+++  CL K+ AT  A   +  S++  +
Sbjct: 64  QIYRSFPGLCLLFFYTLAGVHHMVGCIRHIVWNMNPRCLAKEKATSTAWATVFISLIVTI 123

Query: 121 IVWII 125
            +WII
Sbjct: 124 AIWII 128


>gi|319899436|ref|YP_004159533.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           clarridgeiae 73]
 gi|319403404|emb|CBI76972.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           clarridgeiae 73]
          Length = 152

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 70/125 (56%), Gaps = 1/125 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++   +RP SPHL IYR   TM +SI HRITG ++Y G   +  W   IA G +    + 
Sbjct: 23  TTTTKDRPRSPHLSIYRWSITMAISIAHRITGVMLYFGMLFLALWLVSIACGANAFRMIN 82

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVL 120
              +       LF YT A +HHM+G IR+++W+++  CL K+ AT  A   +  S++  +
Sbjct: 83  QIYESLPGLCLLFFYTLAGVHHMVGCIRHIVWNMNPCCLAKEKATSTAWATVFISLIVTI 142

Query: 121 IVWII 125
            +WII
Sbjct: 143 AIWII 147


>gi|319409393|emb|CBI83037.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           schoenbuchensis R1]
          Length = 133

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP SPHL IYR   TM +SI HRITG  +Y G      W   IA G  T  ++   + 
Sbjct: 8   KDRPYSPHLSIYRWSITMAMSIAHRITGVALYFGMICFAIWLGAIACGSDTFKTVN-GIY 66

Query: 66  GSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVW 123
           GS   +C LFL+T A +HHM+G IR+L+W++  C L K+ AT  A   +  +++    +W
Sbjct: 67  GSFPGLCVLFLFTLAGVHHMVGCIRHLVWNMKPCLLAKEKATATAWATVFITLIVTCAIW 126

Query: 124 II 125
           +I
Sbjct: 127 VI 128


>gi|254292677|ref|YP_003058700.1| succinate dehydrogenase, cytochrome b556 subunit [Hirschia baltica
           ATCC 49814]
 gi|254041208|gb|ACT58003.1| succinate dehydrogenase, cytochrome b556 subunit [Hirschia baltica
           ATCC 49814]
          Length = 136

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 65/124 (52%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           + RPLSPHLQ+++  PTM  SI+ RITG    +G  ++V W F IA+G         +  
Sbjct: 8   DKRPLSPHLQVWKFHPTMLTSILQRITGVGNAIGVVLIVGWLFAIASGSDVFKCFDVFFT 67

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
               ++ LF +T +V++H+  GIR+L WD        +A   +   I   +L  + VWI 
Sbjct: 68  SIFGKIILFGFTVSVMYHLGQGIRFLFWDAGKGFTPAVANFWSYFTIAFGLLGAVAVWIF 127

Query: 126 KDIV 129
             +V
Sbjct: 128 AGLV 131


>gi|258541135|ref|YP_003186568.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632213|dbj|BAH98188.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635270|dbj|BAI01239.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638325|dbj|BAI04287.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641379|dbj|BAI07334.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644434|dbj|BAI10382.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647489|dbj|BAI13430.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650542|dbj|BAI16476.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653533|dbj|BAI19460.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 157

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 66/121 (54%), Gaps = 2/121 (1%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ+YR   +M +SI++RITG +   G  + VFW    A G    ++ R     
Sbjct: 20  QRPMSPHLQVYRYRLSMVLSIMNRITGVIATAGATLGVFWLGAAAKGPKAFATARKVTGN 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA--KINIIASILTVLIVWI 124
            + ++ L  +  +VI+H +GGIR+LIWD     DKK   +     + + A + TVL   +
Sbjct: 80  PLGQLVLLGWLASVIYHTVGGIRHLIWDSGYRYDKKEVNKDGPVAVGVTAGVSTVLAAGL 139

Query: 125 I 125
           +
Sbjct: 140 L 140


>gi|329114746|ref|ZP_08243503.1| Succinate dehydrogenase cytochrome b556 subunit [Acetobacter
           pomorum DM001]
 gi|326695877|gb|EGE47561.1| Succinate dehydrogenase cytochrome b556 subunit [Acetobacter
           pomorum DM001]
          Length = 157

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 66/121 (54%), Gaps = 2/121 (1%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ+YR   +M +SI++RITG +   G  + VFW    A G    ++ R     
Sbjct: 20  QRPMSPHLQVYRYRLSMVLSIMNRITGVIATAGATLGVFWLGAAAKGPKAFATARKVTGN 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA--KINIIASILTVLIVWI 124
            + ++ L  +  +VI+H +GGIR+LIWD     DKK   +     + + A + TVL   +
Sbjct: 80  PLGQLVLVGWLASVIYHTVGGIRHLIWDSGYRYDKKEVNKDGPVAVGVTAGVSTVLAAGL 139

Query: 125 I 125
           +
Sbjct: 140 L 140


>gi|300024743|ref|YP_003757354.1| succinate dehydrogenase, cytochrome b556 subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526564|gb|ADJ25033.1| succinate dehydrogenase, cytochrome b556 subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 137

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           S +  RPLSPHLQIY  +  M +SIVHRITG  +Y+G+ ++  W    A+G      +  
Sbjct: 8   SSRPERPLSPHLQIYSPLINMMMSIVHRITGVALYVGSLLLAVWLLAAASGPDYYDYVAG 67

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +     ++ L  YTWA++HH+LGG+R+ IWD     D K    ++   +  S++   ++
Sbjct: 68  LLGSWPGKIVLLGYTWALMHHLLGGLRHFIWDTGRGYDLKTVDLLSWGTLAGSLVLTALI 127

Query: 123 WI 124
           WI
Sbjct: 128 WI 129


>gi|316931809|ref|YP_004106791.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris DX-1]
 gi|315599523|gb|ADU42058.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 132

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 70/124 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G    ++++ 
Sbjct: 2   TARIERPLSPHMQAYRWSLTMTMSIVHRATGIALYSGTLLLAWWLIACAAGPAAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + +F YTWA++HH+L G+R+ +WD+           +    +I  I+  +++
Sbjct: 62  FTGSWIGRLIVFGYTWALMHHLLSGVRHFVWDLGYGFKTADREWLTWAALIGGIVLTVLL 121

Query: 123 WIIK 126
           W+I 
Sbjct: 122 WVIA 125


>gi|296445361|ref|ZP_06887319.1| succinate dehydrogenase, cytochrome b556 subunit [Methylosinus
           trichosporium OB3b]
 gi|296257122|gb|EFH04191.1| succinate dehydrogenase, cytochrome b556 subunit [Methylosinus
           trichosporium OB3b]
          Length = 136

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RPLSPHL +Y+ I TM +SI HRI+G+ +Y G  ++  +   +A G    S++   
Sbjct: 11  LAAARPLSPHLSVYKPIITMAMSIAHRISGAALYAGAILLALYLLGLALGPSAFSTVAWI 70

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            +  +    LFL++WA+ HH+LGG+R+ IWD  L LD      +AK  +   +   L +W
Sbjct: 71  ANSLIGRAFLFLFSWALFHHLLGGVRHAIWDRGLYLDGPGRELLAKATLGGGVALTLGLW 130

Query: 124 I 124
           I
Sbjct: 131 I 131


>gi|319407790|emb|CBI81441.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           sp. 1-1C]
          Length = 152

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP SPHL +YR   TM +SI HRITG V+Y G   +  W   IA G      +   + 
Sbjct: 27  KDRPRSPHLSVYRWSITMAISIAHRITGIVLYFGMCFLALWLVSIACGPDAFKMVN-KIY 85

Query: 66  GSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVLIVW 123
           GS   +C LF YT A +HHM+G +R+++W+++   L K+ AT  A   +  S++  + +W
Sbjct: 86  GSFLGLCLLFFYTLAGVHHMVGCVRHIVWNLNPRYLAKEKATLTAWATVFISLIVTIALW 145

Query: 124 II 125
           II
Sbjct: 146 II 147


>gi|319404830|emb|CBI78431.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 152

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++   +RP SPHL +YR   TM +SI HRITG V+Y G   +  W   IA G  T   + 
Sbjct: 23  TTTTKDRPRSPHLSVYRWSITMAISIAHRITGIVLYFGMCFLALWLVSIACGADTFKMVN 82

Query: 62  CYMDGSVFEVC-LFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTV 119
             + GS   +C LF YT A +HH++G +R+++W+++   L K+ AT  A   +  S++  
Sbjct: 83  -KIYGSFPGLCFLFFYTLAGVHHIVGCVRHIVWNLNPRYLAKEKATSTAWATVFISLIVT 141

Query: 120 LIVWII 125
           + +W+I
Sbjct: 142 IALWVI 147


>gi|197103676|ref|YP_002129053.1| succinate dehydrogenase cytochrome b-556 subunit [Phenylobacterium
           zucineum HLK1]
 gi|196477096|gb|ACG76624.1| succinate dehydrogenase cytochrome b-556 subunit [Phenylobacterium
           zucineum HLK1]
          Length = 129

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 62/124 (50%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP SPH  I+R   TM  SI+HRITG  +Y G  +   W   +A G  T ++ +  M 
Sbjct: 3   RERPTSPHTTIWRWHLTMATSILHRITGVALYGGALIAAAWALSLAGGPETYAAFKGVMG 62

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
             + ++ LF  T A  +H+  G+R+L WD+    D K A   A   I  ++   L VW+I
Sbjct: 63  SFLGKLALFGLTLAGFYHLGNGVRHLTWDLGHGFDLKSANASAVGVIAFAVAATLAVWVI 122

Query: 126 KDIV 129
             + 
Sbjct: 123 AGMT 126


>gi|153868748|ref|ZP_01998495.1| Succinate dehydrogenase, cytochrome b subunit [Beggiatoa sp. PS]
 gi|152074659|gb|EDN71493.1| Succinate dehydrogenase, cytochrome b subunit [Beggiatoa sp. PS]
          Length = 130

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 65/121 (53%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             +PLSPHLQIY+   T  +SI+HRITG  + LGT V+V+W    A G  T    + ++ 
Sbjct: 2   TKQPLSPHLQIYKPQLTSIMSILHRITGVFLSLGTLVLVYWLMAAAEGPETYQQAQNFLR 61

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
                  LF ++ A+ +H+  GIR+L WD  L LD K       +  I + L  ++ W++
Sbjct: 62  SWWGLFLLFGWSLALFYHLCNGIRHLFWDAGLGLDIKTVYITGSLVWIMTFLLTILTWVL 121

Query: 126 K 126
            
Sbjct: 122 A 122


>gi|114320488|ref|YP_742171.1| succinate dehydrogenase subunit C [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226882|gb|ABI56681.1| succinate dehydrogenase subunit C [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 130

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 67/110 (60%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           +NRPLSPHLQ+Y+   T  +SI HR +G V+ LG+ ++V+W   +A G    +++   + 
Sbjct: 4   DNRPLSPHLQVYKPQLTSVLSICHRGSGVVLALGSIILVWWLSALAAGPEAFATVNGVVG 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
             + +V LFL+T A+ +H+  GIR+L+WD     + +   +   + +IAS
Sbjct: 64  SFIGKVILFLFTLALFYHLCNGIRHLVWDTGRGFELESVYRSGYLVVIAS 113


>gi|254510339|ref|ZP_05122406.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacteraceae
           bacterium KLH11]
 gi|221534050|gb|EEE37038.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacteraceae
           bacterium KLH11]
          Length = 184

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + L   ++V+WF   A      +    ++
Sbjct: 62  RGNRPLSPHLSIYRPQLTSVTSILTRITGNAMLLAALLIVWWFLAAATSPEAFARANWWL 121

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
              + ++ + L  W + +H L GIR+LIWD +  LD   AT++    +I S
Sbjct: 122 TSILGDLVMALSLWGLWYHTLAGIRHLIWDNAYGLDIPTATKLGWAVVIGS 172


>gi|260431521|ref|ZP_05785492.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415349|gb|EEX08608.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 128

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 67/121 (55%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A      ++    +
Sbjct: 6   RGNRPLSPHLSIYRPQLTSVTSILTRITGNAMLVAALLIVWWFLAAATSPEAYATANAVI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ + L  W + +H L GIR+LIWD ++ LD   A ++    +I S++  L+  +
Sbjct: 66  TSLLGDLVMALSLWGLWYHTLAGIRHLIWDSAVGLDLPTAYKLGWAVVIGSVVLTLVTLL 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|163734150|ref|ZP_02141591.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           litoralis Och 149]
 gi|161392686|gb|EDQ17014.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           litoralis Och 149]
          Length = 127

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 67/119 (56%), Gaps = 1/119 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL+IYR   T   SI+ RITG+ + + + +VV+WF   A    + +     +
Sbjct: 6   RGNRPLSPHLRIYRPQLTSITSILTRITGNALLISSLLVVWWFLAAATSPESFAVANGVL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLIV 122
                +V + L  W + +H L G+R+LIWD  + LD + A +M    I  S +LT+L +
Sbjct: 66  TSWFGDVVMTLSLWGLWYHTLAGVRHLIWDQGIGLDIETAYKMGYAVIGGSFVLTLLTI 124


>gi|56695273|ref|YP_165621.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria pomeroyi
           DSS-3]
 gi|56677010|gb|AAV93676.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria pomeroyi
           DSS-3]
          Length = 128

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (53%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ +     ++V+WF   A      +     +
Sbjct: 6   RGNRPLSPHLSIYRPQLTSITSILTRITGNALLFAALLIVWWFLAAATSPEYFAVADGVI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
              + ++ + L  W + +H L GIR+LIWD +L LD   A ++    +I S+L
Sbjct: 66  TSLIGDLVMALSLWGLWYHTLAGIRHLIWDNALGLDLPTAEKLGWAVVIGSVL 118


>gi|304320539|ref|YP_003854182.1| succinate dehydrogenase cytochrome B-556 subunit [Parvularcula
           bermudensis HTCC2503]
 gi|303299441|gb|ADM09040.1| succinate dehydrogenase cytochrome B-556 subunit [Parvularcula
           bermudensis HTCC2503]
          Length = 142

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 72/121 (59%), Gaps = 2/121 (1%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RPLSPHLQI+R   TM  SI+HR TG  +Y G+ ++V W    A  E     +  ++ 
Sbjct: 17  GDRPLSPHLQIWRWSVTMATSILHRATGIALYAGSVLLVLWLLGGALTEGFYDGVTGFL- 75

Query: 66  GSVFEVCLFL-YTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           GS F + + + +TWA + H+  GI+YLIWD    L +++A + A   +IAS +   +VW+
Sbjct: 76  GSPFGILILVGFTWAQMFHLSNGIKYLIWDSGRLLQREVAKKTAWGVLIASFVLTALVWL 135

Query: 125 I 125
           +
Sbjct: 136 V 136


>gi|254487864|ref|ZP_05101069.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           GAI101]
 gi|214044733|gb|EEB85371.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           GAI101]
          Length = 127

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 65/121 (53%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A      ++   ++
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNAMLVAALLIVWWFLAAATSPEAFAAANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ +F     + +H L GIR+LIWD    LD + A ++    ++ S+L  +I  +
Sbjct: 66  TSWFGDLIMFFSLLGLWYHTLAGIRHLIWDNGYGLDIQTAEKLGWAALVGSVLLTIITAL 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|254437963|ref|ZP_05051457.1| succinate dehydrogenase, cytochrome b556 subunit [Octadecabacter
           antarcticus 307]
 gi|198253409|gb|EDY77723.1| succinate dehydrogenase, cytochrome b556 subunit [Octadecabacter
           antarcticus 307]
          Length = 127

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 65/113 (57%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           ++ RPLSPHL IYR   T   SI  R+TG+ + +G  ++V+WF  +A+G    +    +M
Sbjct: 6   RDKRPLSPHLTIYRPQWTSMTSIFTRLTGNALIVGALLIVWWFAALASGPEAYARANGFM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
                ++ +F    A+ +H L G+R+LIWD    LD + + +  ++ I+ S+L
Sbjct: 66  TSWFGDLIMFGSVAALWYHSLAGVRHLIWDSGHMLDVQSSERAGQLIILVSVL 118


>gi|89068123|ref|ZP_01155540.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           granulosus HTCC2516]
 gi|89046362|gb|EAR52419.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           granulosus HTCC2516]
          Length = 127

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 62/113 (54%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL ++R       SI+ RITG+ + +   ++V+WF  +A G    +    ++
Sbjct: 6   RGNRPLSPHLTVWRWSLPAISSILTRITGNALIVAALMIVWWFVALATGPEAYARANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
                ++ +FL   AV +H+  G+R+LIWD    LD   +   A   +IAS+L
Sbjct: 66  TSWFGDLVMFLSVLAVWYHLFAGVRHLIWDQGYMLDVSSSETYATAAMIASVL 118


>gi|83944805|ref|ZP_00957171.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851587|gb|EAP89442.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicaulis
           alexandrii HTCC2633]
          Length = 134

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 3/125 (2%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           + RP+SPHL+I+R   TM  SI HR TG   Y+G   +  W   +A G          M 
Sbjct: 7   DPRPISPHLEIWRWHATMASSIFHRATGVGNYIGAIFLTLWLVLLAAGPDAYGGFEALMA 66

Query: 66  GSVFEVCLFLY---TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           G +  +   +    T ++I+H++ G+R+L+WD     + K A   +   IIASIL  + +
Sbjct: 67  GPLGLLVKLVLFLFTLSLIYHLINGVRHLVWDAGKGFEPKFANTASMAIIIASILVTVAI 126

Query: 123 WIIKD 127
           W++  
Sbjct: 127 WLLSG 131


>gi|149184716|ref|ZP_01863034.1| hypothetical protein ED21_28398 [Erythrobacter sp. SD-21]
 gi|148832036|gb|EDL50469.1| hypothetical protein ED21_28398 [Erythrobacter sp. SD-21]
          Length = 126

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 1/120 (0%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMD 65
           NRPLSPHLQI++  P M VSI+HR+TG  + L G  V ++W   +A G  + ++    M 
Sbjct: 3   NRPLSPHLQIWKWGPHMLVSILHRVTGDGLALVGLGVFLWWLAAMAGGADSYATFAGIMG 62

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
             +  V L   +WA  +HM+ GIR+ + D+    +       + I+ +  IL  +  W +
Sbjct: 63  SPIGMVVLIGLSWAFFNHMMSGIRHFVLDIGAGYELDTNKTWSVISPVLGILLTIAFWAV 122


>gi|218458002|ref|ZP_03498093.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium etli
          Kim 5]
          Length = 90

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (78%)

Query: 1  MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
          M+++ NNRPLSPHLQIY+ IPTM +SIVHRITG  +Y+GT +V +W    A+G+ +
Sbjct: 16 MANVTNNRPLSPHLQIYKPIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQAS 71


>gi|254477708|ref|ZP_05091094.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria sp. R11]
 gi|214031951|gb|EEB72786.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria sp. R11]
          Length = 127

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 64/117 (54%), Gaps = 1/117 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQIYR   T   SI  R TG  ++    + V+W    A  E     +   +
Sbjct: 6   RGNRPLSPHLQIYRPQLTSASSIFVRATGIAIFFLMLLAVWWLLAAATSEAAFGFIDGLL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK-INIIASILTVL 120
            G + ++ L   TW++ + MLG +R++IWD   CLD + + +M + + I A+ LTV 
Sbjct: 66  RGWLGDIILLGATWSIWYLMLGRLRHVIWDFGHCLDVETSEKMGQGMFIAATALTVF 122


>gi|209883444|ref|YP_002287301.1| succinate dehydrogenase cytochrome b556 subunit [Oligotropha
           carboxidovorans OM5]
 gi|209871640|gb|ACI91436.1| succinate dehydrogenase cytochrome b556 subunit [Oligotropha
           carboxidovorans OM5]
          Length = 131

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (50%), Gaps = 1/122 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RPLSP L  YR   TM +S++HR TG  +Y GT ++ +     A+     +    + 
Sbjct: 4   QTDRPLSPFLT-YRWTLTMAMSLIHRATGIALYGGTLLMAWGLIATASSPAAYACFEAFA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + +F +TW+++HH L G+RYL+WD            M +  +I  +L  + VW 
Sbjct: 63  TSWIGRIAIFGFTWSLMHHALSGLRYLVWDTGHGYAPGPREGMTRGALIGGVLATIAVWA 122

Query: 125 IK 126
           I 
Sbjct: 123 IA 124


>gi|163738939|ref|ZP_02146352.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis BS107]
 gi|163741817|ref|ZP_02149207.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis 2.10]
 gi|161384990|gb|EDQ09369.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis 2.10]
 gi|161387744|gb|EDQ12100.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 127

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 1/117 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQ+YR   T   SI+ RITG+ + +   ++ +WF   A  E    +    M
Sbjct: 6   RGNRPLSPHLQVYRPQITSITSILTRITGNALIVSALLIAWWFLAAATSEDYFRTANAVM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVL 120
                ++ + L    + +H L G+R+LIWD    LD + A ++    II S +LTVL
Sbjct: 66  TSWFGDIVMSLSVLGLWYHTLAGVRHLIWDNGKMLDLEPAQKLGWFVIIGSVVLTVL 122


>gi|114769286|ref|ZP_01446912.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HTCC2255]
 gi|114550203|gb|EAU53084.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HTCC2255]
          Length = 131

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 1/121 (0%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K NRPLSPHL IYR   +   SI+ RITG  + LG  +++ W    +   +    +   
Sbjct: 5   VKGNRPLSPHLTIYRPQMSSISSILVRITGVSLALGFILIITWLLAASTNVYYFDCINSI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLIV 122
           +      + L    WA+ +H LGGIR+LIWD+    D KIA ++  + II S +LT+ +V
Sbjct: 65  LTSWFGIIVLIGSVWALCYHSLGGIRHLIWDMGFGFDLKIADRLGWMVIIGSFVLTIFVV 124

Query: 123 W 123
           +
Sbjct: 125 Y 125


>gi|209967178|ref|YP_002300093.1| succinate dehydrogenase, cytochrome b556, putative [Rhodospirillum
           centenum SW]
 gi|209960644|gb|ACJ01281.1| succinate dehydrogenase, cytochrome b556, putative [Rhodospirillum
           centenum SW]
          Length = 138

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YRL      SI HR+TG  +  GT ++ +W    A G    ++++   
Sbjct: 13  GRPRPLSPHLQVYRLPLPAIASITHRVTGVGLAAGTLLLAWWLIAAATGPEAFATVQAVA 72

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
              +  +CL  + WA  +H + G+R+L+WD    L+
Sbjct: 73  GSPLGLLCLLGWVWAFWYHAMNGVRHLLWDAGYGLE 108


>gi|259415023|ref|ZP_05738945.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter sp.
           TrichCH4B]
 gi|259348933|gb|EEW60687.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter sp.
           TrichCH4B]
          Length = 127

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 68/118 (57%), Gaps = 3/118 (2%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSLRCY 63
           + NRPLSPHL IYR   T   SI+ RITG +  LG   +VV+W    A  E   + +   
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMSSIMVRITG-IAALGVALLVVWWLLAAATSESAFAFIDGL 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA-KINIIASILTVL 120
           M   + ++ +    WA+ +HMLG +R+++WD   CL+ + + ++   + I A++LTVL
Sbjct: 65  MRSWLGDLVMLGAAWAIFYHMLGRLRHVVWDFGYCLEVETSEKLGIGMFIGATVLTVL 122


>gi|89053302|ref|YP_508753.1| succinate dehydrogenase subunit C [Jannaschia sp. CCS1]
 gi|88862851|gb|ABD53728.1| succinate dehydrogenase subunit C [Jannaschia sp. CCS1]
          Length = 127

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 66/117 (56%), Gaps = 1/117 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IY+       SI+ RITG+ + +   +VV+W    A+G    +++  ++
Sbjct: 6   RGNRPLSPHLTIYKPQLNSITSILVRITGNAMLVSAVLVVWWLMAAASGPEYFATVDGWV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVL 120
              + ++ + L    + +H LGG+R+LIWD    LD   + +M    +I S +LTVL
Sbjct: 66  TSVLGDIVMSLSVLGLWYHALGGLRHLIWDAGYGLDADTSDKMGWGMLIGSVVLTVL 122


>gi|254503128|ref|ZP_05115279.1| succinate dehydrogenase, cytochrome b556 subunit [Labrenzia
           alexandrii DFL-11]
 gi|222439199|gb|EEE45878.1| succinate dehydrogenase, cytochrome b556 subunit [Labrenzia
           alexandrii DFL-11]
          Length = 108

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 60/103 (58%)

Query: 23  MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIH 82
           M +SI+HRITG+ +Y GT ++ +W    A G      +       +  + LF +TWA++H
Sbjct: 1   MVMSILHRITGAALYFGTILLAWWLIAAAAGPAYFDFVNAIYGSIIGRLVLFGFTWALVH 60

Query: 83  HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
           HMLGGIR+ IWD+    +K     +AK  II S+   LI+WII
Sbjct: 61  HMLGGIRHFIWDMGAGFEKDAREWLAKATIIGSVSLTLILWII 103


>gi|83313049|ref|YP_423313.1| succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Magnetospirillum magneticum AMB-1]
 gi|82947890|dbj|BAE52754.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 125

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPH+Q+YR+  T  +SI HRITG  + +GT V+ +W    A G       +  + 
Sbjct: 4   RTRPLSPHIQVYRMPFTAILSISHRITGVALAVGTVVLAYWLASAAYGPVAYGHAQAVLG 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
             + ++ LF +T A+ +H+  GIR+L WD     +   A +  ++ + A+    ++ WI
Sbjct: 64  SWLGKLVLFGWTAALFYHLCNGIRHLFWDKGRGYEIAEADKSGRMVVGAAAALTVLAWI 122


>gi|110678932|ref|YP_681939.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           denitrificans OCh 114]
 gi|109455048|gb|ABG31253.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           denitrificans OCh 114]
          Length = 127

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + + + +VV+WF   A      +     +
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNALLISSLLVVWWFLAAATSPEYFAVANGVL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLIV 122
                ++ + L  W + +H L G+R+LIWD  + LD + A ++    I  S +LT+L +
Sbjct: 66  TSWFGDLVMTLSLWGLWYHTLAGVRHLIWDQGIGLDIETAYKLGYAVIGGSFVLTLLTI 124


>gi|83943849|ref|ZP_00956306.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           EE-36]
 gi|83845096|gb|EAP82976.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           EE-36]
          Length = 127

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 63/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A           ++
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNAMLVAALLIVWWFLAAATSAEYFDIANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ +FL    + +H L GIR+LIWD    LD   A ++    +I S++  +I  +
Sbjct: 66  TSWFGDLVMFLSLLGLWYHTLAGIRHLIWDNGYALDIPTAEKLGWAALIGSVVLTIITAL 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|114798487|ref|YP_761916.1| succinate dehydrogenase, cytochrome b556 subunit [Hyphomonas
           neptunium ATCC 15444]
 gi|114738661|gb|ABI76786.1| succinate dehydrogenase, cytochrome b556 subunit [Hyphomonas
           neptunium ATCC 15444]
          Length = 132

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 1   MSSIKN--NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLS 58
           MS  K    RPLSPH+QI+R   +   SI HRITG  +Y+GT ++  W   +A      +
Sbjct: 1   MSGTKRAATRPLSPHIQIWRWHISALASITHRITGGALYVGTFLIAAWLVALAISPDAYA 60

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD-VSLCLDKKIATQMAKINIIASIL 117
           ++   +     ++ LFL+  A + H+  GIR+LIWD   +    K+A+Q++    + +IL
Sbjct: 61  AMEGIITSIPGKIVLFLWAVATLFHLYNGIRHLIWDGPGIGFSPKVASQVSTFIYVLAIL 120

Query: 118 T 118
           +
Sbjct: 121 S 121


>gi|332559447|ref|ZP_08413769.1| succinate dehydrogenase cytochrome b556 subunit [Rhodobacter
           sphaeroides WS8N]
 gi|332277159|gb|EGJ22474.1| succinate dehydrogenase cytochrome b556 subunit [Rhodobacter
           sphaeroides WS8N]
          Length = 127

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR+  T   SI  R+TG+ + +GT +V +W    A       +
Sbjct: 1   MAETKRVERPLSPHLQIYRVQLTSTTSIFTRLTGNGLIVGTMLVTWWLLAAALSPEQFET 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI----NIIAS 115
               +     ++ L L  WA+ +H L G+R+L WD    L+ K A ++       +++ +
Sbjct: 61  ADWVLTSWFGDIVLLLSVWALWYHYLAGLRHLYWDTGKGLEIKTAEKLGMACIGGSLVPT 120

Query: 116 ILTVLIV 122
           +LTV+I+
Sbjct: 121 LLTVIII 127


>gi|146276143|ref|YP_001166302.1| succinate dehydrogenase, cytochrome b subunit [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554384|gb|ABP68997.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides ATCC
           17025]
          Length = 127

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR+  T   SI  RITG+ + +GT +V +W    A G    ++
Sbjct: 1   MAETKRVERPLSPHLQIYRVQLTSTTSIFTRITGNGLIVGTMLVTWWLLAAALGPEQFAT 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
               +     ++ L L  WA+ +H L G+R+L WD    L+   A ++ 
Sbjct: 61  ADAVLTSWFGDIVLLLSVWALWYHYLAGLRHLYWDTGKGLEITTAEKLG 109


>gi|307822158|ref|ZP_07652390.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacter
           tundripaludum SV96]
 gi|307736724|gb|EFO07569.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacter
           tundripaludum SV96]
          Length = 129

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 68/120 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +I  NRP SPHLQ+Y+L  T  +SI HR+TG ++  G  + V+    +A G  + ++++ 
Sbjct: 2   AINTNRPTSPHLQVYKLPLTGIISITHRMTGIMLTAGLILFVYVISALAGGADSYTAMQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            M   +F++ ++ + +A+  H+  G+R+LIWD     +     + A I + AS+   L+ 
Sbjct: 62  LMSLWLFKLVIWAFIYALFFHLCHGVRHLIWDSGSSFELDTLNRYAMIELAASLALTLMT 121


>gi|77464554|ref|YP_354058.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides 2.4.1]
 gi|126463394|ref|YP_001044508.1| succinate dehydrogenase, cytochrome b subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221640465|ref|YP_002526727.1| Succinate dehydrogenase subunit C [Rhodobacter sphaeroides KD131]
 gi|77388972|gb|ABA80157.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides 2.4.1]
 gi|126105058|gb|ABN77736.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161246|gb|ACM02226.1| Succinate dehydrogenase subunit C [Rhodobacter sphaeroides KD131]
          Length = 127

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR+  T   SI  R+TG+ + +GT +V +W    A       +
Sbjct: 1   MAETKRVERPLSPHLQIYRVQLTSTTSIFTRLTGNGLIVGTMLVTWWLLAAALSPEQFET 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI----NIIAS 115
               +     ++ L L  WA+ +H L G+R+L WD    L+ K A ++       +++ +
Sbjct: 61  ADWVLTSWFGDIVLLLSVWALWYHYLAGLRHLYWDTGKGLEIKTAEKLGMACIGGSLVLT 120

Query: 116 ILTVLIV 122
           +LTV+I+
Sbjct: 121 LLTVIII 127


>gi|83953490|ref|ZP_00962212.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           NAS-14.1]
 gi|83842458|gb|EAP81626.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           NAS-14.1]
          Length = 127

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 58/112 (51%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A           ++
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNAMLVAALLIVWWFLAAATSAEYFDIANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
                ++ +FL    + +H L GIR+LIWD    LD   A ++    +I S+
Sbjct: 66  TSWFGDLVMFLSLLGLWYHTLAGIRHLIWDNGYALDIPTAEKLGWAALIGSV 117


>gi|148251845|ref|YP_001236430.1| succinate dehydrogenase subunit C [Bradyrhizobium sp. BTAi1]
 gi|146404018|gb|ABQ32524.1| succinate dehydrogenase subunit C [Bradyrhizobium sp. BTAi1]
          Length = 111

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 58/107 (54%)

Query: 23  MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIH 82
           M +SIVHR TG  +Y GT ++ +W    A+G    S ++ +M   +  + +F YTWA++H
Sbjct: 1   MILSIVHRATGVALYFGTLLLAWWLIAAASGPSAYSYVQGFMGSFLGRLIMFGYTWALLH 60

Query: 83  HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV 129
           H+L GIR+ +WD+           +    +I  I   ++VWI+   V
Sbjct: 61  HLLSGIRHFVWDLGYGFKPNERETLTWGALIGGITLTVLVWIVAYAV 107


>gi|114764872|ref|ZP_01444054.1| Succinate dehydrogenase cytochrome b-556 subunit [Pelagibaca
           bermudensis HTCC2601]
 gi|114542758|gb|EAU45781.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           HTCC2601]
          Length = 131

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 73/131 (55%), Gaps = 7/131 (5%)

Query: 1   MSSIKN-NRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL 57
           M+  K   RPLSP +  Q YRL  T   S++ RITG+ + + T +V++W   +A G    
Sbjct: 1   MAEAKRIERPLSPFMFVQYYRLQLTAVTSVMIRITGNALMVATLLVIWWLLALAAGPEAF 60

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI----NII 113
            +   ++   V  + +F   WAV +H LGG+R+LI+D    L+ + A ++       +++
Sbjct: 61  ETAEWWITSWVGNLVMFGSLWAVWYHYLGGLRHLIFDAGKGLELETAEKLGWACVYGSVV 120

Query: 114 ASILTVLIVWI 124
            ++LTV+I WI
Sbjct: 121 LTVLTVIIYWI 131


>gi|294085393|ref|YP_003552153.1| succinate dehydrogenase subunit C [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664968|gb|ADE40069.1| succinate dehydrogenase subunit C [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 123

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 63/122 (51%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RPLSPHLQIY+   T  +SI HR TG V+  GT +V  W   +A GE + +     
Sbjct: 1   MSKPRPLSPHLQIYKPQMTSVLSICHRATGVVLATGTGLVCLWLIALALGEDSFALATMI 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + +  LF Y+  + +H   GIR+L WD+   L+        +I + A+++   I W
Sbjct: 61  IQHPLGQFVLFGYSAVLFYHACNGIRHLAWDMGYGLEIPQVYATGRIVLAATVILTGIFW 120

Query: 124 II 125
            +
Sbjct: 121 FL 122


>gi|163744267|ref|ZP_02151627.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanibulbus
           indolifex HEL-45]
 gi|161381085|gb|EDQ05494.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanibulbus
           indolifex HEL-45]
          Length = 127

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 1/122 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPH+ IYR   T   SI+ RITG+ + +   ++V+WF   A       ++   M
Sbjct: 6   RGNRPLSPHMTIYRPQLTSMTSILTRITGNAMLITALLIVWWFLAAATSVEYFDTVNGIM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLIVW 123
                ++   L    + +H L GIR+LIWD    LD   A ++    +I S +LTVL V 
Sbjct: 66  TSWFGDLVFTLSLLGLWYHTLAGIRHLIWDTGRMLDVPTAEKLGIAALIGSVVLTVLTVI 125

Query: 124 II 125
           I+
Sbjct: 126 IV 127


>gi|157803312|ref|YP_001491861.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           canadensis str. McKiel]
 gi|157784575|gb|ABV73076.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           canadensis str. McKiel]
          Length = 124

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP+SPHL IY++  +  +SI+HRITG  ++    ++ +W        + L    
Sbjct: 6   QEIYNKRPISPHLSIYKMQISSTLSILHRITGVALFFAVSILAWWLILSKYDNNYLYLAS 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           CY    + ++CL   ++A  +H+  GIRYL W +  C   K         +I S L  ++
Sbjct: 66  CY----IIKICLVAVSYAWFYHLCNGIRYLFWAIGYCFSIKAVNITGWCVVICSTLLTIL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|288957014|ref|YP_003447355.1| succinate dehydrogenase cytochrome b-556 subunit [Azospirillum sp.
           B510]
 gi|288909322|dbj|BAI70811.1| succinate dehydrogenase cytochrome b-556 subunit [Azospirillum sp.
           B510]
          Length = 142

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 72/121 (59%), Gaps = 2/121 (1%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           + RPLSPHLQ+Y+L  T  +SI HRITG  + +GT ++V+W    A G    +  + ++ 
Sbjct: 18  SGRPLSPHLQVYKLPLTAVMSITHRITGVGLAVGTLLLVWWLVAAAAGPEAFARAQGFI- 76

Query: 66  GSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           GS F + L F ++ A+ +H+  GIR+L+WD     +   A +  +I +IA+    ++ WI
Sbjct: 77  GSFFGLLLMFGWSAALYYHLCNGIRHLVWDAGKSFELTDADRNNRIVLIATAALTVLTWI 136

Query: 125 I 125
           +
Sbjct: 137 V 137


>gi|159045407|ref|YP_001534201.1| putative succinate dehydrogenase cytochrome subunit B
           [Dinoroseobacter shibae DFL 12]
 gi|157913167|gb|ABV94600.1| putative succinate dehydrogenase cytochrome b subunit
           [Dinoroseobacter shibae DFL 12]
          Length = 127

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 9/123 (7%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RPLSPH+QIYR   T   SI+ RITG+ + +G  + V+W    A G    +    ++
Sbjct: 6   RGDRPLSPHIQIYRPQLTSVTSILTRITGNALLVGALLCVWWLIAAAAGPEYFA----FV 61

Query: 65  DG---SVFEVCLFLYT-WAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTV 119
           DG   S F   +FL + WA+ +H L G+R+LIWD     + K A  +  + I  S +LTV
Sbjct: 62  DGLVTSWFGKLVFLGSIWALWYHTLAGVRHLIWDAGYGFELKDAYALGYMVIGGSVVLTV 121

Query: 120 LIV 122
           + V
Sbjct: 122 ITV 124


>gi|121996856|ref|YP_001001643.1| succinate dehydrogenase, cytochrome b subunit [Halorhodospira
           halophila SL1]
 gi|121588261|gb|ABM60841.1| succinate dehydrogenase subunit C [Halorhodospira halophila SL1]
          Length = 129

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 64/120 (53%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           NRPLSPHL IYR   T  +S++HR TG  V +   ++V W   +A G      L   +  
Sbjct: 5   NRPLSPHLTIYRPQLTSLLSVLHRGTGVFVTMAAVLLVAWVMALAAGPEYYELLTQVLGH 64

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            + ++ L   T+++ +H+  GIR+L+WD     + K   +   + + AS+L   +VW+I 
Sbjct: 65  WLGQLVLLGITFSLAYHLCNGIRHLVWDTVRAFELKAVYRGGYMVLAASVLLTALVWVIA 124


>gi|114571387|ref|YP_758067.1| succinate dehydrogenase, cytochrome b subunit [Maricaulis maris
           MCS10]
 gi|114341849|gb|ABI67129.1| succinate dehydrogenase, cytochrome b subunit [Maricaulis maris
           MCS10]
          Length = 130

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 1/124 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSL 60
           S   + RP+SPHLQ++R   TM  SI+HR TG   Y+G   +  W   +A G E ++S L
Sbjct: 3   SDWSDPRPMSPHLQVWRWHATMASSILHRATGVANYIGAVAISVWVVLLAFGAEGSISFL 62

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  V    L   T++V +H L G+R+L+WD     D K +   + + I  +++   
Sbjct: 63  FEGWMAWVTRFGLIALTYSVSYHWLNGLRHLLWDAGKGYDPKGSNLRSILIIFGAVIPTA 122

Query: 121 IVWI 124
           ++W+
Sbjct: 123 LIWL 126


>gi|84684219|ref|ZP_01012121.1| Succinate dehydrogenase cytochrome b-556 subunit [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667972|gb|EAQ14440.1| Succinate dehydrogenase cytochrome b-556 subunit [Rhodobacterales
           bacterium HTCC2654]
          Length = 127

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (50%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQ YRL     +SI+HRITG  +     ++V++F  +A G     +    +
Sbjct: 6   QGNRPLSPHLQAYRLPLNAKLSILHRITGVAMGFSGVLIVWYFLALATGPEYFETASAVL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI 112
                ++  FL   A+  H   G+R+LIWD      +K   + A I I
Sbjct: 66  TSWFGDIVFFLSICALWLHFANGVRHLIWDTGSHFGQKTVNRSALIGI 113


>gi|254465461|ref|ZP_05078872.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium Y4I]
 gi|206686369|gb|EDZ46851.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium Y4I]
          Length = 127

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 64/117 (54%), Gaps = 1/117 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQ+YR   T   SI+ RITG+ + +   ++ +WF   A      ++    +
Sbjct: 6   RGNRPLSPHLQVYRPQLTSVTSILTRITGNALIVSALLIAWWFLAAATSADYFATANGLL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA-KINIIASILTVL 120
                ++ + L    + +H L GIR+LIWD    L+ + A ++   + I +++LTVL
Sbjct: 66  TSWFGDLVMTLSVLGLWYHTLAGIRHLIWDNGYMLELEQAEKLGWGVVIGSAVLTVL 122


>gi|85374260|ref|YP_458322.1| hypothetical protein ELI_07165 [Erythrobacter litoralis HTCC2594]
 gi|84787343|gb|ABC63525.1| hypothetical protein ELI_07165 [Erythrobacter litoralis HTCC2594]
          Length = 126

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (51%), Gaps = 1/120 (0%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMD 65
           NRPLSPHLQI++  P M VSI+HRITG  + L G  V+++W   +A+G     +      
Sbjct: 3   NRPLSPHLQIWKWGPHMLVSILHRITGDGMALVGLGVLLWWLGALASGPEAYETFSTLAT 62

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
             +  V L   +WA   H++ G+R+ + D+    +       + ++ +  +L  +  W +
Sbjct: 63  TPIGYVVLVGLSWAFFTHLMSGLRHFVLDIGAGYELDTNKMWSIVSPVLGVLLTVAFWAV 122


>gi|84515883|ref|ZP_01003244.1| succinate dehydrogenase, cytochrome b556 subunit [Loktanella
           vestfoldensis SKA53]
 gi|84510325|gb|EAQ06781.1| succinate dehydrogenase, cytochrome b556 subunit [Loktanella
           vestfoldensis SKA53]
          Length = 127

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (54%), Gaps = 22/131 (16%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF---------FCIANGEH 55
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF         F +A+G  
Sbjct: 6   RGNRPLSPHLTIYRPQWTSITSILVRITGNALLVAGLLIVWWFVAAATGPAAFALADGVL 65

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD----KKIATQMAKIN 111
           T    +  M GS+         WA+ +H LGG+R+L+WD    LD    ++    M  ++
Sbjct: 66  TSWFGKLVMLGSI---------WALWYHSLGGLRHLVWDSGRMLDVASSERAGQAMVALS 116

Query: 112 IIASILTVLIV 122
           ++ +I+TV+I+
Sbjct: 117 VVLTIITVIIL 127


>gi|85706758|ref|ZP_01037850.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           217]
 gi|85668816|gb|EAQ23685.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           217]
          Length = 127

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 1/117 (0%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR   T   SI+ RITG+ + +   ++V+W    +  ++  + 
Sbjct: 1   MAETKQVERPLSPHLQIYRPQLTSITSILTRITGNALVVAAALIVWWLLAASTSDNYFAM 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
               +     ++ L L  WAV +H L G+R+L +D    +D   A ++    II S+
Sbjct: 61  ADAVLTSWFGDLVLTLSLWAVWYHYLAGLRHLYFDAGKGMDIPTAEKLGWACIIGSV 117


>gi|149913137|ref|ZP_01901671.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           AzwK-3b]
 gi|149813543|gb|EDM73369.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           AzwK-3b]
          Length = 127

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHLQ+YR   T   SI+ RITG+ + +G  ++V+W    A G    +     +
Sbjct: 6   RGERPLSPHLQVYRPQMTSISSILTRITGNALIVGVLLIVWWLLAAATGPDYFAIADAVV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA----KINIIASILTVL 120
                ++ L L  WA+ +H L G+R+L +D    L+ + + ++       ++I +++T+L
Sbjct: 66  TSWFGDLVLTLSLWAIWYHYLAGLRHLYYDAGKGLEIETSEKLGWACIGGSVILTVITLL 125

Query: 121 IV 122
           I+
Sbjct: 126 II 127


>gi|67459555|ref|YP_247179.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia felis
           URRWXCal2]
 gi|75536045|sp|Q4UKC1|DHSC_RICFE RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|67005088|gb|AAY62014.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia felis
           URRWXCal2]
          Length = 124

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+L  +  +SI+HR+TG  ++    ++ +W        + L    
Sbjct: 6   QEIYNKRPTSPHLSIYKLQISSTLSILHRMTGVALFFAVSILAWWLILSKYDNNYLQFAN 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K         ++ SIL  ++
Sbjct: 66  C----CIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|126725053|ref|ZP_01740896.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium HTCC2150]
 gi|126706217|gb|EBA05307.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium HTCC2150]
          Length = 139

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 58/117 (49%), Gaps = 1/117 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHL IYR   T   SI  RITG+ + L   ++V+W    A G       R  +
Sbjct: 18  RGKRPLSPHLTIYRPQLTSMTSIFTRITGNAMLLAALMIVWWLLAAATGPGYYDLARTVI 77

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVL 120
                 + + L  WA+ +H   G+R+L WD     + K A ++  + I  S ILTVL
Sbjct: 78  TSWFGSLIMILSLWALWYHFCAGLRHLYWDTGRGFEIKQAERLGIMVIAGSFILTVL 134


>gi|315497255|ref|YP_004086059.1| succinate dehydrogenase, cytochrome b556 subunit [Asticcacaulis
           excentricus CB 48]
 gi|315415267|gb|ADU11908.1| succinate dehydrogenase, cytochrome b556 subunit [Asticcacaulis
           excentricus CB 48]
          Length = 143

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (50%), Gaps = 7/130 (5%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLS 58
           S+    RPLSPHLQ+++   TMF SI+HR TG    +G  +V  W   I   A+G H   
Sbjct: 6   STEAAYRPLSPHLQVWKFHITMFTSILHRATGIASVVGAVMVAAWLLAIGLTASG-HCPE 64

Query: 59  SLRCYMDGSVFEVCLFLY---TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
           +   ++  +     LF++   T A   H+ GG+R+LIWD+ L      A  +A  +++  
Sbjct: 65  AYTLFLSFAASPFGLFVWFGLTLAGFIHLTGGLRHLIWDMGLGFKISSANALAWWSLLGG 124

Query: 116 ILTVLIVWII 125
           I   L  W +
Sbjct: 125 IALTLAFWAV 134


>gi|157825304|ref|YP_001493024.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia akari
           str. Hartford]
 gi|157799262|gb|ABV74516.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia akari
           str. Hartford]
          Length = 124

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP+SPHL IY+   +  +SI+HRITG  ++    ++V+W        + L   +
Sbjct: 6   QEIYNKRPISPHLTIYKPQISSTLSILHRITGVALFFAVSILVWWLILSKYDNNYLQFAK 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   +++  +H+  GIR+L WD+      K         ++ S+L  ++
Sbjct: 66  C----CIIKICLVAVSYSWFYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVGSLLLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|51473326|ref|YP_067083.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia typhi
           str. Wilmington]
 gi|81390260|sp|Q68XP1|DHSC_RICTY RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|51459638|gb|AAU03601.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia typhi
           str. Wilmington]
          Length = 124

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++V+W        + L   R
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNYLQLAR 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL  +++A  +H+  GIR+L WD+      +         ++ SIL  ++
Sbjct: 66  C----CIIKICLVAFSYAWCYHLCNGIRHLFWDIGYGFSIRAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|332188523|ref|ZP_08390243.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingomonas sp.
           S17]
 gi|332011428|gb|EGI53513.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingomonas sp.
           S17]
          Length = 161

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 68/138 (49%), Gaps = 21/138 (15%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGS-VVYLGTPVVVFWFFCIANGEHTLSS 59
           +++    RPLSPHLQI++  P M VSI+HR TG+ +  +G  ++V++   IA G  + ++
Sbjct: 26  LAARNTARPLSPHLQIWKWGPNMLVSILHRATGTGMATVGAALLVWFLAAIAGGPESYAT 85

Query: 60  LR-------------CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQ 106
            R              Y+ G     CLF        H+  GIR+L  DV    + K   +
Sbjct: 86  FRDVFTVQSGRLNIIGYVVGIGLTACLF-------QHLANGIRHLFMDVGAGFELKSNKR 138

Query: 107 MAKINIIASILTVLIVWI 124
            A+  I+ +++  +  W+
Sbjct: 139 QAQATIVFAVVMTVAFWL 156


>gi|149201370|ref|ZP_01878345.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           TM1035]
 gi|149145703|gb|EDM33729.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           TM1035]
          Length = 127

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQIYR   T   SI+ RITG+ + +   ++V+W    +  +   +     +  
Sbjct: 8   ERPLSPHLQIYRPQLTSITSILTRITGNALIVAALLIVWWLLAASTSDAYFAMADAVLTS 67

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
              ++ L L  WAV +H L G+R+L +D    +D   A ++    II S++  +I
Sbjct: 68  WFGDLVLSLSAWAVWYHYLAGLRHLYFDAGKGMDIPTAEKLGWGCIIGSVVLTVI 122


>gi|126734839|ref|ZP_01750585.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           CCS2]
 gi|126715394|gb|EBA12259.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           CCS2]
          Length = 127

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 71/122 (58%), Gaps = 4/122 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A G    ++   ++
Sbjct: 6   RGNRPLSPHLTIYRPQWTSMSSILVRITGNALIVAALMIVWWFVAAAAGPDAFATANGFV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD---KKIATQMAKI-NIIASILTVL 120
                ++ + L    + +H+LGG+R+L+WD    LD    ++A QM  + +++ +I T++
Sbjct: 66  TSWFGDLIMTLSVLGLWYHLLGGLRHLVWDSGRMLDVDKSELAAQMMVVLSVLLTIFTIV 125

Query: 121 IV 122
           +V
Sbjct: 126 VV 127


>gi|299133110|ref|ZP_07026305.1| succinate dehydrogenase, cytochrome b556 subunit [Afipia sp. 1NLS2]
 gi|298593247|gb|EFI53447.1| succinate dehydrogenase, cytochrome b556 subunit [Afipia sp. 1NLS2]
          Length = 111

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (53%)

Query: 23  MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIH 82
           M +SI+HRITG  +Y GT ++ +W    A+G    + L+ +    +  +    +TW+++H
Sbjct: 1   MIMSIIHRITGLALYAGTLLLAWWLIATASGPAAYACLQSFTASWIGRLIEIGFTWSLLH 60

Query: 83  HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           H   G+RYL+WD       +   ++ +  +IA ++    +WI
Sbjct: 61  HAFSGLRYLVWDTGHGFGVEARERLTQAALIAGVVATAALWI 102


>gi|144898837|emb|CAM75701.1| succinate dehydrogenase cytochrome b556 subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 138

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            NRPLSPHL +YRL     +SI HRITG  + +G   + +W    A+G    +  +    
Sbjct: 16  RNRPLSPHLDVYRLPLLAIMSITHRITGVGLAIGMFALAWWLCAAASGPAEFAVAQAVFG 75

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
             + ++ LF +T A+  H+  GIR+L+WD     +   A   AK+ + A+++  +I WII
Sbjct: 76  SFLGKLFLFGWTVALFFHLSHGIRHLLWDSGWGFEIPQAYLSAKVALGATVVLTVIAWII 135


>gi|285018596|ref|YP_003376307.1| succinate dehydrogenase_cytochrome b subunit protein [Xanthomonas
           albilineans GPE PC73]
 gi|283473814|emb|CBA16316.1| putative succinate dehydrogenase_cytochrome b subunit protein
           [Xanthomonas albilineans]
          Length = 130

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 62/119 (52%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SIVHR TG V+  G  ++V     +  G+ +    R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSIVHRATGIVLAFGALLIVAALLLLMCGQASWDCFRALAG 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF ++WA  +H+  G+R+++ D           + + +++I S++ V ++W+
Sbjct: 64  AWYGQVFLFAWSWAFAYHLCNGLRHIVQDFGHGFSIPAFLRSSWLSVIGSLVIVALIWV 122


>gi|194365313|ref|YP_002027923.1| succinate dehydrogenase, cytochrome b556 subunit [Stenotrophomonas
           maltophilia R551-3]
 gi|194348117|gb|ACF51240.1| succinate dehydrogenase, cytochrome b556 subunit [Stenotrophomonas
           maltophilia R551-3]
          Length = 130

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 61/118 (51%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI+HR TG  + +G  ++      +  G  + +    +  
Sbjct: 4   RQRPLSPHLQVYRWQIQMATSILHRATGVFLSVGALIIAAGLLALMMGPDSWNCFTGHAG 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
                V LF +TW+  +H+  GIR+++ D ++        + + +++I S++  L+VW
Sbjct: 64  AWYGRVFLFAWTWSFAYHLCNGIRHVVQDFAIGFSIPAFIRSSWLSVIGSLVITLLVW 121


>gi|87199761|ref|YP_497018.1| succinate dehydrogenase subunit C [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135442|gb|ABD26184.1| succinate dehydrogenase subunit C [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 141

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 69/138 (50%), Gaps = 18/138 (13%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF-CIANGEHTLSS 59
           M+  +  RP+SPHLQI+R  P M VSI+HRITG+ +      ++ W+   +A+G     S
Sbjct: 1   MAQARKARPISPHLQIWRWGPAMLVSILHRITGNGLAFAGLGLLLWWVGALASGPE---S 57

Query: 60  LRCYMD----GS----------VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIAT 105
            + ++D    GS          + ++ L   +WA   H   GIR+LI D+    +     
Sbjct: 58  YQTFLDWVWVGSAGGIQAVTAILGKIVLVGLSWAFFQHAASGIRHLILDIGAGYELDANA 117

Query: 106 QMAKINIIASILTVLIVW 123
           + + + I+ S+L  +  W
Sbjct: 118 RWSSLTIVISVLLTIAFW 135


>gi|157964193|ref|YP_001499017.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           massiliae MTU5]
 gi|157843969|gb|ABV84470.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           massiliae MTU5]
          Length = 124

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  C----CIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|239947122|ref|ZP_04698875.1| succinate dehydrogenase, cytochrome b556 subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921398|gb|EER21422.1| succinate dehydrogenase, cytochrome b556 subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 124

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++ +W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFAVSILAWWLILSKYDNNYLQLAN 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K         ++ SIL  ++
Sbjct: 66  C----CIIKICLVAASYAWFYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|86138977|ref|ZP_01057548.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           MED193]
 gi|85824208|gb|EAQ44412.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           MED193]
          Length = 127

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+W    A      ++    M
Sbjct: 6   RGNRPLSPHLSIYRPQMTSLSSILTRITGNALIISVMLIVWWLLAAATSPAYFATANGVM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
                ++ L L T  + +H L G+R+L +D    LD + A ++    +I S
Sbjct: 66  TSWFGDIVLALSTLGIWYHFLAGLRHLYFDAGHGLDIETAEKLGWGMMIGS 116


>gi|15892091|ref|NP_359805.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           conorii str. Malish 7]
 gi|229586366|ref|YP_002844867.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           africae ESF-5]
 gi|21362479|sp|Q92J99|DHSC_RICCN RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|15619214|gb|AAL02706.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           conorii str. Malish 7]
 gi|228021416|gb|ACP53124.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           africae ESF-5]
          Length = 124

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  C----CIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|34580878|ref|ZP_00142358.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           sibirica 246]
 gi|28262263|gb|EAA25767.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           sibirica 246]
          Length = 124

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSQYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  C----CIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|190573776|ref|YP_001971621.1| putative succinate dehydrogenase cytochrome b-556 subunit
           [Stenotrophomonas maltophilia K279a]
 gi|190011698|emb|CAQ45317.1| putative succinate dehydrogenase cytochrome b-556 subunit
           [Stenotrophomonas maltophilia K279a]
          Length = 130

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 60/118 (50%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI+HR TG  + +G  ++      +  G  + +    +  
Sbjct: 4   RQRPLSPHLQVYRWQIQMATSILHRATGVFLSVGALIIAAGLLALMMGPESWNCFTGHAG 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
                V LF +TW+  +H+  GIR+++ D ++        + + +++  S++  L+VW
Sbjct: 64  AWYGRVFLFAWTWSFAYHLCNGIRHVVQDFAIGFSIPAFIRSSWLSVTGSLVITLLVW 121


>gi|15604003|ref|NP_220518.1| succinate dehydrogenase cytochrome B560 subunit (sdhC) [Rickettsia
           prowazekii str. Madrid E]
 gi|729336|sp|P41085|DHSC_RICPR RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|409934|gb|AAA18325.1| putative hydrophobic subunit of succinate dehydrogenase [Rickettsia
           prowazekii]
 gi|3860694|emb|CAA14595.1| SUCCINATE DEHYDROGENASE CYTOCHROME B560 SUBUNIT (sdhC) [Rickettsia
           prowazekii]
 gi|292571719|gb|ADE29634.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           prowazekii Rp22]
          Length = 124

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNYLQLAS 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL  ++++  +H+  GIR+L WD+      K         ++ SIL  ++
Sbjct: 66  C----CIIKICLVAFSYSWCYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|84500178|ref|ZP_00998444.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           batsensis HTCC2597]
 gi|84392112|gb|EAQ04380.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           batsensis HTCC2597]
          Length = 129

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (4%)

Query: 5   KNNRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + NRPLSP +  Q YR       SI+ RITG+ + +   ++ +WF   A G         
Sbjct: 6   RGNRPLSPFMLGQYYRFQLNSVASILTRITGNALIVAAFLIAWWFMAAAAGPEYFRVADY 65

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI----NIIASILT 118
            +   V ++ L   T  + +H L G+R+LIWD    LD + + +M+ I    +++ ++LT
Sbjct: 66  VITSWVGDLILLFSTLGLWYHTLAGVRHLIWDNGYLLDMESSDKMSWIIIGGSVVLTLLT 125

Query: 119 VLIV 122
           V+IV
Sbjct: 126 VIIV 129


>gi|157828041|ref|YP_001494283.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165932739|ref|YP_001649528.1| succinate dehydrogenase cytochrome b556 subunit [Rickettsia
           rickettsii str. Iowa]
 gi|157800522|gb|ABV75775.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165907826|gb|ABY72122.1| succinate dehydrogenase cytochrome b556 subunit [Rickettsia
           rickettsii str. Iowa]
          Length = 124

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  C----CIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVLGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|53804146|ref|YP_114003.1| succinate dehydrogenase, cytochrome b556 subunit [Methylococcus
           capsulatus str. Bath]
 gi|53757907|gb|AAU92198.1| putative succinate dehydrogenase, cytochrome b556 subunit
           [Methylococcus capsulatus str. Bath]
          Length = 138

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 52/97 (53%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YRL  T  +SI HRITG ++ +G   +V     +  G    + +  ++ 
Sbjct: 14  RERPLSPHLQVYRLPVTALLSISHRITGVLLGIGLIGLVLVLMSVVQGPSAYAPVHAFLS 73

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           G      L+++  A++ H+  GIR+L+WD      + 
Sbjct: 74  GIAGRSLLWIWITALLFHLSHGIRHLVWDTGHGFSRD 110


>gi|126730329|ref|ZP_01746140.1| succinate dehydrogenase, cytochrome b556 subunit [Sagittula
           stellata E-37]
 gi|126709062|gb|EBA08117.1| succinate dehydrogenase, cytochrome b556 subunit [Sagittula
           stellata E-37]
          Length = 131

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 66/119 (55%), Gaps = 5/119 (4%)

Query: 5   KNNRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSLR 61
           + NRPLSP +  Q YR   T   SI+ RITG +  LGT  ++V W  C A      + + 
Sbjct: 8   RGNRPLSPFMIGQYYRPQMTSISSIMVRITG-IASLGTAALLVLWLLCAATSPDAYAVVN 66

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII-ASILTV 119
             +   + +V + L +WA+ +HMLG +R++IWD+   ++ + +  M  I  I AS++ +
Sbjct: 67  GILTSFIGDVLMLLASWAIWYHMLGRLRHVIWDLGYMVEIEPSEMMGWIMFIGASVMAI 125


>gi|99078501|ref|YP_611759.1| succinate dehydrogenase subunit C [Ruegeria sp. TM1040]
 gi|99035639|gb|ABF62497.1| succinate dehydrogenase subunit C [Ruegeria sp. TM1040]
          Length = 127

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 67/122 (54%), Gaps = 1/122 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHL IYR   T   SI+ RITG        +VV+W    A  E   + +   +
Sbjct: 6   RGKRPLSPHLTIYRPQLTSMSSIMVRITGIAALAVALLVVWWLLAAATSESAFAFIDGLL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA-KINIIASILTVLIVW 123
              + ++ + L  WA+ +HMLG +R+++WD   CL+ + + ++   + I A++LTVL   
Sbjct: 66  RSWLGDIVMLLAAWAIFYHMLGRLRHVVWDFGYCLEVETSEKLGVGMFIGATVLTVLAAL 125

Query: 124 II 125
           ++
Sbjct: 126 VV 127


>gi|262277891|ref|ZP_06055684.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HIMB114]
 gi|262224994|gb|EEY75453.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HIMB114]
          Length = 122

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (45%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K   PLSPHLQ+Y+   +  +SI HR+T     +G      W F +  GE        +
Sbjct: 1   MKFESPLSPHLQVYKWQLSSLLSITHRMTSIFNLMGMMFFALWIFMLFLGEDVYKYFEIF 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               + +       W+  +H+L GIR+L WD+    + K A       +++S +   +VW
Sbjct: 61  SATVIGKFIFVGIIWSFSYHLLNGIRHLFWDMGYGYEIKTANLSGIFVLLSSFILTFLVW 120

Query: 124 II 125
           + 
Sbjct: 121 VF 122


>gi|91762626|ref|ZP_01264591.1| Succinate dehydrogenase cytochrome b [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718428|gb|EAS85078.1| Succinate dehydrogenase cytochrome b [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 127

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + NN PLSPH+QIYR   +  VSI HRITG V      V+  W F +  GE +    + +
Sbjct: 1   MDNNNPLSPHIQIYRWHISSLVSISHRITGIVNIFAITVICLWIFSLLLGESSYDLTKLF 60

Query: 64  MD---GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           +    G    +CL   TW+    +L  IR+L+ D+    + K       + I  SI   +
Sbjct: 61  LQSIFGKFIIICL---TWSFSFQVLSEIRHLVMDLGYGFELKTTKITGLLVIFGSIFFTI 117

Query: 121 IVWII 125
           + +++
Sbjct: 118 LFYLL 122


>gi|260576579|ref|ZP_05844567.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter sp.
           SW2]
 gi|259021183|gb|EEW24491.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter sp.
           SW2]
          Length = 131

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 1   MSSIKNN--RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLS 58
           M+  K    RPLSPHLQ+YR+  +M  S++ RITG  +  G  + V+W    A      +
Sbjct: 1   MAEAKREIVRPLSPHLQVYRMKASMATSVLIRITGVGLMSGFILFVWWLLAAAISPEYFA 60

Query: 59  SLRCYMDGSVFEVCLFLYTWAVI-HHMLGGIRYLIWDVSLCLD----KKIATQMAKINII 113
            +   +  S F   +F+ + A I +H LGG+R+L WD    LD     K++  M     +
Sbjct: 61  FVNGIVT-SWFGYLIFIGSLAAIWYHYLGGLRHLYWDTGKGLDLETVDKLSWGMVIGTPV 119

Query: 114 ASILTVLIVWII 125
            ++LT+L +W I
Sbjct: 120 LTVLTILAIWGI 131


>gi|162147201|ref|YP_001601662.1| succinate dehydrogenase cytochrome b556 subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785778|emb|CAP55349.1| putative Succinate dehydrogenase cytochrome b556 subunit
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 153

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 59/114 (51%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ+YR   +MF+SI +R  G     G+ + V W    A G  +   ++     
Sbjct: 20  RRPMSPHLQVYRFRLSMFLSIANRAAGVAAAAGSVLGVCWLNAAAKGPESFKKVQKVTRN 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
            + ++ L  +T ++++H + G+R+L WD     +KK   +   I +  ++ T L
Sbjct: 80  PLGKLALVGWTLSLVYHFVAGLRHLSWDAGYRFEKKEINEDGPIAVGVTVGTTL 133


>gi|209544254|ref|YP_002276483.1| succinate dehydrogenase, cytochrome b556 subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531931|gb|ACI51868.1| succinate dehydrogenase, cytochrome b556 subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 153

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 59/114 (51%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ+YR   +MF+SI +R  G     G+ + V W    A G  +   ++     
Sbjct: 20  RRPMSPHLQVYRFRLSMFLSIANRAAGVAAAAGSVLGVCWLNAAAKGPESFKRVQKVTRN 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
            + ++ L  +T ++++H + G+R+L WD     +KK   +   I +  ++ T L
Sbjct: 80  PMGKLALVGWTLSLVYHFVAGLRHLSWDAGYRFEKKEINEDGPIAVGVTVGTTL 133


>gi|71082950|ref|YP_265669.1| succinate dehydrogenase cytochrome b [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062063|gb|AAZ21066.1| Succinate dehydrogenase cytochrome b [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 127

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + NN PLSPH+QIYR   +  VSI HRITG V      V+  W F +  GE +    + +
Sbjct: 1   MDNNNPLSPHIQIYRWHISSLVSISHRITGIVNIFAITVICLWIFSLLLGESSYDLTKLF 60

Query: 64  MD---GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           +    G    +CL   TW+    +L  IR+L+ D+    + K         I  SI   +
Sbjct: 61  LQSIFGKFIIICL---TWSFSFQVLSEIRHLVMDLGYGFELKTTKITGLFVIFGSIFFTI 117

Query: 121 IVWII 125
           + +++
Sbjct: 118 LFYLL 122


>gi|148554233|ref|YP_001261815.1| succinate dehydrogenase subunit C [Sphingomonas wittichii RW1]
 gi|148499423|gb|ABQ67677.1| succinate dehydrogenase subunit C [Sphingomonas wittichii RW1]
          Length = 135

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 1/123 (0%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S    RPLSPHL I++  P M VSI+HR TG  +  +     V+W    A+G    ++  
Sbjct: 2   SRNPGRPLSPHLTIWKWGPHMAVSILHRATGVGLAIVAGLAFVWWLVAAASGPDAYATFY 61

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                    +     TW+   H+  G+R+ + D+    + KI    +   ++ S+L  L+
Sbjct: 62  KVATSWFGYLVAIGLTWSFFQHLFSGLRHFVLDIGAGYELKINKTGSIATMVGSVLVTLL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 IWV 124


>gi|254460410|ref|ZP_05073826.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium HTCC2083]
 gi|206676999|gb|EDZ41486.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 103

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%)

Query: 26  SIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHML 85
           SI+ RITG+ + L   ++V+WF   A  E   +    ++     +V LFL  W + +H L
Sbjct: 3   SILTRITGNAMLLAALLIVWWFLAAATSESYFAVANGFLTSWFGDVVLFLSLWGMWYHTL 62

Query: 86  GGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
            G+R+LIWD ++ L+   A +M    I  SIL  LI
Sbjct: 63  AGVRHLIWDNAIGLEINTAEKMGYAVIGGSILLTLI 98


>gi|166712288|ref|ZP_02243495.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 131

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 58/118 (49%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R +  
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLTVGALVIAAALLTLMLGPDHWNCFRDHAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW+   H+ GG+R+++ D       +    M  +++I S +    VW
Sbjct: 64  SWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFVGMGWLSVILSFVLTGAVW 121


>gi|238650698|ref|YP_002916551.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           peacockii str. Rustic]
 gi|238624796|gb|ACR47502.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           peacockii str. Rustic]
          Length = 124

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+       +        ++ S+L  ++
Sbjct: 66  C----CIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSITLVNITCWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|58581933|ref|YP_200949.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84623845|ref|YP_451217.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|50313515|gb|AAT74619.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae]
 gi|58426527|gb|AAW75564.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84367785|dbj|BAE68943.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
          Length = 131

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 58/118 (49%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R +  
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLTVGALVIAAALLTLMLGPDHWNCFRDHAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S +    VW
Sbjct: 64  SWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFVGMGWLSVLLSFVLTGAVW 121


>gi|119383319|ref|YP_914375.1| succinate dehydrogenase, cytochrome b subunit [Paracoccus
           denitrificans PD1222]
 gi|2493412|sp|Q59659|DHSC_PARDE RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|975316|gb|AAA75175.1| succinate dehydrogenase b-type cytochrome subunit [Paracoccus
           denitrificans]
 gi|119373086|gb|ABL68679.1| succinate dehydrogenase subunit C [Paracoccus denitrificans PD1222]
          Length = 130

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 61/121 (50%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQ+YRL      SI+ RITG  +  G  ++ +W           +     +
Sbjct: 6   RGNRPLSPHLQVYRLPLAAITSIMTRITGHALVAGIVLITWWLVAAVTSPGAFACADWVV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + L    WA+ +H+L G+R+L +D    L+ + A + ++  I  S++  ++  I
Sbjct: 66  RSWLGFIILTGSMWALWYHLLAGLRHLFYDAGYGLEIEQAHKSSQALIAGSVVLAVLTLI 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|319779731|ref|YP_004130644.1| Succinate dehydrogenase cytochrome b-556 subunit [Taylorella
           equigenitalis MCE9]
 gi|317109755|gb|ADU92501.1| Succinate dehydrogenase cytochrome b-556 subunit [Taylorella
           equigenitalis MCE9]
          Length = 137

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (53%)

Query: 15  QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLF 74
           + Y+L     +SI+HR++G +++L  P+++  F    +G    +SL     G +  V   
Sbjct: 22  RAYKLPLPAILSILHRVSGVLIFLSLPILIHLFRNSLSGPVMFNSLATGFSGFIIRVVCI 81

Query: 75  LYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           +  W  +HH+  GIR+LI D+ + +DK  A + AKI  I S++   +  I
Sbjct: 82  VALWGFMHHLCAGIRFLILDLHIGMDKVSARKSAKIVFIVSLVLTFVFAI 131


>gi|325920388|ref|ZP_08182319.1| succinate dehydrogenase subunit C [Xanthomonas gardneri ATCC 19865]
 gi|325549135|gb|EGD20058.1| succinate dehydrogenase subunit C [Xanthomonas gardneri ATCC 19865]
          Length = 130

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 57/118 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI+HR TG ++  G  V+      +  G+   + L   + 
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILHRATGIILSGGALVIAAALLVLMLGQDHWTCLTQQLG 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               ++ LF +TWA  +H+  GIR+++ D           +    +++ S+L    +W
Sbjct: 64  AWYGQLFLFGWTWAFAYHLSNGIRHIVQDFGYGYSIPAFVRSGWASVVVSLLITAAIW 121


>gi|119385745|ref|YP_916800.1| succinate dehydrogenase, cytochrome b subunit [Paracoccus
           denitrificans PD1222]
 gi|119376340|gb|ABL71104.1| succinate dehydrogenase subunit C [Paracoccus denitrificans PD1222]
          Length = 125

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP SP++Q YR   T  +S  HR++G    LG   +  W    A+G+    S +  
Sbjct: 1   MSHRRPKSPNMQNYRPQLTSVLSFGHRLSGVAQSLGALGLAAWLMAGASGQDAFGSAQAL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +      + LFL T A+ +H+  G+R+L+WD     + +         +  S++  L +W
Sbjct: 61  LLSVPGRIALFLVTLALFYHLCNGVRHLVWDSGRGFELRAIYAGGWTVVGTSLILTLALW 120


>gi|297183595|gb|ADI19722.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 127

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 1/127 (0%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++N  PLSPH+QIY    +  +SI HRITG +  L   ++  W   +  GE     ++ +
Sbjct: 1   MENKNPLSPHIQIYSWNISSLISISHRITGVINILALTLICLWIVLLLLGEVNYEYIKFF 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLIV 122
           +   + +  +    W+    +L  IR+L WD+    +   +     I I  S +LT+LI 
Sbjct: 61  LQSFLGKFLILCLIWSFSFQILSEIRHLFWDLGYGFELMTSKITGLIVIFGSFVLTILIY 120

Query: 123 WIIKDIV 129
           +I K I+
Sbjct: 121 FIGKQII 127


>gi|170729589|ref|YP_001775022.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           M12]
 gi|167964382|gb|ACA11392.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           M12]
          Length = 151

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 58/124 (46%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           +SS    RPLSPHLQIYR    M  SI+HR TG  + LG  V+      +  G       
Sbjct: 19  LSSPPRERPLSPHLQIYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGAEPWDYF 78

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           R  ++    +  L ++TW   +H+  GIR++  D           + +  +++ SI+   
Sbjct: 79  RSCLNLWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITA 138

Query: 121 IVWI 124
            VW+
Sbjct: 139 GVWV 142


>gi|289665883|ref|ZP_06487464.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289669028|ref|ZP_06490103.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 131

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 57/118 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSVGALVIAAALLTLMLGPDHWNCFRDQTA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW+   H+ GG+R+++ D       +    M  +++I S +    VW
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVILSFVLTGAVW 121


>gi|260425602|ref|ZP_05779582.1| succinate dehydrogenase, cytochrome b556 subunit [Citreicella sp.
           SE45]
 gi|260423542|gb|EEX16792.1| succinate dehydrogenase, cytochrome b556 subunit [Citreicella sp.
           SE45]
          Length = 131

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 75/131 (57%), Gaps = 7/131 (5%)

Query: 1   MSSIKN-NRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL 57
           M+  K   RPLSP +  Q YRL  T   S++ RITG+ + +   ++++W   +A G    
Sbjct: 1   MAEAKRIERPLSPFMFVQYYRLQLTAVTSVMIRITGNAMMVAVLLLIWWLLALAAGPEYF 60

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI----NII 113
            +   ++   V ++ +F   WA+ +H LGG+R+L++D    LD + A ++  I    +++
Sbjct: 61  ETAEWWITSFVGDLIMFGSLWAIWYHYLGGLRHLVFDAGKGLDIETAEKLGWICVYGSVV 120

Query: 114 ASILTVLIVWI 124
            +ILTV+I+W+
Sbjct: 121 LTILTVIIIWL 131


>gi|186920110|ref|YP_001874764.1| succinate:cytochrome c oxidoreductase subunit 4 [Hemiselmis
           andersenii]
 gi|186461056|gb|ACC78218.1| succinate:cytochrome c oxidoreductase subunit 4 [Hemiselmis
           andersenii]
          Length = 142

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 13/107 (12%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFC-IANGEHTLSSLRCY 63
           + NRPLSPHL +Y+   T FVSI HRI+GS++ L   V+ F F+  +   EH +     Y
Sbjct: 18  ETNRPLSPHLYLYKAQLTSFVSIFHRISGSILSLSFIVLAFVFYLDVLFSEHYI----LY 73

Query: 64  MDGSVFEVCLFLYTWAVIH--------HMLGGIRYLIWDVSLCLDKK 102
             G V E   + +  ++ +        H+  G+R+LIWD+ L LD K
Sbjct: 74  CLGLVLETYGYWFFISLSYLLLTFFCLHVFNGMRHLIWDLGLGLDVK 120


>gi|11466547|ref|NP_044796.1| succinate:ubiquinone oxidoreductase subunit 3 [Reclinomonas
           americana]
 gi|1705531|sp|P80481|C560_RECAM RecName: Full=Succinate dehydrogenase cytochrome b560 subunit;
           AltName: Full=Succinate dehydrogenase, subunit III
 gi|2258377|gb|AAD11911.1| succinate:ubiquinone oxidoreductase subunit 3 [Reclinomonas
           americana]
          Length = 144

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 60/127 (47%), Gaps = 11/127 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY--- 63
           NRP+SPHL IY+L  T  +SI HRITG V+ L    + F+   +      LSS   Y   
Sbjct: 20  NRPISPHLTIYKLQITNTLSIFHRITGGVLAL---TLCFFILILKMLNFHLSSYAFYSIA 76

Query: 64  -----MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
                  G +F    F     + +H+  G+R+L+WD    L+ +       I +  + L 
Sbjct: 77  YTLNQYSGFLFIAISFFLLLFIFYHLFAGLRHLVWDAGYALEIENVYLTGYIMLGLAFLF 136

Query: 119 VLIVWII 125
            LI WII
Sbjct: 137 TLIAWII 143


>gi|241663421|ref|YP_002981781.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12D]
 gi|309781916|ref|ZP_07676649.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia sp.
           5_7_47FAA]
 gi|240865448|gb|ACS63109.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12D]
 gi|308919557|gb|EFP65221.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 136

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 65/125 (52%), Gaps = 5/125 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            +IK  RP+  ++ +     YRL     VSI+HR +G++++L  P V++ F      E +
Sbjct: 3   EAIKKARPVYRNIGLGDIARYRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEIS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            +     +     +V +    WA +HH   GIRYLI D+ + +DK  A++ A   +I S+
Sbjct: 63  FAKFTALLSNGFAKVVVLALIWAYLHHFCAGIRYLILDLHIGIDKTSASKSAVSVLIVSL 122

Query: 117 LTVLI 121
           L  ++
Sbjct: 123 LLTVV 127


>gi|83748081|ref|ZP_00945110.1| Hypothetical Protein RRSL_02488 [Ralstonia solanacearum UW551]
 gi|207723905|ref|YP_002254303.1| transmembrane succinate dehydrogenase (cytochrome b-556 subunit)
           protein [Ralstonia solanacearum MolK2]
 gi|207742801|ref|YP_002259193.1| transmembrane succinate dehydrogenase (cytochrome b-556 subunit)
           protein [Ralstonia solanacearum IPO1609]
 gi|83725267|gb|EAP72416.1| Hypothetical Protein RRSL_02488 [Ralstonia solanacearum UW551]
 gi|206589111|emb|CAQ36073.1| transmembrane succinate dehydrogenase (cytochrome b-556 subunit)
           protein [Ralstonia solanacearum MolK2]
 gi|206594195|emb|CAQ61122.1| transmembrane succinate dehydrogenase (cytochrome b-556 subunit)
           protein [Ralstonia solanacearum IPO1609]
          Length = 136

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 64/125 (51%), Gaps = 5/125 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            +IK  RP   ++ +     YRL     VSI+HR +G++++L  P V++ F      E +
Sbjct: 3   EAIKKARPEFRNIGVGDIARYRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEIS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            +     +     +V +    WA +HH   GIRYLI D+ + +DK  + + A   +IAS+
Sbjct: 63  FAKFTALLSNGFAKVVVLALIWAYLHHFCAGIRYLILDLHIGIDKTTSAKSAVSVLIASL 122

Query: 117 LTVLI 121
           L  ++
Sbjct: 123 LLTVV 127


>gi|187929230|ref|YP_001899717.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12J]
 gi|187726120|gb|ACD27285.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12J]
          Length = 136

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 65/125 (52%), Gaps = 5/125 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            +IK  RP+  ++ +     YRL     VSI+HR +G++++L  P V++ F      E +
Sbjct: 3   EAIKKARPVYRNIGLGDIARYRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEIS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            +     +     +V +    WA +HH   G+RYLI D+ + +DK  A++ A   +I S+
Sbjct: 63  FAKFSALLSNGFAKVVVLALIWAYLHHFCAGVRYLILDLHIGIDKASASKSAVSVLIVSL 122

Query: 117 LTVLI 121
           L  ++
Sbjct: 123 LLTVV 127


>gi|73666822|ref|YP_302838.1| succinate dehydrogenase subunit C [Ehrlichia canis str. Jake]
 gi|72393963|gb|AAZ68240.1| succinate dehydrogenase subunit C [Ehrlichia canis str. Jake]
          Length = 136

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 9/101 (8%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV------VFWFFCIANGEHTLSSLR 61
           RPLSPHLQIY+++  +  SI+HR TG ++++G  ++       F F  I    +   S  
Sbjct: 13  RPLSPHLQIYKVVYKL--SIMHRFTGMLLFVGLFIISWGIIAAFLFPKIIYEIYNFFS-T 69

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           CY+    F++  F++     +H L GIR+L+WD+  CL K 
Sbjct: 70  CYLALYSFKLIAFIWLNIFSYHYLNGIRHLLWDLGFCLTKS 110


>gi|325917571|ref|ZP_08179771.1| succinate dehydrogenase subunit C [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536205|gb|EGD08001.1| succinate dehydrogenase subunit C [Xanthomonas vesicatoria ATCC
           35937]
          Length = 131

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 56/118 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+  G   +      +  G      LR +  
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSFGALAIAAALLTLMLGPEHWDCLRQHAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW    H+ GG+R+++ D       +    +  ++++ S++    +W
Sbjct: 64  AWYGQVFLFGWTWCFAFHLFGGLRHIMQDFGQGYAVRSFVSLGWLSVVLSLVLTAAIW 121


>gi|21242814|ref|NP_642396.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|21108300|gb|AAM36932.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|50981400|gb|AAT91478.1| succinate dehydrogenase subunit C [Xanthomonas citri]
          Length = 131

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLTVGALAIAAALLTLMLGPDHWNCFRAQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++    +W
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTAAIW 121


>gi|325928377|ref|ZP_08189572.1| succinate dehydrogenase subunit C [Xanthomonas perforans 91-118]
 gi|325541253|gb|EGD12800.1| succinate dehydrogenase subunit C [Xanthomonas perforans 91-118]
          Length = 131

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 58/118 (49%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSVGALGIAAALLTLMLGPDHWNCFRDQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++  + +W
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTIAIW 121


>gi|190571454|ref|YP_001975812.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|190357726|emb|CAQ55176.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
          Length = 123

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 61/99 (61%), Gaps = 6/99 (6%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           +NRPLSPHLQIY++  T F SI+HR+TG +++L   ++  W+F +      L  +RC ++
Sbjct: 2   SNRPLSPHLQIYKVQVTSFFSIMHRLTGILLFLLLIILS-WYFILYVYSPKLIIVRC-LN 59

Query: 66  GSVF----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
             +F    ++   L   + ++H L GIR+L+WD  L L+
Sbjct: 60  ALLFTPVAKLAYILCFVSFMYHFLNGIRHLLWDAGLNLE 98


>gi|15837672|ref|NP_298360.1| succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
 gi|9106017|gb|AAF83880.1|AE003943_11 succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
          Length = 142

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI+HR TG  + LG  V+      +  G  T    R  ++
Sbjct: 15  RERPLSPHLQVYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGAATWDYFRSCLN 74

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW+
Sbjct: 75  LWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFVRSSWASVLGSIVITAGVWV 133


>gi|326404267|ref|YP_004284349.1| succinate dehydrogenase cytochrome b subunit [Acidiphilium
           multivorum AIU301]
 gi|325051129|dbj|BAJ81467.1| succinate dehydrogenase cytochrome b subunit [Acidiphilium
           multivorum AIU301]
          Length = 147

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQ+YR   T  +SI+HRITG  +  G  ++  W    A      S  +  +  
Sbjct: 24  RRPLSPHLQVYRPQITSTLSILHRITGVALSAGAVLLSLWLAAAATSSGAFSVAQAIVGS 83

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
            +  + LF +T+A+ +H   GIR+L+WD  +  +
Sbjct: 84  ILGMIVLFGFTFALFYHFCNGIRHLLWDAGVGFE 117


>gi|254468837|ref|ZP_05082243.1| succinate dehydrogenase, cytochrome b556 subunit [beta
           proteobacterium KB13]
 gi|207087647|gb|EDZ64930.1| succinate dehydrogenase, cytochrome b556 subunit [beta
           proteobacterium KB13]
          Length = 124

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 66/119 (55%), Gaps = 2/119 (1%)

Query: 4   IKNNRPLSPHLQIYRL-IPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++N  P + +L   R  +P M VSI+HR++G V+++  P++    +     E+  + +  
Sbjct: 1   MENRNPKNLNLFTIRFPVPAM-VSILHRVSGVVLFVLMPLLTISLYWSLKNENIFNWVLL 59

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             D ++F++   L  W +IHH++ G R+L+ D+   +D  IA   +KI ++AS L   I
Sbjct: 60  LFDTTLFKLIKCLMLWGIIHHLIAGTRHLLLDLHFGVDLIIARMTSKIVLVASFLLTFI 118


>gi|163796399|ref|ZP_02190359.1| succinate dehydrogenase, cytochrome b subunit [alpha
           proteobacterium BAL199]
 gi|159178249|gb|EDP62793.1| succinate dehydrogenase, cytochrome b subunit [alpha
           proteobacterium BAL199]
          Length = 128

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 64/122 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
            + RPLSPHLQIY+   T  +SI HR TG  +  G  ++ +W    A G  + + ++ ++
Sbjct: 3   ADRRPLSPHLQIYKPQLTSVLSISHRATGVGLAAGLLLLTWWLLAAAAGPDSFAVVQDFL 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF +++A++ H+  G+R+L WD     +     +     +IAS+   ++ W 
Sbjct: 63  GSWLGYLILFGFSYALMFHLCNGVRHLFWDAGWGFELDTVYKSGWAVVIASVALTVLAWA 122

Query: 125 IK 126
           I 
Sbjct: 123 IA 124


>gi|300703704|ref|YP_003745306.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhd [Ralstonia solanacearum CFBP2957]
 gi|299071367|emb|CBJ42686.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Ralstonia solanacearum CFBP2957]
          Length = 136

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 5/125 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            +IK  RP   ++ +     YRL     VSI+HR++G++++L  P V++ F      E +
Sbjct: 3   EAIKKARPEFRNIGVGDIARYRLPWAGKVSILHRVSGALMFLLLPFVLYLFEQSLTSEIS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            +     +     +V +    WA +HH   G+RYLI D+ + +DK  + + A   +I S+
Sbjct: 63  FAKFTALLSSGFAKVVVLALIWAYLHHFCAGVRYLILDLHIGIDKTTSAKSAVSVLIVSL 122

Query: 117 LTVLI 121
           L  ++
Sbjct: 123 LLTVV 127


>gi|254448802|ref|ZP_05062259.1| succinate dehydrogenase, cytochrome b556 subunit [gamma
           proteobacterium HTCC5015]
 gi|198261643|gb|EDY85931.1| succinate dehydrogenase, cytochrome b556 subunit [gamma
           proteobacterium HTCC5015]
          Length = 119

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%), Gaps = 6/107 (5%)

Query: 10  LSPHLQIYRLIPTMFVSIVHRITG---SVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +SPHLQ+YRL    ++SI+HR TG   S+  L  PVV+     ++ GE     L+ ++  
Sbjct: 1   MSPHLQVYRLPMLAWLSILHRATGVALSIAILLLPVVL--LTAVSGGE-AYDCLQQHLSA 57

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII 113
              +V LFL T ++ +H+  GIR+L WD     + K A +   I+++
Sbjct: 58  WYGQVVLFLITLSLNYHLCNGIRHLFWDAGHGFELKSADRSGAISVV 104


>gi|148260873|ref|YP_001235000.1| succinate dehydrogenase, cytochrome b subunit [Acidiphilium cryptum
           JF-5]
 gi|146402554|gb|ABQ31081.1| succinate dehydrogenase subunit C [Acidiphilium cryptum JF-5]
          Length = 143

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQ+YR   T  +SI+HRITG  +  G  ++  W    A      S  +  +  
Sbjct: 20  RRPLSPHLQVYRPQITSTLSILHRITGVALSAGAVLLSLWLAAAATSSGAFSVAQAIVGS 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
            +  + LF +T+A+ +H   GIR+L+WD  +  +
Sbjct: 80  ILGMIVLFGFTFALFYHFCNGIRHLLWDAGVGFE 113


>gi|21231576|ref|NP_637493.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768302|ref|YP_243064.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|188991441|ref|YP_001903451.1| succinate dehydrogenase (ubiquinone) cytochrome b556 subunit
           [Xanthomonas campestris pv. campestris str. B100]
 gi|21113263|gb|AAM41417.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573634|gb|AAY49044.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167733201|emb|CAP51399.1| succinate dehydrogenase (ubiquinone) cytochrome b556 subunit
           [Xanthomonas campestris pv. campestris]
          Length = 131

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 56/118 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSIGALVIAAALLTLMLGPDHWNCFRDMAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW    H+ GG+R+++ D       +    +  +++I S +    +W
Sbjct: 64  AWYGQVFLFGWTWCFAFHLFGGLRHILQDFGQGYAVRSFVSIGWLSVILSFVLTAAIW 121


>gi|294624875|ref|ZP_06703532.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|294665038|ref|ZP_06730345.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292600834|gb|EFF44914.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292605195|gb|EFF48539.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 131

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSVGALGIAAALLTLMLGPDHWNCFRDQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++    +W
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTAAIW 121


>gi|299066396|emb|CBJ37581.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Ralstonia solanacearum CMR15]
          Length = 140

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 5/125 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            +IK  RP   ++ +     YRL     VSI+HR +G++++L  P V++ F      E +
Sbjct: 7   EAIKKARPEFRNIGVGDIARYRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEIS 66

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            +     +     +V +    WA +HH   GIRYLI D+ + +DK  +++ A   +I S+
Sbjct: 67  FAKFTALLSNGFAKVVVLALIWAYLHHFCAGIRYLILDLHIGIDKTTSSKSAVSVLIVSL 126

Query: 117 LTVLI 121
           L  ++
Sbjct: 127 LLTVV 131


>gi|71899418|ref|ZP_00681577.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|71730827|gb|EAO32899.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
          Length = 142

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQIYR    M  SI+HR TG  + LG  V+      +  G       R  ++
Sbjct: 15  RERPLSPHLQIYRWQMQMLTSILHRATGVFLSLGVLVIAAGLLALMFGAEPWDYFRSCLN 74

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW+
Sbjct: 75  LWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITAGVWV 133


>gi|17546715|ref|NP_520117.1| transmembrane succinate dehydrogenase (cytochrome B-556 subunit)
           oxidoreductase [Ralstonia solanacearum GMI1000]
 gi|17429014|emb|CAD15698.1| putative transmembrane succinate dehydrogenase (cytochrome b-556
           subunit) oxidoreductase protein [Ralstonia solanacearum
           GMI1000]
          Length = 140

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 5/125 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            +IK  RP   ++ +     YRL     VSI+HR +G++++L  P V++ F      E +
Sbjct: 7   EAIKKARPEFRNIGLGDIARYRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEIS 66

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            +     +     +V +    WA +HH   GIRYLI D+ + +DK  +++ A   +I S+
Sbjct: 67  FAKFTALLSNGFAKVVVLALIWAYLHHFCAGIRYLILDLHIGIDKTTSSKSAVSVLIVSL 126

Query: 117 LTVLI 121
           L  ++
Sbjct: 127 LLTVV 131


>gi|300691091|ref|YP_003752086.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Ralstonia solanacearum PSI07]
 gi|299078151|emb|CBJ50794.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Ralstonia solanacearum PSI07]
          Length = 136

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 5/125 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            +IK  RP   ++ +     YRL     VSI+HR +G++++L  P V++ F      E +
Sbjct: 3   EAIKKARPEFRNIGLGDIAHYRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEIS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            +     +     +V +    WA +HH   GIRYLI D+ + +DK  +++ A   +I S+
Sbjct: 63  FAKFTALLSNGFAKVVVLALIWAYLHHFCAGIRYLILDLHIGIDKTTSSKSAVSVLIVSL 122

Query: 117 LTVLI 121
           L  ++
Sbjct: 123 LLTVV 127


>gi|83592538|ref|YP_426290.1| succinate dehydrogenase subunit C [Rhodospirillum rubrum ATCC
           11170]
 gi|83575452|gb|ABC22003.1| succinate dehydrogenase subunit C [Rhodospirillum rubrum ATCC
           11170]
          Length = 132

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 3/123 (2%)

Query: 6   NNRPLSPHLQIYRLIP--TMFVSIVHRITGSVVYLG-TPVVVFWFFCIANGEHTLSSLRC 62
           + RP+SPHLQ+Y+L    T  +SI  R+ G+ + +G T   + W     +GE   +S++ 
Sbjct: 4   HPRPISPHLQVYKLHTKVTSMLSITFRVFGAALMVGGTFFFLLWIVAAGSGEQAFTSVQG 63

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +       + LF  T  + +H+  GIR+++WD     D     +     + A+I+  L+ 
Sbjct: 64  FYGSPFGYLVLFGLTVVLFYHLCNGIRHMLWDTGFGFDMPTLRKTGAAAVGAAIVLSLLA 123

Query: 123 WII 125
           W +
Sbjct: 124 WTV 126


>gi|329891125|ref|ZP_08269468.1| succinate dehydrogenase, cytochrome b556 subunit [Brevundimonas
           diminuta ATCC 11568]
 gi|328846426|gb|EGF95990.1| succinate dehydrogenase, cytochrome b556 subunit [Brevundimonas
           diminuta ATCC 11568]
          Length = 125

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 61/117 (52%), Gaps = 2/117 (1%)

Query: 10  LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVF 69
           +SP   I+R   TM  SI+ R+T     +G  +++ W   +A+G    +S+  +  GS F
Sbjct: 1   MSPFTDIWRWHMTMVASILFRVTIGAASVGAVLLLGWVAAVASGPDAFASVAAF-SGSPF 59

Query: 70  EVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
            + + F  TW +   +L G R+LI D    LD K A  MA+I +   I+  ++ W++
Sbjct: 60  GLFIWFGLTWVLFSFLLNGARHLINDAGKGLDLKSANLMAQIAVWGPIVLAVLFWVV 116


>gi|68171567|ref|ZP_00544942.1| Succinate dehydrogenase, cytochrome b subunit [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658394|ref|YP_507709.1| succinate dehydrogenase, cytochrome b556 subunit [Ehrlichia
           chaffeensis str. Arkansas]
 gi|18139860|gb|AAL60178.1|AF416764_1 succinate dehydrogenase subunit C [Ehrlichia chaffeensis]
 gi|67999008|gb|EAM85684.1| Succinate dehydrogenase, cytochrome b subunit [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599851|gb|ABD45320.1| succinate dehydrogenase, cytochrome b556 subunit [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 128

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 7/121 (5%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF---FCIANGEHTLSSLRCYM 64
           RPLSPHLQIY+++  +  SI+HR TG +++LG  V+ + F   F      + + S  C  
Sbjct: 5   RPLSPHLQIYKVVYKL--SIMHRFTGMILFLGLLVLSWGFILSFLCPQVVYRICSFFCNS 62

Query: 65  DGSVFEVCLFLYTW--AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
             S++ + L  + W   + +H + GIR++ WD+ L L K        + +   +++  I+
Sbjct: 63  YVSLYSLKLITFIWLNVLCYHYMNGIRHIFWDLGLGLSKSAVRTTGVVVVFLCLVSSFIL 122

Query: 123 W 123
           +
Sbjct: 123 Y 123


>gi|225075124|ref|ZP_03718323.1| hypothetical protein NEIFLAOT_00123 [Neisseria flavescens
           NRL30031/H210]
 gi|224953608|gb|EEG34817.1| hypothetical protein NEIFLAOT_00123 [Neisseria flavescens
           NRL30031/H210]
          Length = 125

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 61/117 (52%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP+   +   RL     VSI+HRI+G  +++  PV++++F    + E +  + R  + 
Sbjct: 4   KSRPVFLEIPNIRLPIPGIVSILHRISGVGLFVMLPVLLYFFSGTLDREASFEAYRSAIS 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
               ++ L    WA +HH L GIR+L  DV   L+   A   AK+ + AS L + +V
Sbjct: 64  NPFVKLILIGLLWAYLHHFLAGIRFLFLDVHKGLELNTARATAKV-VFASALILTVV 119


>gi|52840772|ref|YP_094571.1| succinate dehydrogenase cytochrome b556 subunit C [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52627883|gb|AAU26624.1| succinate dehydrogenase cytochrome b556 subunit C [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 130

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 67/124 (54%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RP++  L   +  P    SI+HRI+G +++L  P V+F   C    E +    +  
Sbjct: 7   VNKKRPINLDLSSLKFPPMAIASILHRISGVLIFLLFPFVLFILGCSLQSEESFVQAKTM 66

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII--ASILTVLI 121
           +    +++ L+ +  ++I+H++ GIR+LI D+      + A +M+ ++II  A IL + +
Sbjct: 67  LANPFYKLMLWAFGASMIYHVIAGIRHLIMDMGFGESLR-AGRMSAVSIIVLAVILAIFL 125

Query: 122 -VWI 124
            +WI
Sbjct: 126 GIWI 129


>gi|54293523|ref|YP_125938.1| succinate dehydrogenase, cytochrome b556 subunit [Legionella
           pneumophila str. Lens]
 gi|54296562|ref|YP_122931.1| succinate dehydrogenase, cytochrome b556 subunit [Legionella
           pneumophila str. Paris]
 gi|148360816|ref|YP_001252023.1| succinate dehydrogenase cytochrome b556 subunit C [Legionella
           pneumophila str. Corby]
 gi|296106120|ref|YP_003617820.1| succinate dehydrogenase cytochrome b-556 subunit [Legionella
           pneumophila 2300/99 Alcoy]
 gi|53750347|emb|CAH11741.1| succinate dehydrogenase, cytochrome b556 subunit [Legionella
           pneumophila str. Paris]
 gi|53753355|emb|CAH14805.1| succinate dehydrogenase, cytochrome b556 subunit [Legionella
           pneumophila str. Lens]
 gi|148282589|gb|ABQ56677.1| succinate dehydrogenase cytochrome b556 subunit C [Legionella
           pneumophila str. Corby]
 gi|295648021|gb|ADG23868.1| succinate dehydrogenase cytochrome b-556 subunit [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 124

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RP++  L   +  P    SI+HR++G +++L  P V+F   C    E + +  +  
Sbjct: 1   MNKKRPINLDLSSLKFPPMAIASILHRVSGVLIFLLFPFVLFILGCSLQSEESFAQTKII 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA 114
           +    +++ L+ +  ++I+H++ GIR+LI D+      + A +M+ ++IIA
Sbjct: 61  LANPYYKLLLWAFGASMIYHVIAGIRHLIMDMGFGESLR-AGRMSAVSIIA 110


>gi|317401832|gb|EFV82442.1| succinate dehydrogenase cytochrome B subunit [Achromobacter
           xylosoxidans C54]
          Length = 138

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRCYMDGSVFEVCLFL 75
           YRL     +SI+HRI+G +++L  P+V+   F  +     T +++  Y    + ++ L +
Sbjct: 24  YRLPLAGKLSILHRISGILLFLCLPLVILPLFAASVASPQTFAAVAAYAGNPIVKLVLLV 83

Query: 76  YTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
             W  +HH   GIRYL+ D+ L +DK  A + A +
Sbjct: 84  LIWGYLHHFCAGIRYLLLDLHLGIDKLSAKKSAGV 118


>gi|311104829|ref|YP_003977682.1| succinate dehydrogenase, cytochrome b556 subunit [Achromobacter
           xylosoxidans A8]
 gi|310759518|gb|ADP14967.1| succinate dehydrogenase, cytochrome b556 subunit [Achromobacter
           xylosoxidans A8]
          Length = 137

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 13  HLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRCYMDGSVFEV 71
            L  YRL     +SI+HR++G++++L  P+V+   F  +     T +++  Y    + ++
Sbjct: 19  QLASYRLPLAGKLSILHRVSGALLFLCLPLVILPLFAASVAAPQTFAAVAAYAGNPIVKL 78

Query: 72  CLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
              +  W  +HH   GIRYL+ D+ + +DK  A + A +
Sbjct: 79  VFLVLIWGYLHHFCAGIRYLLLDLHIGIDKLSAKKSAGV 117


>gi|33593355|ref|NP_880999.1| succinate dehydrogenase cytochrome B subunit [Bordetella pertussis
           Tohama I]
 gi|33597755|ref|NP_885398.1| succinate dehydrogenase cytochrome B subunit [Bordetella
           parapertussis 12822]
 gi|33602657|ref|NP_890217.1| succinate dehydrogenase cytochrome B subunit [Bordetella
           bronchiseptica RB50]
 gi|33572711|emb|CAE42635.1| succinate dehydrogenase cytochrome B subunit [Bordetella pertussis
           Tohama I]
 gi|33574184|emb|CAE38515.1| succinate dehydrogenase cytochrome B subunit [Bordetella
           parapertussis]
 gi|33577099|emb|CAE35655.1| succinate dehydrogenase cytochrome B subunit [Bordetella
           bronchiseptica RB50]
 gi|332382764|gb|AEE67611.1| succinate dehydrogenase cytochrome B subunit [Bordetella pertussis
           CS]
          Length = 137

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 12  PHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRCYMDGSVFE 70
           P +  YRL     +SI+HRI+G++++L  P+V+   F  +     + + +  Y    + +
Sbjct: 18  PQILSYRLPLAGKLSILHRISGALLFLCLPLVIVPLFAASVTSPESYAQVAQYAANPLVK 77

Query: 71  VCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           + L    W  +HH   GIRYL+ D+ + LDK  A + A +    S+   L+
Sbjct: 78  LVLLALIWGYLHHFCAGIRYLVLDLHIGLDKVSAQKSAGVAFGVSLALTLV 128


>gi|149926165|ref|ZP_01914427.1| succinate dehydrogenase cytochrome B subunit [Limnobacter sp.
           MED105]
 gi|149824983|gb|EDM84195.1| succinate dehydrogenase cytochrome B subunit [Limnobacter sp.
           MED105]
          Length = 137

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEH 55
           +++   RP+  ++ +     YRL     +SI+HR++G+V++L  PV++   F  +   E 
Sbjct: 3   NTVAKKRPVYRNIHVTQILKYRLPLAGKLSILHRVSGAVLFLALPVILLPLFDKSITSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
           T   ++  +   + ++ L    W+ +HH   GIRYL+ D+ +  +K  A++ A I
Sbjct: 63  TFLEMQSLVSSPLVKIVLLGLIWSYLHHFAAGIRYLVLDMHVGTEKYAASKSAGI 117


>gi|187926533|ref|YP_001892878.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12J]
 gi|241666044|ref|YP_002984403.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12D]
 gi|187728287|gb|ACD29451.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12J]
 gi|240868071|gb|ACS65731.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia
           pickettii 12D]
          Length = 158

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 56/105 (53%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     VSI+HR +G++++L  P V++ F      E + +     +     +V +   
Sbjct: 45  YRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEISFAKFSALLSNGFAKVVVLAL 104

Query: 77  TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
            WA +HH   G+RYLI D+ + +DK  A++ A   +I S+L  ++
Sbjct: 105 IWAYLHHFCAGVRYLILDLHIGIDKASASKSAVSVLIVSLLLTVV 149


>gi|182680904|ref|YP_001829064.1| succinate dehydrogenase, cytochrome b556 subunit [Xylella
           fastidiosa M23]
 gi|182631014|gb|ACB91790.1| succinate dehydrogenase, cytochrome b556 subunit [Xylella
           fastidiosa M23]
          Length = 131

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI+HR TG  + LG  V+      +  G       R  ++
Sbjct: 4   RERPLSPHLQVYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGPEPWDYFRSCLN 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW
Sbjct: 64  LWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITAGVW 121


>gi|309778645|ref|ZP_07673422.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia sp.
           5_7_47FAA]
 gi|308922560|gb|EFP68180.1| succinate dehydrogenase, cytochrome b556 subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 136

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     VSI+HR +G++++L  P V++ F      E + +     +     +V +   
Sbjct: 23  YRLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEISFAKFTALLSNGFAKVVVLAL 82

Query: 77  TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
            WA +HH   GIRYLI D+ + +DK  A++ A   +I S+L  ++
Sbjct: 83  IWAYLHHFCAGIRYLILDLHIGIDKTSASKSAVSVLIVSLLLTVV 127


>gi|257093959|ref|YP_003167600.1| succinate dehydrogenase, cytochrome b556 subunit [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046483|gb|ACV35671.1| succinate dehydrogenase, cytochrome b556 subunit [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 130

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 62/120 (51%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +IK  RP +  L   RL     +SI+HR++G+ ++L  PV+++ F        T ++++ 
Sbjct: 5   AIKKRRPKNLDLPTIRLPLPGILSILHRVSGAGLFLMLPVLLWLFQGSLASSETFAAVKG 64

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +   V ++ L    W  +HH   GIRYL+ D+   ++ + A   +KI    SI   LI+
Sbjct: 65  VVGHPVAKIVLLGLIWFYMHHFCAGIRYLLLDLHKGIELEAARLSSKIVFAVSIALTLII 124


>gi|91793541|ref|YP_563192.1| succinate dehydrogenase, cytochrome b subunit [Shewanella
           denitrificans OS217]
 gi|91715543|gb|ABE55469.1| succinate dehydrogenase subunit C [Shewanella denitrificans OS217]
          Length = 131

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 54/108 (50%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T  VSI+HRI+G ++     ++++            +S++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIVSILHRISGVIMLFAIGILLWLLNSTLTSAEGFASVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
              DG V +  L+    A+ +H+LGGIR+LI D     + K  T  AK
Sbjct: 66  SLFDGFVMKFILWGILTALGYHLLGGIRHLIMDAGCWEEFKSGTASAK 113


>gi|42521018|ref|NP_966933.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42410759|gb|AAS14867.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 125

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 61/99 (61%), Gaps = 6/99 (6%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           ++RPLSPHLQIY++  T F SI+HR+TG ++     +++ W+F +      L  +R Y++
Sbjct: 2   SDRPLSPHLQIYKVQVTSFFSIMHRLTG-ILLFLLLMILSWYFILHVYFPELLIVR-YLN 59

Query: 66  GSVF----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
             +F    ++   L   + ++H L GIR+L+WDV L L+
Sbjct: 60  ALLFTPVAKLAYVLCFISFVYHFLNGIRHLLWDVGLNLE 98


>gi|91205983|ref|YP_538338.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           RML369-C]
 gi|157826653|ref|YP_001495717.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           OSU 85-389]
 gi|122425294|sp|Q1RHB5|DHSC_RICBR RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|91069527|gb|ABE05249.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           RML369-C]
 gi|157801957|gb|ABV78680.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           OSU 85-389]
          Length = 125

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 3/123 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++ +WF  ++  +     L 
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFAVSILAWWF-ILSKFDSNYIKLA 64

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                    + L  + W   +H+  GIR+L WD+ L    K         +I S+L  ++
Sbjct: 65  NCCCIIKICLILTSFAW--FYHLCNGIRHLFWDIGLGFSIKAVNLTGWSVVICSVLFTIL 122

Query: 122 VWI 124
           +W+
Sbjct: 123 LWV 125


>gi|28198267|ref|NP_778581.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           Temecula1]
 gi|28056337|gb|AAO28230.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           Temecula1]
          Length = 142

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI+HR TG  + LG  V+      +  G       R  ++
Sbjct: 15  RERPLSPHLQVYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGPEPWDYFRSCLN 74

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW
Sbjct: 75  LWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITAGVW 132


>gi|56752597|gb|AAW24512.1| SJCHGC05423 protein [Schistosoma japonicum]
 gi|226489330|emb|CAX75809.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Schistosoma japonicum]
 gi|226489332|emb|CAX75810.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Schistosoma japonicum]
 gi|226489334|emb|CAX75811.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Schistosoma japonicum]
 gi|226489336|emb|CAX75812.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Schistosoma japonicum]
 gi|226489338|emb|CAX75813.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Schistosoma japonicum]
 gi|226489340|emb|CAX75814.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Schistosoma japonicum]
          Length = 192

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 65/126 (51%), Gaps = 2/126 (1%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           +I   RP SPHLQIY     M  S +HR TG ++  + + V +  FF   + +  L  ++
Sbjct: 66  NITGGRPWSPHLQIYSAPLVMRFSFLHRATGIAMAIVWSSVGIGAFFFTGHYDSVLDYVK 125

Query: 62  -CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             ++  +V   C F+  + +++H L G+R+L WD ++    K   +   I + +S++   
Sbjct: 126 NMHLGDTVITACKFVLCYPLVYHYLNGMRHLAWDYAIGFPIKTCNKTGFIALGSSLVVAA 185

Query: 121 IVWIIK 126
           I+  I+
Sbjct: 186 ILACIR 191


>gi|311253955|ref|XP_003125707.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like [Sus scrofa]
          Length = 169

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 9/122 (7%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           ++ +NRPLSPH+ IYR  P++  SI HR TG  V  G  V +F    +    N E  L  
Sbjct: 45  NLGSNRPLSPHITIYRSTPSLGTSICHRGTGVAVSCG--VSLFGLSALLLPGNFESHLEL 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
           ++    G ++     F   + +++H   GIR+LIWD+   L      Q+ +  ++  ILT
Sbjct: 103 VKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLT---IPQLTQSGVVVLILT 159

Query: 119 VL 120
           VL
Sbjct: 160 VL 161


>gi|241760378|ref|ZP_04758473.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           flavescens SK114]
 gi|241319256|gb|EER55734.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           flavescens SK114]
          Length = 125

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 60/117 (51%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP+   +   RL     VSI+HRI+G  +++  PV++++F    + E +  + R  + 
Sbjct: 4   KSRPVFLEIPNIRLPIPGIVSILHRISGVGLFVMLPVLLYFFSGTLDREASFEAYRSAIS 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
               ++ L    WA +HH   GIR+L  DV   L+   A   AK+ + AS L + +V
Sbjct: 64  NPFVKLILIGLLWAYLHHFFAGIRFLFLDVHKGLELNTARATAKV-VFASALILTVV 119


>gi|261379697|ref|ZP_05984270.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           subflava NJ9703]
 gi|284797361|gb|EFC52708.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           subflava NJ9703]
          Length = 125

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 60/117 (51%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP+   +   RL     VSI+HRI+G  +++  PV++++F    + E +  + R  + 
Sbjct: 4   KSRPVFLEIPNIRLPIPGIVSILHRISGVGLFVMLPVLLYFFSGTLDREASFEAYRSAIS 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
               ++ L    WA +HH   GIR+L  DV   L+   A   AK+ + AS L + +V
Sbjct: 64  NPFVKLILIGLLWAYLHHFFAGIRFLFLDVHKGLELNTARTTAKV-VFASALILTVV 119


>gi|300312278|ref|YP_003776370.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD protein [Herbaspirillum seropedicae SmR1]
 gi|300075063|gb|ADJ64462.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD protein [Herbaspirillum seropedicae SmR1]
          Length = 136

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 5/126 (3%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            + K  RP   ++ +     YR+     VSI+HRI+G  ++L  P +++        E T
Sbjct: 3   EAAKPQRPQFRNIHLTQIAGYRMPLAAIVSIMHRISGLFLFLMLPFILYLLDSSLLSEGT 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
              L+ +  G   ++ +   +WA +HH   GIR+LI D  + LDK  A + +   ++ SI
Sbjct: 63  FDYLKGFTSGWFVKLVILALSWAYLHHFCAGIRHLIMDNHIGLDKDSARKSSATVLVISI 122

Query: 117 LTVLIV 122
             +++V
Sbjct: 123 ALMVLV 128


>gi|113868593|ref|YP_727082.1| succinate dehydrogenase (cytochrome b subunit) [Ralstonia eutropha
           H16]
 gi|113527369|emb|CAJ93714.1| succinate dehydrogenase (cytochrome b subunit) [Ralstonia eutropha
           H16]
          Length = 136

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            ++K  RP   ++ I     YRL     VSI+HR++G++++L  P V++ F      E +
Sbjct: 3   EAVKQARPEYRNIGIAQIARYRLPWAGKVSILHRVSGALMFLLLPFVLYLFEQSITSELS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
            +     + G   ++ L +  W  +HH   GIR+L+ DV + + K  + + A
Sbjct: 63  FAKFSALLSGGFVKLVLLVLIWGYLHHFCAGIRFLLLDVHVGVSKPASAKSA 114


>gi|30249045|ref|NP_841115.1| succinate dehydrogenase, cytochrome b subunit [Nitrosomonas
           europaea ATCC 19718]
 gi|30138662|emb|CAD84957.1| Succinate dehydrogenase, cytochrome b subunit [Nitrosomonas
           europaea ATCC 19718]
          Length = 130

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 68/114 (59%), Gaps = 4/114 (3%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVC 72
           L+I + +P + VSI+HRI+G +++L G P+ ++    +     T +SL+  +   + ++ 
Sbjct: 17  LKIRQPLPAI-VSILHRISGVLLFLPGIPLFLYGLQMLLQSPETFASLQSNLAHPLCKLF 75

Query: 73  LFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII-ASILTVLI-VWI 124
           L L TW  IHH+L GIR+L+ D+   +  + A   +K+ ++  +ILT L  +W+
Sbjct: 76  LLLATWFFIHHLLAGIRHLMLDLHYGMQLEQARLSSKLVLVFGAILTALTGIWL 129


>gi|33320238|gb|AAQ05856.1| SdhC protein [Cupriavidus necator]
          Length = 140

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            ++K  RP   ++ I     YRL     VSI+HR++G++++L  P V++ F      E +
Sbjct: 7   EAVKQARPEYRNIGIAQIARYRLPWAGKVSILHRVSGALMFLLLPFVLYLFEQSITSELS 66

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
            +     + G   ++ L +  W  +HH   GIR+L+ DV + + K  + + A
Sbjct: 67  FAKFSALLSGGFVKLVLLVLIWGYLHHFCAGIRFLLLDVHVGVSKPASAKSA 118


>gi|56416566|ref|YP_153640.1| succinate dehydrogenase cytochrome b556 subunit [Anaplasma
           marginale str. St. Maries]
 gi|222474934|ref|YP_002563349.1| succinate dehydrogenase cytochrome b556 subunit (sdhC) [Anaplasma
           marginale str. Florida]
 gi|56387798|gb|AAV86385.1| succinate dehydrogenase cytochrome b556 subunit [Anaplasma
           marginale str. St. Maries]
 gi|222419070|gb|ACM49093.1| succinate dehydrogenase cytochrome b556 subunit (sdhC) [Anaplasma
           marginale str. Florida]
          Length = 127

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 63/136 (46%), Gaps = 25/136 (18%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +  +RPLSPHLQ+Y+L     +SI HR +G  ++ G  V+  W F +         LRC 
Sbjct: 2   VLRSRPLSPHLQVYKLPVAALLSITHRASGLFLFFGLSVLS-WLFVL---------LRCA 51

Query: 64  MDG---------SVFEVCLFLYTW--AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI 112
            D            F V L  ++   A  +H   G+R+L+WD  + LDK   T  +   +
Sbjct: 52  PDCIAPFLANPLGFFLVKLLSFSCCVAFCYHYFNGVRHLLWDCGVGLDKTAVTASSAFVL 111

Query: 113 IA----SILTVLIVWI 124
           +     S++    VW+
Sbjct: 112 LLTAAFSVVAFFFVWL 127


>gi|78047797|ref|YP_363972.1| putative succinate dehydrogenase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036227|emb|CAJ23918.1| putative succinate dehydrogenase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 131

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+Y     M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYLWQIQMVTSILNRATGIVLSVGALGIAAALLTLMLGPDHWNCFRDQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++  + +W
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTIAIW 121


>gi|189184864|ref|YP_001938649.1| succinate dehydrogenase cytochrome b-556 subunit [Orientia
           tsutsugamushi str. Ikeda]
 gi|189181635|dbj|BAG41415.1| succinate dehydrogenase cytochrome b-556 subunit [Orientia
           tsutsugamushi str. Ikeda]
          Length = 127

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
            + RP+SPH+ IYR+  +M +SI+HR++G  V+ G  ++ +W       +     +  + 
Sbjct: 7   SHTRPMSPHITIYRMQMSMILSILHRLSGMAVFGGASIITWWLILCVYSDFDRVVVDIFY 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +   F+  ++L  +    H+  GIR+LIWD       K
Sbjct: 67  N-LWFQALIYLTIFTTCFHLCTGIRHLIWDTGYGFSIK 103


>gi|319637649|ref|ZP_07992415.1| succinate dehydrogenase cytochrome B subunit [Neisseria mucosa
           C102]
 gi|317400804|gb|EFV81459.1| succinate dehydrogenase cytochrome B subunit [Neisseria mucosa
           C102]
          Length = 125

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP+   +   RL     VSI+HRI+G  ++L  PV+++ F    + E +  + R  + 
Sbjct: 4   KSRPVFLEIPNIRLPIPGIVSILHRISGVGLFLMLPVLLYLFSGTLDRESSFEAYRSVIS 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
               ++ L    WA +HH+  GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 64  NPFVKLILIGLLWAYLHHLFAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 119


>gi|307295105|ref|ZP_07574947.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306879579|gb|EFN10797.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 131

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGS-VVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
            +RPLSPHL I++  P M VSI+HR+TG+ +   G   +V+W    A+G    ++     
Sbjct: 5   TSRPLSPHLTIWKWGPAMAVSIMHRVTGNGLATAGALGLVWWLMAAASGPEAYATFVTCA 64

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
              +  + +   +W    H+  G+R+ + D+    + K
Sbjct: 65  TSPIGYLVMAGLSWFFFQHLCSGLRHFVLDMGAGYELK 102


>gi|103488506|ref|YP_618067.1| succinate dehydrogenase, cytochrome b subunit [Sphingopyxis
           alaskensis RB2256]
 gi|98978583|gb|ABF54734.1| succinate dehydrogenase subunit C [Sphingopyxis alaskensis RB2256]
          Length = 147

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 13/108 (12%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRCYM-- 64
           RP SPHLQ+Y+  P M VSI HR++G  +  +G  + ++W   +A G    ++    +  
Sbjct: 9   RPRSPHLQVYKWTPAMAVSIFHRVSGDGLAIVGAGMFLWWLGALAAGPDAYAAFVACVWH 68

Query: 65  --DGSVF--------EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
             D   F        ++ L   TWA   H+  G+R+ + D     + +
Sbjct: 69  DPDAGTFHQVTNILGKIVLIGLTWAFFQHLFSGLRHFVLDAGAGYELR 116


>gi|329847590|ref|ZP_08262618.1| succinate dehydrogenase, cytochrome b556 subunit [Asticcacaulis
           biprosthecum C19]
 gi|328842653|gb|EGF92222.1| succinate dehydrogenase, cytochrome b556 subunit [Asticcacaulis
           biprosthecum C19]
          Length = 112

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 47/103 (45%)

Query: 23  MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIH 82
           MF SI+HRITGS    G  ++  W  C+A G  T +    Y    +  +  F  + A   
Sbjct: 1   MFSSIMHRITGSAAVGGVVLIAAWLVCLALGRETYTVFLQYASTPLGLLVWFGLSLAGFV 60

Query: 83  HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
           H+ GG+R+LIWD     + K A  +        I+  L  W +
Sbjct: 61  HLGGGLRHLIWDTGASFELKKANALTAWTFALGIILTLAFWAV 103


>gi|58698191|ref|ZP_00373112.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630885|ref|YP_002727676.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia sp.
           wRi]
 gi|58535272|gb|EAL59350.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592866|gb|ACN95885.1| succinate dehydrogenase, cytochrome b556 subunit [Wolbachia sp.
           wRi]
          Length = 125

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (60%), Gaps = 6/99 (6%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           ++RPLSPHLQIY++  T F SI+HR+TG ++     +++ W+F +      L  +R Y++
Sbjct: 2   SDRPLSPHLQIYKVQVTSFFSIMHRLTG-ILLFLLLMILSWYFILHVYFPELLIVR-YLN 59

Query: 66  GSVF----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
             +F    ++   L   + ++H L GIR+L+WD  L L+
Sbjct: 60  ALLFTPVAKLAYVLCFISFVYHFLNGIRHLLWDAGLNLE 98


>gi|262186706|ref|YP_003275965.1| succinate dehydrogenase subunit 3 [Pleurozia purpurea]
 gi|237780703|gb|ACR19349.1| succinate dehydrogenase subunit 3 [Pleurozia purpurea]
          Length = 137

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 17/108 (15%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K NRPLSPHL IY+   T   SI HRI+G+  +L T +V+F  F    G+ +L+    Y
Sbjct: 1   MKINRPLSPHLTIYKPQLTSTFSIFHRISGA--FLAT-MVLFSIFSFKIGDLSLTFYHFY 57

Query: 64  MDGSVFEVCLFLYTWAVI-----------HHMLGGIRYLIWDVSLCLD 100
                F +  F   W +I           +HM  G+R+L+WD  L L+
Sbjct: 58  ---QYFFLLTFYLNWVIISLVNFTLLALCYHMSNGVRHLLWDSGLFLE 102


>gi|224824513|ref|ZP_03697620.1| succinate dehydrogenase, cytochrome b556 subunit [Lutiella
           nitroferrum 2002]
 gi|224603006|gb|EEG09182.1| succinate dehydrogenase, cytochrome b556 subunit [Lutiella
           nitroferrum 2002]
          Length = 124

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++  RP    L   RL     VSI+HRI+G  ++   P++++      +      + R  
Sbjct: 1   MQKQRPKHLDLAKIRLPIPGIVSILHRISGVALFFSLPLLIYLLHGTLSSAEAFDAYRAV 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + ++ L    WA +HH   GIR+L  DV   L+ + A   AK  I+ S+   +I+ 
Sbjct: 61  VSHPLMKLVLIGLLWAFMHHFCAGIRFLFLDVHKGLELQTARATAKSVIVISLALTVILG 120

Query: 124 II 125
           ++
Sbjct: 121 VV 122


>gi|296532571|ref|ZP_06895277.1| succinate dehydrogenase cytochrome b558 subunit [Roseomonas
           cervicalis ATCC 49957]
 gi|296267096|gb|EFH13015.1| succinate dehydrogenase cytochrome b558 subunit [Roseomonas
           cervicalis ATCC 49957]
          Length = 148

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIP-TMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
              + NRPLSPHLQ+Y ++  T  +SI HR TG    +G  V+ +W    A G    +++
Sbjct: 18  DGTRVNRPLSPHLQVYDMLQITSGLSIAHRATGVAWSVGLLVLAWWLLAAAAGPGPFATV 77

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           + ++   +  + LF  T    +H L G+R+L+WD     D     +  +  +I + +  +
Sbjct: 78  QWFLSSFLGMLMLFGMTAVAWYHTLAGLRHLMWDAGYGFDLPTTYRTGRAVLIGTGVLTV 137

Query: 121 IVWII 125
           + W+I
Sbjct: 138 LTWLI 142


>gi|171059387|ref|YP_001791736.1| succinate dehydrogenase, cytochrome b556 subunit [Leptothrix
           cholodnii SP-6]
 gi|170776832|gb|ACB34971.1| succinate dehydrogenase, cytochrome b556 subunit [Leptothrix
           cholodnii SP-6]
          Length = 142

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 70/133 (52%), Gaps = 14/133 (10%)

Query: 1   MSSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF------C 49
           M+     RP+  ++ I     YRL P   VSI+HR++G++++L  P+++ WFF       
Sbjct: 1   MADSTPQRPVFRNIHITDIASYRLPPAGIVSILHRVSGAMMFLLLPLII-WFFDTSVTSE 59

Query: 50  IANGEHT--LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
           ++  E T   SS   ++ G + ++      WA +HH + G+R+L  D +  + K+     
Sbjct: 60  VSYEEFTAAFSSGIGFVPGVLVKLVALGLIWAYLHHFIAGVRHLWMDATHSVTKQHGHSS 119

Query: 108 AKINIIASILTVL 120
           A + +++S+L  L
Sbjct: 120 ALVTLVSSVLLTL 132


>gi|241765615|ref|ZP_04763570.1| succinate dehydrogenase, cytochrome b556 subunit [Acidovorax
           delafieldii 2AN]
 gi|241364553|gb|EER59619.1| succinate dehydrogenase, cytochrome b556 subunit [Acidovorax
           delafieldii 2AN]
          Length = 144

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 14/136 (10%)

Query: 1   MSSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           M+ +   RP          L  YR+ P  +VSI+HR +G+V++L  P V++ F    + E
Sbjct: 1   MTELAKKRPEFRNINAFKDLTTYRMTPAAWVSILHRASGAVMFLLLPFVLWMFDTSVSSE 60

Query: 55  HTLSSLRC-------YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQ 106
            +  + +        ++ G   ++      W  +HHM+ G+R+L  DVS   ++K+    
Sbjct: 61  ISFGTFKAAFNAGLGFLPGWFIKLVALALIWGYLHHMIAGMRHLWMDVSHEAVNKQFGKT 120

Query: 107 MAKINIIASILTVLIV 122
            A + +  SI   L++
Sbjct: 121 SAVVTLTISIALTLVL 136


>gi|34496520|ref|NP_900735.1| succinate dehydrogenase cytochrome b-556 subunit [Chromobacterium
           violaceum ATCC 12472]
 gi|34102374|gb|AAQ58740.1| succinate dehydrogenase cytochrome b-556 subunit [Chromobacterium
           violaceum ATCC 12472]
          Length = 125

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 55/113 (48%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++  RP    L   RL    FVSI+HR++G  ++   P++++      +   +  + +  
Sbjct: 1   MQKQRPKHLDLARIRLPVPGFVSILHRVSGVALFFSLPLLIYLLHGSLSSAESFDTYKAV 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
           +   + ++ L    WA +HH   GIR+L  D+   L+ + A   AK  ++ S+
Sbjct: 61  VSHPLMKLALLGLIWAYLHHFCAGIRFLFLDIHKGLELETARGTAKTVLVVSL 113


>gi|253996130|ref|YP_003048194.1| succinate dehydrogenase, cytochrome b556 subunit [Methylotenera
          mobilis JLW8]
 gi|253982809|gb|ACT47667.1| succinate dehydrogenase, cytochrome b556 subunit [Methylotenera
          mobilis JLW8]
          Length = 129

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%)

Query: 7  NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
          NRP + +L   RL     VSI+HR++G V++L TP +++      N E +LS+L      
Sbjct: 9  NRPKNLNLFTIRLPINAVVSILHRMSGMVLFLFTPALIWSLQASLNSEASLSALGDMFQH 68

Query: 67 SVFEVCLFLYTWAVIHHMLGGIRYLIWDV 95
            F++ L   +W   HH   G+R+L  DV
Sbjct: 69 WAFKLMLIALSWPFFHHFYAGLRHLGQDV 97


>gi|320168382|gb|EFW45281.1| succinate dehydrogenase cytochrome b subunit [Capsaspora owczarzaki
           ATCC 30864]
          Length = 159

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG-TPVVVFWFFCIANGEHTLSSLRCYMD 65
            RPLSPHL IYR   T  +SI HR TG+ +    +   V+    + +  + +  +R    
Sbjct: 39  GRPLSPHLTIYRPQLTSVLSITHRATGAAMTFAISTAAVYSALSVHDFAYNIDLVRSLDL 98

Query: 66  GSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCL 99
            SV  +   ++  W +++H L GIR+L+WD    L
Sbjct: 99  PSVVTLTAKYILAWPLVYHSLNGIRHLVWDSGRAL 133


>gi|298369270|ref|ZP_06980588.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria sp.
           oral taxon 014 str. F0314]
 gi|298283273|gb|EFI24760.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria sp.
           oral taxon 014 str. F0314]
          Length = 125

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP+   +   RL     VSI+HRI+G ++++  PV+++      + E    + R  + 
Sbjct: 4   KSRPVFLEIPNIRLPIPGIVSILHRISGVILFVMLPVLLYLLSGTLSRESAFETYRVIVS 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLI 121
             + ++ L    WA +HH+L G+R+L  D    L+   A   AK+   A+ +LTV++
Sbjct: 64  NPLAKLILIGVLWAYLHHLLAGVRFLFLDAHKGLELNTARNTAKLVFAAALVLTVVL 120


>gi|6649873|gb|AAF21608.1|AF018287_2 SdhC [papaya bunchy top disease rickettsia]
          Length = 125

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 3/123 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++  W+F  +  +     L 
Sbjct: 6   QEIYNKRPTSPHLTIYKPRISSTLSILHRMTGVALFFAVSILA-WWFIFSKFDSNYIQLA 64

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                    + L  + W   +H+  GIR+L WD+      K         +I S+L  ++
Sbjct: 65  NCCCIIKICLILTSFAW--FYHLCNGIRHLFWDIGYGFPIKAVNLTGWSVVICSVLFTIL 122

Query: 122 VWI 124
           +WI
Sbjct: 123 LWI 125


>gi|256071967|ref|XP_002572309.1| succinate dehydrogenase [Schistosoma mansoni]
 gi|238657465|emb|CAZ28540.1| succinate dehydrogenase, putative [Schistosoma mansoni]
          Length = 192

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 2/123 (1%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLR-CY 63
             RP SPHLQ+Y     M  S +HR TG ++  + + V +  FF   + +  L  +R  +
Sbjct: 69  EKRPWSPHLQVYSSPLVMRFSFLHRATGIAMAIVWSSVGIGAFFFTGHYDSILDYVRNMH 128

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +  SV   C F+  + +++H L G+R+L WD ++    K       I + +S++   I+ 
Sbjct: 129 LGTSVIAACKFILCYPLVYHYLNGMRHLAWDYAIGFPIKTCNTTGFIALGSSLVISAILA 188

Query: 124 IIK 126
            I+
Sbjct: 189 CIR 191


>gi|2623844|gb|AAB86570.1| unknown [Schistosoma mansoni]
          Length = 198

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 2/123 (1%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLR-CY 63
             RP SPHLQ+Y     M  S +HR TG ++  + + V +  FF   + +  L  +R  +
Sbjct: 75  EKRPWSPHLQVYSSPLVMRFSFLHRATGIAMAIVWSSVGIGAFFFTGHYDSILDYVRNMH 134

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +  SV   C F+  + +++H L G+R+L WD ++    K       I + +S++   I+ 
Sbjct: 135 LGTSVIAACKFILCYPLVYHYLNGMRHLAWDYAIGFPIKTCNTTGFIALGSSLVISAILA 194

Query: 124 IIK 126
            I+
Sbjct: 195 CIR 197


>gi|91208853|ref|YP_539014.1| succinate dehydrogenase subunit 3 [Physcomitrella patens]
 gi|90991393|dbj|BAE93085.1| succinate dehydrogenase subunit 3 [Physcomitrella patens]
          Length = 131

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 61/128 (47%), Gaps = 18/128 (14%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K NRPLSPHL IY+   T   SI HRI+G+ +     +V F    +  G+  L+S   Y
Sbjct: 1   MKINRPLSPHLTIYKPQLTSTFSIFHRISGAFL---ASMVFFSILFLKIGDLNLTSYYLY 57

Query: 64  MDGSVFEVCLFLYTW-----------AVIHHMLGGIRYLIWDVSLCLD-KKIATQMAKIN 111
                F    F + W           A+ +HM  GIR+L+WD+   L+  K+ T    + 
Sbjct: 58  RYAFSFT---FYFHWLISSVVNFSLLALCYHMSNGIRHLLWDLGFFLELSKVYTSGIIML 114

Query: 112 IIASILTV 119
             A+ L V
Sbjct: 115 FCAAFLAV 122


>gi|194290224|ref|YP_002006131.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhd [Cupriavidus taiwanensis LMG 19424]
 gi|193224059|emb|CAQ70068.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Cupriavidus taiwanensis LMG 19424]
          Length = 136

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            ++K  RP   ++ I     YRL     VSI+HR++G++++L  P V++ F      E +
Sbjct: 3   EAVKQARPEFRNIGISQIAKYRLPWAGKVSILHRVSGALMFLLLPFVLYLFEQSITSELS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
            +     + G   ++ +    W  +HH   GIR+L+ DV + + K  + + A
Sbjct: 63  FAKFSALLSGGFVKLVVLALIWGYLHHFCAGIRFLLLDVHVGVSKPASAKSA 114


>gi|46201871|ref|ZP_00054198.2| COG2009: Succinate dehydrogenase/fumarate reductase, cytochrome b
           subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 109

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%)

Query: 22  TMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVI 81
           T  +SI HRITG  + +GT V+ +W    A G       +  +   + ++ LF +T A+ 
Sbjct: 4   TAILSISHRITGVALAVGTIVLAYWLASAAYGPVAYGHAQAVLGSVLGKLVLFGWTAALF 63

Query: 82  HHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           +H+  GIR+L WD     +   A +  ++ + A+ L  ++ W+
Sbjct: 64  YHLCNGIRHLFWDKGRGYEIAEADKSGRMVVGAAALLTVLAWV 106


>gi|167648795|ref|YP_001686458.1| succinate dehydrogenase, cytochrome b556 subunit [Caulobacter sp.
           K31]
 gi|167351225|gb|ABZ73960.1| succinate dehydrogenase, cytochrome b556 subunit [Caulobacter sp.
           K31]
          Length = 135

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 61/120 (50%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQ++R   TM  SI+HR     +Y+G  ++  W   +A+G    ++    +  
Sbjct: 10  ERPLSPHLQVWRWHITMACSILHRGCIFALYVGVLLLAGWGLALASGPDAYAAFTGCLGS 69

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            + ++ LF  T AV+ ++   +R   WD+      KIA       I  +++  ++VW+I 
Sbjct: 70  PLGKLVLFGLTVAVLFNIAYTVRQSFWDMGKGFTPKIADMTGACAIAFAVVGAIVVWVIA 129


>gi|66045245|ref|YP_235086.1| succinate dehydrogenase, cytochrome b subunit [Pseudomonas syringae
           pv. syringae B728a]
 gi|63255952|gb|AAY37048.1| Succinate dehydrogenase, cytochrome b subunit [Pseudomonas syringae
           pv. syringae B728a]
          Length = 124

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HRI+G ++++G  ++++        E     ++ Y
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVGIAIMLYAMDKSLASEEGFGEVKAY 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           M   + ++ ++    A+++H++ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  MTSPLAKLIIWGLLSALLYHLVAGIRHLIMDSGVGETLEGGKLGSKIVIAVSVILILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|254480479|ref|ZP_05093726.1| succinate dehydrogenase, cytochrome b556 subunit [marine gamma
           proteobacterium HTCC2148]
 gi|214039062|gb|EEB79722.1| succinate dehydrogenase, cytochrome b556 subunit [marine gamma
           proteobacterium HTCC2148]
          Length = 129

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 68/126 (53%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S +K+NRP++  +   RL  T + SI HR TG ++++G  ++++       G    + ++
Sbjct: 4   SKVKDNRPVNLDIGTMRLPITAWASITHRATGVILFVGMGILLWLLDTSLAGPDGFAFVQ 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI----NIIASIL 117
             + G V +  ++    A+I+H L G+++LI D  +    +     A+I    +++ S+L
Sbjct: 64  ESLGGFVAKFVIWGLVTALIYHSLAGVKHLIMDFGVGETMEGGILGARIVIALSVVLSLL 123

Query: 118 TVLIVW 123
           TV+ +W
Sbjct: 124 TVIWIW 129


>gi|261364266|ref|ZP_05977149.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria mucosa
           ATCC 25996]
 gi|288567509|gb|EFC89069.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria mucosa
           ATCC 25996]
          Length = 125

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   +   RL     VSI+HRI+G  +++  PV+++      + E    + R  +   
Sbjct: 6   RPVFLEIPNIRLPIPGIVSILHRISGVALFVMLPVLLYLLSGTLSRESAFETYRAIVSNP 65

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLI 121
           + ++ L    WA +HH+  GIR+L+ D    L+   A   AK+   A+ +LTV++
Sbjct: 66  LVKLILIGVLWAYLHHLFAGIRFLLLDAHKGLELNTARNTAKLVFAAALVLTVVL 120


>gi|152985839|ref|YP_001349047.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa PA7]
 gi|150960997|gb|ABR83022.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa PA7]
          Length = 128

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 69/125 (55%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++ + RP++  L+  +L  T + SI+HRI+G +++LG  V++F        E     ++
Sbjct: 3   KAVNSKRPVNLDLRTIKLPVTAYTSILHRISGVILFLGIAVLLFALDKSLRSEEGFEQVK 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI-IASILTVL 120
             +   + ++ ++    A+++H++ GIR+L+ D  +    +   + +KI I IA +L VL
Sbjct: 63  ACLTSPLAKLVIWGLLSALLYHLVAGIRHLVMDAGVGETLEGGKRGSKIVIAIAVVLIVL 122

Query: 121 I-VWI 124
             VW+
Sbjct: 123 AGVWV 127


>gi|150406491|ref|YP_001315099.1| succinate:cytochrome c oxidoreductase subunit 3 [Chlorokybus
           atmophyticus]
 gi|126507728|gb|ABO15125.1| succinate:cytochrome c oxidoreductase subunit 3 [Chlorokybus
           atmophyticus]
          Length = 133

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 19/106 (17%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +RPLSPHL IY+   T  +SI HRITG+  ++ T V++  F       H L+S   Y   
Sbjct: 6   HRPLSPHLTIYKPQLTSMLSIFHRITGA--FMATSVLLTIFLLKICNFH-LTSYNFY--- 59

Query: 67  SVFEVCLF-LYTWAVI-----------HHMLGGIRYLIWDVSLCLD 100
            +F   LF  Y W ++           +HM  G+R+L WD+ L LD
Sbjct: 60  -IFAFILFSYYKWLILTVLFLLIISLHYHMSNGLRHLTWDLGLSLD 104


>gi|94311422|ref|YP_584632.1| succinate dehydrogenase subunit C [Cupriavidus metallidurans CH34]
 gi|93355274|gb|ABF09363.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Cupriavidus metallidurans CH34]
          Length = 136

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            ++K  RP   ++ I     YRL     VSI+HR++G++++L  P V++ F      E +
Sbjct: 3   EAVKQARPEFRNIGIAQISRYRLPWAGKVSILHRVSGAMMFLLLPFVLYLFEQSVTSELS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
            +     +     +V +    W  +HH   GIR+L+ DV + + K  + + A
Sbjct: 63  FAKFSALLSNGFIKVVILALIWGYLHHFCAGIRFLLLDVHVGVTKPASAKSA 114


>gi|49077638|gb|AAT49701.1| PA1581 [synthetic construct]
          Length = 129

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 70/125 (56%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++ + RP++  L+  +L  T + SI+HRI+G +++LG  V++F      + E     ++
Sbjct: 3   KAVNSKRPVNLDLRTIKLPVTAYTSILHRISGVILFLGIAVLLFALDKSLSSEEGFEQVK 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI-IASILTVL 120
             +   + ++ ++    A+++H++ G+R+L+ D  +    +   + +KI I IA +L VL
Sbjct: 63  ACLTSPLAKLVIWGLLSALLYHLVAGVRHLVMDAGVGETLEGGKRGSKIVIAIAVVLIVL 122

Query: 121 I-VWI 124
             VW+
Sbjct: 123 AGVWV 127


>gi|58584743|ref|YP_198316.1| succinate dehydrogenase subunit C sdhC [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58419059|gb|AAW71074.1| Succinate dehydrogenase subunit C sdhC [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 125

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 15/128 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC---- 62
           +RPLSPHLQIY++  T F SI+HR+TG ++     V++ W+F +      L  ++C    
Sbjct: 3   DRPLSPHLQIYKVQVTNFFSIMHRLTG-ILLFLLLVMLSWYFTLHVYFPELFIVKCLNVL 61

Query: 63  ---YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCL---DKKIATQMAKINIIASI 116
              ++   V  +C   +++    H L GIR+L+WD    L   D   +  +  + +I S 
Sbjct: 62  LSTFIAKLVCILCFISFSY----HFLNGIRHLLWDAGFNLEITDVLKSAMLLTVMLILST 117

Query: 117 LTVLIVWI 124
           +  L V+I
Sbjct: 118 MAFLFVFI 125


>gi|15596778|ref|NP_250272.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa PAO1]
 gi|116049526|ref|YP_791670.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218892462|ref|YP_002441329.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa LESB58]
 gi|254234682|ref|ZP_04928005.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa C3719]
 gi|254239930|ref|ZP_04933252.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa 2192]
 gi|296390045|ref|ZP_06879520.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa PAb1]
 gi|9947544|gb|AAG04970.1|AE004586_8 succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa PAO1]
 gi|115584747|gb|ABJ10762.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126166613|gb|EAZ52124.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa C3719]
 gi|126193308|gb|EAZ57371.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa 2192]
 gi|218772688|emb|CAW28473.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa LESB58]
          Length = 128

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 70/125 (56%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++ + RP++  L+  +L  T + SI+HRI+G +++LG  V++F      + E     ++
Sbjct: 3   KAVNSKRPVNLDLRTIKLPVTAYTSILHRISGVILFLGIAVLLFALDKSLSSEEGFEQVK 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI-IASILTVL 120
             +   + ++ ++    A+++H++ G+R+L+ D  +    +   + +KI I IA +L VL
Sbjct: 63  ACLTSPLAKLVIWGLLSALLYHLVAGVRHLVMDAGVGETLEGGKRGSKIVIAIAVVLIVL 122

Query: 121 I-VWI 124
             VW+
Sbjct: 123 AGVWV 127


>gi|91077184|ref|XP_972464.1| PREDICTED: similar to succinate dehydrogenase [Tribolium castaneum]
 gi|270002817|gb|EEZ99264.1| hypothetical protein TcasGA2_TC000993 [Tribolium castaneum]
          Length = 172

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (51%), Gaps = 2/102 (1%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLR 61
           ++K  RP SPHL IY    T  +SI HR TG ++   T V+      + +  E  L++L 
Sbjct: 48  NMKLGRPQSPHLTIYAPQMTSMLSISHRATGMILTFYTIVLGTGAIILPDSIETYLNALE 107

Query: 62  CY-MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            Y + G V  V  F+  + + +H   GIR+L WD+ L L  K
Sbjct: 108 EYHVGGVVLSVGKFILAFPLTYHYWNGIRHLAWDIGLFLSLK 149


>gi|171463739|ref|YP_001797852.1| succinate dehydrogenase, cytochrome b556 subunit [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193277|gb|ACB44238.1| succinate dehydrogenase, cytochrome b556 subunit [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 139

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 19/120 (15%)

Query: 1   MSSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
             ++K +RP+  ++ +     YRL     VSI+HRI G+ ++L  P +++ F      + 
Sbjct: 5   QQNVKKDRPVYRNIGLAQLIKYRLPWASKVSILHRIGGAALFLMLPFILYLF------DQ 58

Query: 56  TLSSLRCYMDGSVFE-------VCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
           +L+S   Y     F        +CL L  W  +HH   GIRYL+ D+ + +++  A + A
Sbjct: 59  SLASKLSYQKFQAFTGNILVKIICLGL-IWCFLHHFCAGIRYLLLDLEIGVERSEANRSA 117


>gi|99035092|ref|ZP_01314880.1| hypothetical protein Wendoof_01000286 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 125

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (60%), Gaps = 6/99 (6%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           ++RPLSPHLQIY++  T F SI+HR+TG ++     +++ W+F +      L  +R Y++
Sbjct: 2   SDRPLSPHLQIYKVQVTSFFSIMHRLTG-ILLFLLLMILSWYFILHVYFPELLIVR-YLN 59

Query: 66  GSVF----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
             +F    ++   L   + ++H L GIR+L+ DV L L+
Sbjct: 60  ALLFTPVAKLAYVLCFISFVYHFLNGIRHLLRDVGLNLE 98


>gi|73542011|ref|YP_296531.1| succinate dehydrogenase subunit C [Ralstonia eutropha JMP134]
 gi|72119424|gb|AAZ61687.1| succinate dehydrogenase subunit C [Ralstonia eutropha JMP134]
          Length = 136

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     VSI+HR++G++++L  P V++ F      E + +     + G   ++ +   
Sbjct: 23  YRLPWAGKVSILHRVSGAMMFLLLPFVLYLFEQSITSELSFAKFSALLSGGFVKLVVLAL 82

Query: 77  TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
            W  +HH   GIR+L+ DV + + K  + + A
Sbjct: 83  IWGYLHHFCAGIRFLLLDVHVGVSKPASAKSA 114


>gi|325303890|tpg|DAA34619.1| TPA_inf: truncated succinate dehydrogenase cytochrome b subunit
           [Amblyomma variegatum]
          Length = 173

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 51/98 (52%), Gaps = 12/98 (12%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFW-----FFCIANGEHTLSSLR 61
           NRPLSPHL IY+   TM +S+ HR+TG    +G    V+        C  +  H + +LR
Sbjct: 53  NRPLSPHLGIYKQQITMVLSLTHRVTG----IGMTAFVYGMGLMPLVCSHHFPHYVEALR 108

Query: 62  CYMDGSV--FEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
                 V  F V L L  +A+ +H   G+R++ WD+ L
Sbjct: 109 AMEISPVLTFPVKLGL-AFALCYHTFNGVRHMAWDLGL 145


>gi|307609335|emb|CBW98819.1| succinate dehydrogenase, cytochrome b556 subunit [Legionella
           pneumophila 130b]
          Length = 111

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 54/94 (57%), Gaps = 1/94 (1%)

Query: 21  PTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAV 80
           P    SI+HR++G +++L  P V+F   C    E + +  +  +    +++ L+ +  ++
Sbjct: 5   PMAIASILHRVSGVLIFLLFPFVLFILSCSLQSEESFAQTKIILANPYYKLLLWAFGASM 64

Query: 81  IHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA 114
           I+H++ GIR+LI D+      + A +M+ ++IIA
Sbjct: 65  IYHVIAGIRHLIMDMGFGESLR-AGRMSAVSIIA 97


>gi|294340933|emb|CAZ89328.1| putative Succinate dehydrogenase cytochrome b556 subunit
           (Cytochrome b-556) (sdhC) [Thiomonas sp. 3As]
          Length = 137

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 54/100 (54%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     VSI+HRI+G+V++L  P+V++ F        + +++  ++     ++ L   
Sbjct: 24  YRLPLAGLVSILHRISGAVMFLALPLVLWAFDDSLRSADSHAAITQFLSHWFVKLILLGL 83

Query: 77  TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            WA++HH++ G+R+L  D    + K    Q+A I    S+
Sbjct: 84  FWALMHHLVAGVRHLWMDAFHAVSKAQGLQLALITFAVSL 123


>gi|319786900|ref|YP_004146375.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465412|gb|ADV27144.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 130

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 58/122 (47%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI+HR TG V+  G  V+      +  G  + +    + 
Sbjct: 3   SRERPLSPHLQVYRWQVQMVTSILHRATGIVLAGGALVLAGGLLALMVGPESWACFTGHA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                +V L  +TWA  +H+  GIR++  D +         + + ++I  S++   IVW 
Sbjct: 63  GAWYGKVFLLGWTWAFAYHLCNGIRHVAQDFAHGYAIPDFVRNSWLSIAGSLVITAIVWA 122

Query: 125 IK 126
           + 
Sbjct: 123 LA 124


>gi|332526164|ref|ZP_08402299.1| succinate dehydrogenase, cytochrome b556 subunit [Rubrivivax
           benzoatilyticus JA2]
 gi|332110004|gb|EGJ10632.1| succinate dehydrogenase, cytochrome b556 subunit [Rubrivivax
           benzoatilyticus JA2]
          Length = 140

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 62/130 (47%), Gaps = 13/130 (10%)

Query: 5   KNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
              RP+  ++ I     YRL    FVSI+HRI+G+++++  P V++ F      E +  +
Sbjct: 3   STQRPVYRNIHISQIASYRLPLAGFVSILHRISGALMFVLLPFVIWLFDNSLTSEISFDT 62

Query: 60  LRCYMDGSVFEVCLFLYT-------WAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI 112
                   V  V  FL         WA +HH++ GIRYL  DVS    K+     A + +
Sbjct: 63  FTSAFVAGVGFVPAFLVKLVVLALIWAYLHHLIAGIRYLWMDVSHAYSKQSGRSSAIVTL 122

Query: 113 IASI-LTVLI 121
             S+ LT L+
Sbjct: 123 ALSLPLTALL 132


>gi|313668609|ref|YP_004048893.1| succinate dehydrogenase cytochrome B subunit [Neisseria lactamica
           ST-640]
 gi|313006071|emb|CBN87532.1| putative succinate dehydrogenase cytochrome B subunit [Neisseria
           lactamica 020-06]
          Length = 125

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  +   
Sbjct: 6   RPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHP 65

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLI 121
           + ++ L    WA +HH L GIR+L  D    L+   A   AK+   A+ +LTV++
Sbjct: 66  LVKLVLIGVLWAYLHHSLAGIRFLFLDAHKGLELNTARNTAKLVFTAALVLTVVL 120


>gi|224009964|ref|XP_002293940.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220970612|gb|EED88949.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 191

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 60/128 (46%), Gaps = 8/128 (6%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           K  RP+SPH+ IY        SI  R+TG ++  G   +        +G   LS+++C  
Sbjct: 65  KTRRPVSPHVTIYSFPVCALSSIATRVTGCILSFGAAGLGIVEIFGGSGA-ALSTMQCIG 123

Query: 65  DGSVFEVCLFLY------TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII-ASIL 117
            G +    LF+        +   +H LGG+R+L+WD S  +   +  + A   ++ AS+L
Sbjct: 124 SGEMVGGALFVAGAKFSVAFPFAYHYLGGLRHLVWDNSPEMLTNVDVEKASYGLLGASVL 183

Query: 118 TVLIVWII 125
              +  ++
Sbjct: 184 LSSVAAVV 191


>gi|269214842|ref|ZP_05987260.2| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           lactamica ATCC 23970]
 gi|269208913|gb|EEZ75368.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           lactamica ATCC 23970]
          Length = 141

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  +   
Sbjct: 22  RPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHP 81

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLI 121
           + ++ L    WA +HH L GIR+L  D    L+   A   AK+   A+ +LTV++
Sbjct: 82  LVKLVLIGVLWAYLHHSLAGIRFLFLDAHKGLELNTARNTAKLVFTAALVLTVVL 136


>gi|91789451|ref|YP_550403.1| succinate dehydrogenase subunit C [Polaromonas sp. JS666]
 gi|91698676|gb|ABE45505.1| succinate dehydrogenase subunit C [Polaromonas sp. JS666]
          Length = 148

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 8/117 (6%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCL 73
           L  YRL     VSI+HRI+G++++L  P +++ F    + E + S  +   +  +  +  
Sbjct: 24  LPSYRLPLAGLVSILHRISGAIMFLLMPFIIWMFDTSISSEISFSRFKSAFNAGMLGLPG 83

Query: 74  FLYT-------WAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVLIV 122
           FL+        WA +HH + G+R+L  D S   + K+     A + +  SI   L++
Sbjct: 84  FLWKLVALALIWAYLHHFIAGLRHLWMDTSHAAVSKEFGKSSAAVTLAVSIGLTLVL 140


>gi|294671245|ref|ZP_06736098.1| hypothetical protein NEIELOOT_02955 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307073|gb|EFE48316.1| hypothetical protein NEIELOOT_02955 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 127

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 61/121 (50%), Gaps = 2/121 (1%)

Query: 6   NNRPLSPHLQIY-RLIPTM-FVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
             RP+   LQ+  R +P    VSI+HR +G ++++  PV++       +      S +  
Sbjct: 4   KKRPVFLDLQVLVRHLPVPGIVSILHRASGVILFIMIPVLLMLLNGSLSSGEDFESYKAV 63

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            D  + ++ L    WA +HH+  GIR+L+ D    L+ +   + AK+ +I S+   L++ 
Sbjct: 64  ADNPLVKLILIGVLWAFLHHLCAGIRFLLLDAHQGLELQTCRKTAKLVLIISLSLTLVLG 123

Query: 124 I 124
           +
Sbjct: 124 V 124


>gi|22550363|ref|NP_689350.1| succinate:cytochrome c oxidoreductase subunit 3 [Chaetosphaeridium
           globosum]
 gi|22417029|gb|AAM96628.1|AF494279_33 succinate:cytochrome c oxidoreductase subunit 3 [Chaetosphaeridium
           globosum]
          Length = 129

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 55/104 (52%), Gaps = 9/104 (8%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF---FCIAN----GEHT 56
           +K NRPLSPHL +Y+   T  +SI HRI+G+  +L   V+ F      C  N      + 
Sbjct: 1   MKINRPLSPHLTVYKPQLTSTLSIFHRISGA--FLAFFVLSFALSMPICQINLSFYSFYK 58

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           +    C+    VF   L L  ++V +HM  GIR+L+WD  L LD
Sbjct: 59  IWFYLCHDKLWVFLTVLNLAFFSVCYHMSNGIRHLLWDYGLFLD 102


>gi|73535958|pdb|1ZOY|C Chain C, Crystal Structure Of Mitochondrial Respiratory Complex Ii
           From Porcine Heart At 2.4 Angstroms
 gi|73535962|pdb|1ZP0|C Chain C, Crystal Structure Of Mitochondrial Respiratory Complex Ii
           Bound With 3-Nitropropionate And
           2-Thenoyltrifluoroacetone
 gi|322812260|pdb|3ABV|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide
 gi|322812268|pdb|3AE1|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With N-Phenyl-2-(Trifluoromethyl)-Benzamide
 gi|322812272|pdb|3AE2|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Hydroxy-N-Phenyl-Benzamide
 gi|322812276|pdb|3AE3|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Nitro-N-Phenyl-Benzamide
 gi|322812280|pdb|3AE4|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-Methyl-Benzamide
 gi|322812284|pdb|3AE5|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Methyl-N-(3-Isopropoxy-Phenyl)-Benzamide
 gi|322812288|pdb|3AE6|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With N-(3-Isopropoxy-Phenyl)-Phthalamicacid
 gi|322812292|pdb|3AE7|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-(3-Isopropoxy-Phenyl)-Benzamide
 gi|322812296|pdb|3AE8|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Isopropoxy-Phenyl)-2-Trifluoromethylbenzamide
 gi|322812300|pdb|3AE9|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Pentafluorophenyloxy-Phenyl)-2-Trifluoromethyl-
           Benzamide
 gi|322812304|pdb|3AEA|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Dimethylaminomethyl-Phenyl)-2-Trifluoromethyl-
           Benzamide
 gi|322812308|pdb|3AEB|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Phenoxy-Phenyl)-2-Trifluoromethyl-Benzamide
 gi|322812312|pdb|3AEC|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-(1-Methylethyl)-Benzamid
 gi|322812316|pdb|3AED|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-Phenyl-Benzamide
 gi|322812320|pdb|3AEE|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With Atpenin A5
 gi|322812324|pdb|3AEF|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii With An Empty Quinone-Binding Pocket
 gi|322812328|pdb|3AEG|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With N-Biphenyl-3-Yl-2-Iodo-Benzamide
          Length = 140

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 62/122 (50%), Gaps = 9/122 (7%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           ++ +NRPLSPH+ IYR    M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 16  NLGSNRPLSPHITIYRWSLPMAMSICHRGTG--IALSAGVSLFGLSALLLPGNFESHLEL 73

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
           ++    G ++     F   + +++H   GIR+LIWD+   L      Q+ +  ++  ILT
Sbjct: 74  VKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLT---IPQLTQSGVVVLILT 130

Query: 119 VL 120
           VL
Sbjct: 131 VL 132


>gi|325982599|ref|YP_004295001.1| succinate dehydrogenase, cytochrome b556 subunit [Nitrosomonas sp.
           AL212]
 gi|325532118|gb|ADZ26839.1| succinate dehydrogenase, cytochrome b556 subunit [Nitrosomonas sp.
           AL212]
          Length = 129

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 65/115 (56%), Gaps = 6/115 (5%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVC 72
           L+I + IP + VSI+HRI+G +++  G P+++     +         L+ Y++  + ++ 
Sbjct: 16  LKIRQPIPAV-VSILHRISGVLLFFPGIPLLLCGLQLLLESPQGFEILQGYINNPMIKLM 74

Query: 73  LFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVLIVW 123
           L L  W  +HH+  GIR+L+ D+ + +  + A   +K+ +IA    + LT L++W
Sbjct: 75  LLLPLWFFLHHLCAGIRHLLLDMQVGIALEQARTGSKLVLIAGFALTTLTGLVLW 129


>gi|261377703|ref|ZP_05982276.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria cinerea
           ATCC 14685]
 gi|269145976|gb|EEZ72394.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria cinerea
           ATCC 14685]
          Length = 125

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  + 
Sbjct: 4   KSRPVYLDLPKIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRSIIS 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
             + ++ L    WA +HH   GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 64  HPLVKLILLGVLWAYLHHFFAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 119


>gi|38638302|ref|NP_943707.1| succinate:cytochrome c oxidoreductase subunit 3 [Chara vulgaris]
 gi|32966616|gb|AAP92199.1| succinate:cytochrome c oxidoreductase subunit 3 [Chara vulgaris]
          Length = 131

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVV-FWFFCIANGEHTLSSLR- 61
           +K NRPLSPH+ IY+   T   SI HRI G+  +L T V+    FF I     T      
Sbjct: 1   MKINRPLSPHITIYKPQLTSTFSIFHRICGA--FLATTVLFSILFFKICELSLTFYHFYL 58

Query: 62  ------CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIA 114
                 CY    +F +   L   A+ +HM  GIR+L+WD+   LD  K+ T    +   A
Sbjct: 59  FVFYFICYFHWLIFSL-FNLAFLALCYHMSNGIRHLLWDLGHSLDLSKVYTSGTIMFFFA 117

Query: 115 SILTVL 120
           + L  L
Sbjct: 118 ACLVTL 123


>gi|319792256|ref|YP_004153896.1| succinate dehydrogenase, cytochrome b556 subunit [Variovorax
           paradoxus EPS]
 gi|315594719|gb|ADU35785.1| succinate dehydrogenase, cytochrome b556 subunit [Variovorax
           paradoxus EPS]
          Length = 148

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC-------YMDG 66
           L  YRL P   VSI+HR++G +++L  P  ++ F    + +++ +  +        ++ G
Sbjct: 24  LTTYRLPPAGIVSILHRVSGVLMFLLLPFTIWMFDTSLSSDYSFARFKAAFNSGLGFVPG 83

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVLIV 122
             F++      WA +HH + G+R+L  DVS   + K+     A + +  S+L  +++
Sbjct: 84  WFFKLVALALIWAYLHHFIAGLRHLWMDVSHAAVTKEFGHTSAVVTLALSVLLTVVL 140


>gi|290463150|sp|D0VWV4|C560_PIG RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; AltName: Full=Succinate-ubiquinone
           oxidoreductase cytochrome B large subunit; Short=CYBL;
           Flags: Precursor
          Length = 169

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 9/123 (7%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLS 58
            ++ +NRPLSPH+ IYR    M +SI HR TG  + L   V +F    +    N E  L 
Sbjct: 44  KNLGSNRPLSPHITIYRWSLPMAMSICHRGTG--IALSAGVSLFGLSALLLPGNFESHLE 101

Query: 59  SLRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
            ++    G ++     F   + +++H   GIR+LIWD+   L      Q+ +  ++  IL
Sbjct: 102 LVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLT---IPQLTQSGVVVLIL 158

Query: 118 TVL 120
           TVL
Sbjct: 159 TVL 161


>gi|308072487|dbj|BAJ22105.1| succinate dehydrogenase cytochrome subunit 3 [Cycas taitungensis]
          Length = 130

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 8/109 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           NRPLSPHL IY+   T   SI+HRI+G+  +L T V+    FC+  G  + +    Y   
Sbjct: 4   NRPLSPHLTIYKPQLTSTFSILHRISGA--FLATMVLFSLLFCLEIGLISFTYGNFYQFS 61

Query: 67  SVFEVCLF------LYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
                  F      L   A+ +HM  G+R+L WD+   L+  +  ++++
Sbjct: 62  FSVNFPKFILGLVNLTLLALCYHMSNGVRHLWWDLGFFLEFSLIIRISE 110


>gi|15676841|ref|NP_273986.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis MC58]
 gi|121634750|ref|YP_974995.1| putative succinate dehydrogenase cytochrome B subunit [Neisseria
           meningitidis FAM18]
 gi|161869861|ref|YP_001599030.1| succinate dehydrogenase cytochrome B subunit [Neisseria
           meningitidis 053442]
 gi|218768032|ref|YP_002342544.1| putative succinate dehydrogenase cytochrome B subunit [Neisseria
           meningitidis Z2491]
 gi|254804831|ref|YP_003083052.1| succinate dehydrogenase cytochrome b-556 subunit [Neisseria
           meningitidis alpha14]
 gi|7226187|gb|AAF41354.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis MC58]
 gi|120866456|emb|CAM10202.1| putative succinate dehydrogenase cytochrome B subunit [Neisseria
           meningitidis FAM18]
 gi|121052040|emb|CAM08349.1| putative succinate dehydrogenase cytochrome B subunit [Neisseria
           meningitidis Z2491]
 gi|161595414|gb|ABX73074.1| succinate dehydrogenase cytochrome B subunit [Neisseria
           meningitidis 053442]
 gi|254668373|emb|CBA05461.1| succinate dehydrogenase cytochrome b-556 subunit [Neisseria
           meningitidis alpha14]
 gi|254671329|emb|CBA08736.1| succinate dehydrogenase cytochrome b-556 subunit [Neisseria
           meningitidis alpha153]
 gi|261392704|emb|CAX50277.1| succinate dehydrogenase cytochrome b-556 subunit [Neisseria
           meningitidis 8013]
 gi|316985351|gb|EFV64300.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis H44/76]
 gi|319410281|emb|CBY90623.1| succinate dehydrogenase cytochrome b-556 subunit [Neisseria
           meningitidis WUE 2594]
 gi|325128093|gb|EGC50988.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis N1568]
 gi|325132169|gb|EGC54865.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis M6190]
 gi|325134135|gb|EGC56787.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis M13399]
 gi|325136116|gb|EGC58725.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis M0579]
 gi|325138101|gb|EGC60674.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis ES14902]
 gi|325140162|gb|EGC62689.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis CU385]
 gi|325142230|gb|EGC64648.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis 961-5945]
 gi|325144260|gb|EGC66565.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis M01-240013]
 gi|325198181|gb|ADY93637.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis G2136]
 gi|325200367|gb|ADY95822.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis H44/76]
 gi|325204020|gb|ADY99473.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis M01-240355]
 gi|325206221|gb|ADZ01674.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis M04-240196]
          Length = 125

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  +   
Sbjct: 6   RPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHP 65

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           + ++ L    WA +HH L GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 66  LVKLVLIGVLWAYLHHSLAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 119


>gi|325202264|gb|ADY97718.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis M01-240149]
 gi|325207983|gb|ADZ03435.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           meningitidis NZ-05/33]
          Length = 125

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  +   
Sbjct: 6   RPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHP 65

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           + ++ L    WA +HH L GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 66  LVKLVLIGVLWAYLHHSLAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 119


>gi|59801319|ref|YP_208031.1| putative fumarate reductase cytochrome b large subunit [Neisseria
           gonorrhoeae FA 1090]
 gi|194098442|ref|YP_002001501.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998841|ref|ZP_04718765.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           35/02]
 gi|240014244|ref|ZP_04721157.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           DGI18]
 gi|240016680|ref|ZP_04723220.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           FA6140]
 gi|240080869|ref|ZP_04725412.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           FA19]
 gi|240112767|ref|ZP_04727257.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           MS11]
 gi|240115518|ref|ZP_04729580.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID18]
 gi|240117813|ref|ZP_04731875.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID1]
 gi|240121807|ref|ZP_04734769.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID24-1]
 gi|240123368|ref|ZP_04736324.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID332]
 gi|240125616|ref|ZP_04738502.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           SK-92-679]
 gi|240128072|ref|ZP_04740733.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           SK-93-1035]
 gi|254493627|ref|ZP_05106798.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           1291]
 gi|260440671|ref|ZP_05794487.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           DGI2]
 gi|268594684|ref|ZP_06128851.1| succinate dehydrogenase [Neisseria gonorrhoeae 35/02]
 gi|268596986|ref|ZP_06131153.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           FA19]
 gi|268598835|ref|ZP_06133002.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           MS11]
 gi|268601193|ref|ZP_06135360.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID18]
 gi|268603513|ref|ZP_06137680.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID1]
 gi|268681993|ref|ZP_06148855.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID332]
 gi|268684205|ref|ZP_06151067.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           SK-92-679]
 gi|268686461|ref|ZP_06153323.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291043980|ref|ZP_06569696.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           DGI2]
 gi|293399179|ref|ZP_06643344.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           gonorrhoeae F62]
 gi|59718214|gb|AAW89619.1| putative fumarate reductase cytochrome b large subunit [Neisseria
           gonorrhoeae FA 1090]
 gi|193933732|gb|ACF29556.1| Succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512667|gb|EEH62012.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           1291]
 gi|268548073|gb|EEZ43491.1| succinate dehydrogenase [Neisseria gonorrhoeae 35/02]
 gi|268550774|gb|EEZ45793.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           FA19]
 gi|268582966|gb|EEZ47642.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           MS11]
 gi|268585324|gb|EEZ50000.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID18]
 gi|268587644|gb|EEZ52320.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID1]
 gi|268622277|gb|EEZ54677.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           PID332]
 gi|268624489|gb|EEZ56889.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           SK-92-679]
 gi|268626745|gb|EEZ59145.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291012443|gb|EFE04432.1| succinate dehydrogenase cytochrome B subunit [Neisseria gonorrhoeae
           DGI2]
 gi|291610593|gb|EFF39703.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           gonorrhoeae F62]
 gi|317164128|gb|ADV07669.1| putative fumarate reductase cytochrome b large subunit [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 125

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  +   
Sbjct: 6   RPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHP 65

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           + ++ L    WA +HH L GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 66  LVKLVLIGILWAYLHHSLAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 119


>gi|304387747|ref|ZP_07369927.1| succinate dehydrogenase cytochrome b558 subunit [Neisseria
           meningitidis ATCC 13091]
 gi|304338223|gb|EFM04353.1| succinate dehydrogenase cytochrome b558 subunit [Neisseria
           meningitidis ATCC 13091]
 gi|308389613|gb|ADO31933.1| putative succinate dehydrogenase cytochrome B subunit [Neisseria
           meningitidis alpha710]
          Length = 141

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  +   
Sbjct: 22  RPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHP 81

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           + ++ L    WA +HH L GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 82  LVKLVLIGVLWAYLHHSLAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 135


>gi|163856130|ref|YP_001630428.1| succinate dehydrogenase cytochrome b-556 subunit, transmembrane
           component [Bordetella petrii DSM 12804]
 gi|163259858|emb|CAP42159.1| Succinate dehydrogenase cytochrome b-556 subunit, transmembrane
           component [Bordetella petrii]
          Length = 137

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFC--IANGEHTLSSLRCYMDGSVFEVCLF 74
           YRL     +SI+HR++G++++L  P+V+   F   +A+ E + + +  Y    + ++ L 
Sbjct: 23  YRLPLAGKLSILHRVSGALLFLCLPLVILPLFAASVASPE-SYAQVAQYAGNPLVKLVLL 81

Query: 75  LYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           +  W  +HH   GIRYL+ D+ + +DK  A + A + +    L + +V+ +K
Sbjct: 82  VLVWGYLHHFCAGIRYLVLDLHIGIDKVSAQKSAGV-VFGVSLALTLVFALK 132


>gi|111073627|emb|CAL29489.1| SdhC; succinate dehydrogenase b-type cytochrome subunit [Wolbachia
           endosymbiont of Onchocerca volvulus]
          Length = 125

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 63/118 (53%), Gaps = 7/118 (5%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL---SSLRC 62
           ++RPLSPHLQIY++  T   SI+HR+TG ++     V++ W+F +      L     L  
Sbjct: 2   SDRPLSPHLQIYKIQITNLFSIIHRLTG-ILLFLLLVMLSWYFILHVYFPKLFIVKYLNV 60

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
            +   + ++   L     ++H   GIR+L+WDV   L     T ++K  I+ +++ +L
Sbjct: 61  LLSTPIAKLAYVLCFIGFLYHFFNGIRHLLWDVGFNLR---ITDVSKSAILLTVMLLL 115


>gi|28869397|ref|NP_792016.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|28852638|gb|AAO55711.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|330875700|gb|EGH09849.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|331018601|gb|EGH98657.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 124

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HRI+G ++++G  ++++        E     ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVGIAIMLYAMDKSLASEEGFGEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ ++    A+++HM+ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  LTSPLAKLIIWGLLSALLYHMVAGIRHLIMDTGVGETLEGGKLGSKIVIAVSVVLILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|308323411|gb|ADO28842.1| mitochondrial succinate dehydrogenase cytochrome b560 subunit
           [Ictalurus punctatus]
          Length = 166

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCY-M 64
           NRPLSPH+ IYR    M +SI HR TG V+  G          +     + L  +  + M
Sbjct: 46  NRPLSPHITIYRWSVPMMMSITHRGTGVVLSAGISAFAAAALVLPGSFPYYLDLVHSFSM 105

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
             ++     F  ++ V +H   GIR+L+WDV 
Sbjct: 106 GPALITTAKFALSFPVAYHTYNGIRHLMWDVG 137


>gi|187477680|ref|YP_785704.1| succinate dehydrogenase cytochrome b-556 subunit [Bordetella avium
           197N]
 gi|115422266|emb|CAJ48790.1| succinate dehydrogenase cytochrome b-556 subunit [Bordetella avium
           197N]
          Length = 137

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 3/112 (2%)

Query: 12  PHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFC--IANGEHTLSSLRCYMDGSVF 69
           P +  YRL     +SI+HR +G++++L  P+V+   F   +A+ E + + +  Y    + 
Sbjct: 18  PQILSYRLPLAGKLSILHRASGALLFLCLPLVIVPLFAASVASPE-SFAQVAQYAGNPLI 76

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           ++ L    W  +HH   GIRYL  D+ + +DK  + + A    + S+L  L+
Sbjct: 77  KIVLLALIWGYLHHFCAGIRYLALDLHIGIDKAASRKSAAAVFVVSLLLTLV 128


>gi|296136777|ref|YP_003644019.1| succinate dehydrogenase, cytochrome b556 subunit [Thiomonas
           intermedia K12]
 gi|295796899|gb|ADG31689.1| succinate dehydrogenase, cytochrome b556 subunit [Thiomonas
           intermedia K12]
          Length = 137

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     VSI+HRI+G+V++L  P+V++ F        +  ++  ++     ++ L   
Sbjct: 24  YRLPLAGLVSILHRISGAVMFLALPLVLWAFDDSLRSADSHVAITQFLSHWFVKLILLGL 83

Query: 77  TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            WA++HH++ G+R+L  D    + K    Q+A I    S+
Sbjct: 84  FWALMHHLVAGVRHLWMDAFHAVSKAQGLQLALITFAVSL 123


>gi|237653215|ref|YP_002889529.1| succinate dehydrogenase, cytochrome b556 subunit [Thauera sp. MZ1T]
 gi|237624462|gb|ACR01152.1| succinate dehydrogenase, cytochrome b556 subunit [Thauera sp. MZ1T]
          Length = 129

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 2/127 (1%)

Query: 1   MSSIKNNRPLSPHLQIY--RLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLS 58
           MS +   +P   +L +   RL     VSI+HRI+G  ++L  P +++          T  
Sbjct: 1   MSEVTARKPRPKYLALNEIRLPLPGIVSILHRISGVGIFLMLPFLLYLLDRSLGSPETFE 60

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
           +    +D    ++ LF   WA +HH   GIR+L+ D+   L+ + A + +KI +I S+  
Sbjct: 61  TFAAVVDNWFIKLVLFGLLWAYLHHFCAGIRFLLLDLHKGLELEEARKSSKIVLIVSLTL 120

Query: 119 VLIVWII 125
            LI+ ++
Sbjct: 121 TLIIGVV 127


>gi|332373648|gb|AEE61965.1| unknown [Dendroctonus ponderosae]
          Length = 176

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 48/103 (46%), Gaps = 26/103 (25%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITG------------SVVYLGTPVVVFWFFCIANGEH 55
           RP SPHL IY+   T  +SI HR TG            + VYL  P+           EH
Sbjct: 55  RPQSPHLTIYKPQLTSMLSISHRATGMVLTGYTVLFSMAAVYLDCPL-----------EH 103

Query: 56  TLSSLRCYM--DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
            +  LRC     GS++ +  FL  + + +H   GIR+LIWD  
Sbjct: 104 YIEQLRCAEIGFGSIYAL-KFLIAFPLTYHFWNGIRHLIWDTG 145


>gi|270157997|ref|ZP_06186654.1| succinate dehydrogenase cytochrome b556 subunit [Legionella
          longbeachae D-4968]
 gi|289163737|ref|YP_003453875.1| succinate dehydrogenase, cytochrome b556 subunit [Legionella
          longbeachae NSW150]
 gi|269990022|gb|EEZ96276.1| succinate dehydrogenase cytochrome b556 subunit [Legionella
          longbeachae D-4968]
 gi|288856910|emb|CBJ10724.1| succinate dehydrogenase, cytochrome b556 subunit [Legionella
          longbeachae NSW150]
          Length = 124

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 52/93 (55%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
          +   RP++  L   +  P    SI+HRI+G V++L  P+++F +      E     ++  
Sbjct: 1  MNKKRPVNLDLVSLKYPPMAIASILHRISGVVLFLLLPIMLFIWGQSVQSEEAFLHVKNL 60

Query: 64 MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
          +  S +++ ++ +  A+I+H+L GIR+L+ D+ 
Sbjct: 61 LSQSCYKMVVWAFGSAMIYHLLAGIRHLLMDIG 93


>gi|217968584|ref|YP_002353818.1| succinate dehydrogenase, cytochrome b556 subunit [Thauera sp. MZ1T]
 gi|217505911|gb|ACK52922.1| succinate dehydrogenase, cytochrome b556 subunit [Thauera sp. MZ1T]
          Length = 128

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%)

Query: 25  VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHM 84
            SI HR++G ++++  PV+          E   +S+R  +   +  V   +  WA+ HH+
Sbjct: 25  ASIAHRVSGVLLFIALPVLAALLHASLRSEADFASVRGLLSSPLSLVVAGVLAWALAHHV 84

Query: 85  LGGIRYLIWDVSLCLDKKIATQMAK 109
           L GIR+L+ DV +  + + A   A+
Sbjct: 85  LAGIRHLLMDVGIGSELERARASAR 109


>gi|50120296|ref|YP_049463.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Pectobacterium atrosepticum SCRI1043]
 gi|49610822|emb|CAG74267.1| succinate dehydrogenase cytochrome b-556 subunit [Pectobacterium
           atrosepticum SCRI1043]
          Length = 129

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            S+K  RP++  LQ  +   T   SI+HR++G + ++   ++++      + E       
Sbjct: 3   KSVKKQRPVNLELQTIQFPVTAIASILHRVSGVITFVAVGILLWLLGTSLSSEEGFLRAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-----LCLDKKIATQMAKINIIASI 116
             MD  + +  ++    A+ +H++GGIR+L+ D       L   K+ A     I ++ SI
Sbjct: 63  EIMDSFIVKFIVWGILVALAYHIVGGIRHLLMDFGYIEEDLAAGKRSANLSFIITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|238898940|ref|YP_002924622.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466700|gb|ACQ68474.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 126

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 64/125 (51%), Gaps = 7/125 (5%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           K  RP++  L  +R   T   SI+HRI+G +++      V+      +           +
Sbjct: 3   KKQRPINLDLMTFRFPLTAIASILHRISGVIIFFAVGCFVWLLGLSLSSPEGFIKASTII 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK--KIATQMAK----INIIASILT 118
           D  + ++ L+ +  A+ +H+LGGIR+L+ D   C+++  K+  + A+    I ++ SIL 
Sbjct: 63  DYFLIKLILWGFLTALFYHLLGGIRHLLMDFG-CIEENLKLGIRSAQVVMVITVLLSILV 121

Query: 119 VLIVW 123
            +I+W
Sbjct: 122 GIIIW 126


>gi|303319777|ref|XP_003069888.1| Succinate dehydrogenase cytochrome b subunit family protein
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240109574|gb|EER27743.1| Succinate dehydrogenase cytochrome b subunit family protein
           [Coccidioides posadasii C735 delta SOWgp]
          Length = 193

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPV-VVFWFFCIANGEHTLSSLRCYMD 65
           NRP+SPHL IYR   + ++S ++RITGSV+  G  V    +    A G H  S+      
Sbjct: 70  NRPVSPHLTIYRPQISWYLSALNRITGSVLSGGLYVFATAYLVAPAIGWHLESASLAAAF 129

Query: 66  GSVFEVCLFLYTWAV----IHHMLGGIRYLIWDVSLCLDKK 102
           G++     F     V      H + G+R+LIWD+   L  K
Sbjct: 130 GALPLAAKFAIKLGVAMPFTFHCMNGVRHLIWDLGKKLSNK 170


>gi|332992984|gb|AEF03039.1| succinate dehydrogenase, cytochrome b subunit [Alteromonas sp. SN2]
          Length = 124

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 55/109 (50%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L   +  P    SI+HR+TG  ++     V++ +    +     ++++  
Sbjct: 1   MKKQRPVNLELNTIKFPPAAISSILHRVTGVAMFFALLFVIWAWAVSVSSPEGFANVQAM 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI 112
           MDG + +V       A+ +H+LGG+R+++ D+    + +     AKI I
Sbjct: 61  MDGIIGKVIAIGTLSALTYHILGGLRHVVMDLGHWEELESGNLSAKIAI 109


>gi|320034179|gb|EFW16124.1| succinate dehydrogenase [Coccidioides posadasii str. Silveira]
          Length = 186

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPV-VVFWFFCIANGEHTLSSLRCYMD 65
           NRP+SPHL IYR   + ++S ++RITGSV+  G  V    +    A G H  S+      
Sbjct: 63  NRPVSPHLTIYRPQISWYLSALNRITGSVLSGGLYVFATAYLVAPAIGWHLESASLAAAF 122

Query: 66  GSVFEVCLFLYTWAV----IHHMLGGIRYLIWDVSLCLDKK 102
           G++     F     V      H + G+R+LIWD+   L  K
Sbjct: 123 GALPLAAKFAIKLGVAMPFTFHCMNGVRHLIWDLGKKLSNK 163


>gi|297250644|ref|ZP_06864705.2| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           polysaccharea ATCC 43768]
 gi|296838408|gb|EFH22346.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria
           polysaccharea ATCC 43768]
          Length = 141

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 1/115 (0%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L   RL     VSI+HRI+G  +++  P ++++     + E    + R  +   
Sbjct: 22  RPVYLDLPNIRLPIPGIVSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHP 81

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           + ++ L    WA +HH   GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 82  LVKLILLGVLWAYLHHFFAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 135


>gi|254450977|ref|ZP_05064414.1| succinate dehydrogenase, cytochrome b556 subunit [Octadecabacter
           antarcticus 238]
 gi|198265383|gb|EDY89653.1| succinate dehydrogenase, cytochrome b556 subunit [Octadecabacter
           antarcticus 238]
          Length = 103

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 50/92 (54%)

Query: 26  SIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHML 85
           SI  R+TG+ + +G  ++V+WF  +A+G    +    +M     ++ +F     + +H L
Sbjct: 3   SIFTRLTGNALIVGALLIVWWFSALASGPEAYARANGFMTSWFGDLVMFGSVACLWYHTL 62

Query: 86  GGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
            G+R+LIWD    LD + + +  +  ++ S+L
Sbjct: 63  AGVRHLIWDSGHMLDVERSERAGQAIVLVSVL 94


>gi|310814646|ref|YP_003962610.1| Succinate dehydrogenase cytochrome b-556 subunit
           [Ketogulonicigenium vulgare Y25]
 gi|308753381|gb|ADO41310.1| Succinate dehydrogenase cytochrome b-556 subunit
           [Ketogulonicigenium vulgare Y25]
          Length = 132

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 6/127 (4%)

Query: 5   KNNRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           K  RPLSP +  + YR+  T   S++ RI+G+ +  G  ++V+W   +A G      +  
Sbjct: 6   KGGRPLSPFMLGKYYRIQLTSASSLLTRISGNALIAGAVLLVWWLLGLAMGPDWFGPVHW 65

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS----ILT 118
            +   +  + +   TWA+ +H+L G R+LI+D    L  + A ++    +I S    +LT
Sbjct: 66  VVTSWIGRLIIVGSTWALWYHLLAGARHLIFDQGYGLKIQTAERLGWAAVIGSFVLTVLT 125

Query: 119 VLIVWII 125
           V + W+I
Sbjct: 126 VGLFWLI 132


>gi|113969971|ref|YP_733764.1| succinate dehydrogenase subunit C [Shewanella sp. MR-4]
 gi|114047206|ref|YP_737756.1| succinate dehydrogenase subunit C [Shewanella sp. MR-7]
 gi|117920153|ref|YP_869345.1| succinate dehydrogenase subunit C [Shewanella sp. ANA-3]
 gi|113884655|gb|ABI38707.1| succinate dehydrogenase subunit C [Shewanella sp. MR-4]
 gi|113888648|gb|ABI42699.1| succinate dehydrogenase subunit C [Shewanella sp. MR-7]
 gi|117612485|gb|ABK47939.1| succinate dehydrogenase subunit C [Shewanella sp. ANA-3]
          Length = 131

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T  VSI+HR++G ++     ++++          + + ++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIVSILHRVSGVIMLFAVGILIWLLNSSLASAESFAGVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASIL 117
              D  V +  ++    A+ +H+ GG+R+L+ D     +    T  AK    + +  SIL
Sbjct: 66  SLFDNFVVKFIMWGILTALAYHLFGGLRHLVMDTGRWEELASGTASAKAVFVLTVAFSIL 125

Query: 118 TVLIVW 123
             L VW
Sbjct: 126 AGLWVW 131


>gi|260220786|emb|CBA28698.1| hypothetical protein Csp_A08450 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 163

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 52/102 (50%), Gaps = 7/102 (6%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC-------YMDG 66
           L  YRL P  +VSI+HRI+G+++++  P +++ F    + E + +           ++ G
Sbjct: 40  LPTYRLPPAGWVSILHRISGAIMFILMPFIIWMFDTSVSSEISFAKFTSVFSVGVGFIPG 99

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
              ++      WA +HH + G+R+L  D++  + K+     A
Sbjct: 100 WFVKLVALAIIWAYLHHFIAGMRHLWMDINHAVSKEFGRSSA 141


>gi|213968188|ref|ZP_03396333.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301383807|ref|ZP_07232225.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato Max13]
 gi|302059585|ref|ZP_07251126.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato K40]
 gi|302133374|ref|ZP_07259364.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213927168|gb|EEB60718.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato T1]
          Length = 124

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HR++G ++++G  ++++        E     ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRVSGVILFVGIAIMLYAMDKSLASEEGFGEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ ++    A+++HM+ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  LTSPLAKLIIWGLLSALLYHMVAGIRHLIMDTGVGETLEGGKLGSKIVIAVSVVLILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|149374990|ref|ZP_01892763.1| succinate dehydrogenase (C subunit) [Marinobacter algicola DG893]
 gi|149360879|gb|EDM49330.1| succinate dehydrogenase (C subunit) [Marinobacter algicola DG893]
          Length = 150

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 68/125 (54%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S++ + RP++  L  +        SI+HR++G ++++G   +++      +GE   S + 
Sbjct: 25  SAVNSKRPVNLDLGKFHFPLPAITSILHRVSGIIIFVGVAFMLYGLQLSLSGEEGFSRVS 84

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             +D  + ++  +    A+++H++ GI++L+ D+ +  + +     AK  ++ S++ +L+
Sbjct: 85  DLLDSFLAKLITWGILSALLYHLVAGIKHLLMDMGIGEELESGRLAAKATVVISVILILL 144

Query: 122 --VWI 124
             VW+
Sbjct: 145 AGVWV 149


>gi|71737948|ref|YP_274200.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257485479|ref|ZP_05639520.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289624405|ref|ZP_06457359.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289646681|ref|ZP_06478024.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298486513|ref|ZP_07004573.1| Succinate dehydrogenase cytochrome b-556 subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|71558501|gb|AAZ37712.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298158990|gb|EFI00051.1| Succinate dehydrogenase cytochrome b-556 subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320329258|gb|EFW85255.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330880846|gb|EGH14995.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|331010660|gb|EGH90716.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 124

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HRI+G ++++G  ++++        E     ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVGIAIMLYAMDKSLASEEGFGEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ ++    A+++HM+ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  LTSPLAKLIIWGLLSALLYHMVAGIRHLIMDSGVGETLEGGKLGSKIVIAVSVVLILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|221134277|ref|ZP_03560582.1| succinate dehydrogenase, cytochrome b subunit [Glaciecola sp.
           HTCC2999]
          Length = 124

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 4/120 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRC 62
           +K  RP++  L   +  P+   SI+HR+TG  ++    + V W + ++ G E   ++++ 
Sbjct: 1   MKKQRPVNLDLNTIKFPPSAISSILHRVTGVAMFFAL-LFVIWAWAVSLGSEEGFNNVQI 59

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            MDG + +        A+ +H+LGGIR+ I D+     +++ +     N++  I  VL V
Sbjct: 60  IMDGFLGKFVAIGTVSALTYHILGGIRHGIMDMGYW--EELESGNTSANVVIGIWVVLTV 117


>gi|88607062|ref|YP_505561.1| succinate dehydrogenase, cytochrome b556 subunit [Anaplasma
           phagocytophilum HZ]
 gi|46361034|gb|AAL17653.2| succinate dehydrogenase subunit C [Anaplasma phagocytophilum]
 gi|88598125|gb|ABD43595.1| succinate dehydrogenase, cytochrome b556 subunit [Anaplasma
           phagocytophilum HZ]
          Length = 127

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 19/112 (16%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL--- 60
           +  +RPLSPHL +Y+L  T ++SI HRITG ++ +G  +  +    +      L  L   
Sbjct: 1   MSRSRPLSPHLSVYKLPITAWLSITHRITGVLLLMGLTLFTWLLISLHWTSGQLWGLLDS 60

Query: 61  -------RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIAT 105
                  +  + G +  +C         +H   GIR+L WD  +   K  AT
Sbjct: 61  WIGVLLVKVIIGGCIAALC---------YHYYNGIRHLFWDCGIGFGKSEAT 103


>gi|329903473|ref|ZP_08273492.1| Succinate dehydrogenase cytochrome b-556 subunit [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548348|gb|EGF33033.1| Succinate dehydrogenase cytochrome b-556 subunit [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 136

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 6/116 (5%)

Query: 1   MSSI-KNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           MS + K NRP   ++ +     YRL     +SI+HRI+G +++   PV+++        E
Sbjct: 1   MSEVTKTNRPEFRNIHVTQLANYRLPLAGLISILHRISGFLMFALLPVILYLLDQSLLSE 60

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
            T    +        ++ L   +WA +HH   GIR+L  D  + ++K  A + A I
Sbjct: 61  GTFEYFKGITSNWFVKLVLLAVSWAFLHHFCAGIRHLFMDNHIGIEKDSARKSAVI 116


>gi|254672872|emb|CBA07129.1| succinate dehydrogenase cytochrome b-556 subunit [Neisseria
           meningitidis alpha275]
          Length = 114

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 25  VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHM 84
           VSI+HRI+G  +++  P ++++     + E    + R  +   + ++ L    WA +HH 
Sbjct: 12  VSILHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVSHPLVKLVLIGVLWAYLHHS 71

Query: 85  LGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           L GIR+L  D    L+   A   AK  + AS L + +V
Sbjct: 72  LAGIRFLFLDAHKGLELNTARNTAK-AVFASALVLTVV 108


>gi|148284919|ref|YP_001249009.1| succinate dehydrogenase, cytochrome b556 subunit [Orientia
           tsutsugamushi str. Boryong]
 gi|146740358|emb|CAM80791.1| succinate dehydrogenase, cytochrome b556 subunit [Orientia
           tsutsugamushi str. Boryong]
          Length = 116

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 10  LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVF 69
           +SPH+ IYR+  +M +SI+HR++G  V+ G  ++ +W       +     +  + +   F
Sbjct: 1   MSPHITIYRMQMSMILSILHRLSGMAVFGGASIITWWLILCVYSDFDRIVVDIFYN-LWF 59

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +  ++L  +    H+  GIR+LIWD       K
Sbjct: 60  QALIYLTIFTTCFHLCTGIRHLIWDTGYGFSIK 92


>gi|167522351|ref|XP_001745513.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163775862|gb|EDQ89484.1| predicted protein [Monosiga brevicollis MX1]
          Length = 178

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           K NRP+SPHL IYR      +SI HR++G+ + +                H LS    Y+
Sbjct: 58  KLNRPMSPHLTIYRFPLPAILSISHRVSGAALTMAISAAAIGLMV-----HPLS---FYI 109

Query: 65  DG----SVFEVCLF----LYTWAVIHHMLGGIRYLIWDVSLCLD 100
           D      +   C F    L  +   +H + G+R+L WD +  L+
Sbjct: 110 DAVQAMQLPAACFFTTKTLLAFPFTYHTVNGLRHLFWDTAKGLE 153


>gi|313768525|ref|YP_004062200.1| SdhC [Gracilariopsis andersonii]
 gi|312844652|gb|ADR03216.1| SdhC [Gracilariopsis andersonii]
          Length = 126

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 10/103 (9%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFW------FFCIANGEHTLSSL 60
           NRPLSPHL IY+   +   SI HRI+G  ++L T ++VF+      F  I   +  L+SL
Sbjct: 3   NRPLSPHLTIYKPQVSSLFSIWHRISG--IFL-TFLIVFYLISSQLFLHITYSKDVLNSL 59

Query: 61  RCYMDGSVF-EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
              ++ S F +    L T    +H + G++++IWD+      K
Sbjct: 60  IIQLEYSFFLQFIYILNTSIFFYHAINGVKHIIWDLGFFPTPK 102


>gi|261822347|ref|YP_003260453.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Pectobacterium wasabiae WPP163]
 gi|261606360|gb|ACX88846.1| succinate dehydrogenase, cytochrome b556 subunit [Pectobacterium
           wasabiae WPP163]
          Length = 129

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            S+K  RP++  LQ  +   T   SI+HR++G + ++   ++++      + E       
Sbjct: 3   KSVKKQRPVNLELQTIQFPVTAIASILHRVSGVITFVAVGILLWLLGTSLSSEEGFLRAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-----LCLDKKIATQMAKINIIASI 116
             MD  + +  ++    A+ +H++GG+R+L+ D       L   K+ A     I ++ SI
Sbjct: 63  EIMDSFIVKFIVWGILAALAYHIVGGLRHLLMDFGYIEEDLAAGKRSANISFIITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|11467108|ref|NP_054409.1| succinate dehydrogenase subunit 3 [Marchantia polymorpha]
 gi|543911|sp|P35721|C560_MARPO RecName: Full=Succinate dehydrogenase cytochrome b560 subunit;
           AltName: Full=Succinate dehydrogenase, subunit III
 gi|786193|gb|AAC09406.1| ORF137 [Marchantia polymorpha]
          Length = 137

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 63/125 (50%), Gaps = 10/125 (8%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVV-FWFFCIANGEHTLSSLRC 62
           +K NRPLSPHL IY+   T   SI HRI+G+  +L T V+    FF I +   T      
Sbjct: 1   MKINRPLSPHLTIYKPQLTSTFSIFHRISGA--FLATMVLFSILFFKIGDLSLTFYHFYQ 58

Query: 63  YMDGSVFEVCLFLYT------WAVIHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIAS 115
           Y     F +  F+ +       A+ +HM  G+R+L+WD+   L+  K+ T    +   A+
Sbjct: 59  YFFFLTFYLNWFIISLVNFTLLALCYHMSNGVRHLLWDLGFFLELSKVYTSGIIMLFCAA 118

Query: 116 ILTVL 120
            L +L
Sbjct: 119 FLALL 123


>gi|225559635|gb|EEH07917.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           capsulatus G186AR]
          Length = 215

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 9/123 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEHTLSSLRCY 63
           NRP+SPH+ IYR   T  +S++HR TG  + L  P  +F+    A+   G H  S+    
Sbjct: 85  NRPVSPHISIYRPQITSVLSLLHRNTG--LLLSGPFYLFFAAYAASPWLGWHIDSTSMAA 142

Query: 64  MDGSV-FEVCLFLYTWAVIH---HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
             G++     + L T A +    H + G+R+L+WD+      K  T+  +  I  SI + 
Sbjct: 143 SFGTLPVAAKVLLKTTAALPFTFHCINGVRHLVWDLGRGFSNKQVTKSGRTVIGLSISSA 202

Query: 120 LIV 122
           L++
Sbjct: 203 LLL 205


>gi|320589791|gb|EFX02247.1| succinate dehydrogenase cytochrome b560 subunit [Grosmannia
           clavigera kw1407]
          Length = 612

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 64/141 (45%), Gaps = 27/141 (19%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMF-VSIVHRITG----------SVVYLGTPVVVFWFFC 49
           ++S +  RP+SPHL IY      F  SI+HR TG          S+ YL  P++      
Sbjct: 481 LASQRLQRPVSPHLDIYDKRQIYFGASILHRFTGLTYAGLLYGGSLAYLAAPLL------ 534

Query: 50  IANGEHTLS-SLRCYMDG---SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-KIA 104
              G H  S SL  +  G   ++  V  F   W +  H   G R+L+WD ++   K +IA
Sbjct: 535 ---GWHLESQSLVTFAAGLPLALKGVAKFALAWPLAFHFFNGARHLVWDAAVGFSKAEIA 591

Query: 105 TQMAKINIIA--SILTVLIVW 123
                I +++  S L +  +W
Sbjct: 592 KGTTAIWVLSVVSSLGLAFLW 612


>gi|300113363|ref|YP_003759938.1| succinate dehydrogenase cytochrome b556 subunit [Nitrosococcus
           watsonii C-113]
 gi|299539300|gb|ADJ27617.1| succinate dehydrogenase, cytochrome b556 subunit [Nitrosococcus
           watsonii C-113]
          Length = 128

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 3/120 (2%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
            N RP+  +L + R      VS++HRI+G ++    PVVV+        E     +  + 
Sbjct: 4   NNPRPIFFNLALIRFPANAVVSVLHRISGVILLFFIPVVVYLLDLSLRDEEGFVWVTQFF 63

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV---SLCLDKKIATQMAKINIIASILTVLI 121
                 +   +  WA++HH+  GIR+L++D+    +  D + +      +I+A ++T+LI
Sbjct: 64  SSLPVRLMGIIALWALLHHIFAGIRFLLFDIHVGKIVKDYRPSWSARIASILALVVTLLI 123


>gi|119183341|ref|XP_001242721.1| hypothetical protein CIMG_06617 [Coccidioides immitis RS]
          Length = 305

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPV-VVFWFFCIANGEHTLSSLRCYMD 65
           NRP+SPHL IYR   + ++S ++RITGSV+  G  V    +    A G H  S+      
Sbjct: 182 NRPVSPHLTIYRPQISWYLSALNRITGSVLSGGLYVFATAYLVAPAIGWHLESASLAAAF 241

Query: 66  GSVFEVCLFLYTWAV----IHHMLGGIRYLIWDVSLCLDKK 102
           G++     F     V      H + G+R+LIWD+   L  K
Sbjct: 242 GALPLAAKFAIKLGVAMPFTFHCMNGVRHLIWDLGKKLSNK 282


>gi|58616911|ref|YP_196110.1| succinate dehydrogenase cytochrome B-556 subunit [Ehrlichia
           ruminantium str. Gardel]
 gi|58416523|emb|CAI27636.1| Succinate dehydrogenase cytochrome B-556 subunit [Ehrlichia
           ruminantium str. Gardel]
          Length = 132

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 5/121 (4%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQ+Y+L     +SI HR TG ++++G  ++ + F   A     +     +   S
Sbjct: 5   RPLSPHLQVYKLPMAAVLSITHRFTGILLFIGLLLLAWTFIACAIYPELIHKAYLFFSTS 64

Query: 68  V-----FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                 F++ +F+    + +H L G+R+++WD  L L K        + ++ S+L   IV
Sbjct: 65  YFALYGFKLFIFVCLNVLCYHYLNGVRHILWDFGLGLTKSAVKTSGIVVLVLSLLFSFIV 124

Query: 123 W 123
           +
Sbjct: 125 Y 125


>gi|124267357|ref|YP_001021361.1| succinate dehydrogenase subunit C [Methylibium petroleiphilum PM1]
 gi|124260132|gb|ABM95126.1| succinate dehydrogenase subunit C [Methylibium petroleiphilum PM1]
          Length = 146

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 14/121 (11%)

Query: 2   SSIKNNRPLSPHLQI-------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           +++K  RP   H  I       YRL P   VSI+HRI+G++++L  P +V+ F    + E
Sbjct: 4   TTVKAGRPRPVHRNIHVSQIIGYRLPPAGIVSILHRISGAIMFLLLPFIVWLFDTSLSSE 63

Query: 55  HTLSSLRC-------YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
            +  +          ++ G   ++      WA + H + G+R+L  DV+  + K+   + 
Sbjct: 64  ISYETFTSAFVAGIGFVPGWFVKLVALALIWAYLLHFIAGVRHLWMDVTHAVSKEAGHRS 123

Query: 108 A 108
           A
Sbjct: 124 A 124


>gi|269959019|ref|YP_003328808.1| succinate dehydrogenase cytochrome B-556 subunit [Anaplasma
           centrale str. Israel]
 gi|269848850|gb|ACZ49494.1| succinate dehydrogenase cytochrome B-556 subunit [Anaplasma
           centrale str. Israel]
          Length = 127

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 67/136 (49%), Gaps = 25/136 (18%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +  +RPLSPHLQIYRL    ++SI HR +G +++ G  +V+ W F +         LRC 
Sbjct: 2   VLRSRPLSPHLQIYRLPVAAWLSITHRASGLLLFFGL-LVLSWLFVL---------LRCA 51

Query: 64  MDG---------SVFEVCLFLYTW--AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI 112
            D            F V L  ++   A  +H   G+R+L+WD  + LDK + T      +
Sbjct: 52  PDCVMPFLANPWGFFLVKLLSFSCCVAFCYHYFNGVRHLLWDCGVGLDKTVVTASNTFVL 111

Query: 113 IA----SILTVLIVWI 124
           +     S++T   VW+
Sbjct: 112 LLTAAFSVVTFFFVWL 127


>gi|156376569|ref|XP_001630432.1| predicted protein [Nematostella vectensis]
 gi|156217453|gb|EDO38369.1| predicted protein [Nematostella vectensis]
          Length = 169

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCYMD 65
            RP+SP L  Y+      +S  HR+TG ++  GT +       +  G EH ++ ++ +  
Sbjct: 48  KRPMSPFLLTYKFEFPALLSGSHRVTGVIMTTGTTIFALCALGLPEGLEHYVNVIKGWEL 107

Query: 66  GSVF-EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
              F   C  L  W V +H L G+R+L WD+    + K
Sbjct: 108 PRPFIFTCKTLLAWPVCYHGLNGLRHLFWDIGKGFEIK 145


>gi|253687626|ref|YP_003016816.1| succinate dehydrogenase, cytochrome b556 subunit [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754204|gb|ACT12280.1| succinate dehydrogenase, cytochrome b556 subunit [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 129

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            S+K  RP++  LQ  +   T   SI+HR++G + ++   ++++      + E       
Sbjct: 3   KSVKKQRPVNLELQTIQFPVTAIASILHRVSGVITFVAVGILLWLLGTSLSSEEGFLRAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-----LCLDKKIATQMAKINIIASI 116
             MD  + +  ++    A+ +H++GG+R+L+ D       L   K+ A     I ++ SI
Sbjct: 63  EIMDSFIVKFIVWGILVALAYHIVGGLRHLLMDFGYIEEDLAAGKRSANISFIITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|221220958|gb|ACM09140.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 186

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 46/95 (48%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K NRP+SPHL IY++     +S  HR TG +  + +  V    F   N    L ++R
Sbjct: 51  KNVKLNRPVSPHLSIYKMELPPLLSGSHRTTGFIFTVMSVSVATMSFLPWNWATILETMR 110

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
            Y+         F     V +H   GIR+L+WD+ 
Sbjct: 111 YYVPYPPIVFAKFGCVAGVSYHFFNGIRHLVWDLG 145


>gi|24373491|ref|NP_717534.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           oneidensis MR-1]
 gi|24347791|gb|AAN54978.1|AE015636_2 succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           oneidensis MR-1]
          Length = 131

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T  VSI+HR++G ++     ++++          + + ++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIVSILHRVSGVIMLFAVGILIWLLNSSLASAESFAGVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASIL 117
              D  V +  ++    A+  H+ GG+R+L+ D     +    T  AK    + +  SIL
Sbjct: 66  SLFDNFVVKFIMWGILTALTFHLFGGLRHLVMDTGRWEELASGTASAKAVFVLTVAFSIL 125

Query: 118 TVLIVW 123
             L VW
Sbjct: 126 AGLWVW 131


>gi|304310233|ref|YP_003809831.1| Succinate dehydrogenase, cytochrome b556 subunit [gamma
           proteobacterium HdN1]
 gi|301795966|emb|CBL44167.1| Succinate dehydrogenase, cytochrome b556 subunit [gamma
           proteobacterium HdN1]
          Length = 127

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 65/125 (52%), Gaps = 2/125 (1%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSS 59
           M ++ N RP+   L+  +L  T + SI+HRI+G V+  G  +++ W   ++   E     
Sbjct: 1   MMTVNNQRPVHLDLRTIKLPITAYTSILHRISG-VILFGGLILMLWALDVSLASEQGFEQ 59

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           ++  +D    ++  +    A+++H+  G+R+++ D+ +    +   + +KI  I S + +
Sbjct: 60  VKGVLDNFFVKLITWGLLSALLYHLAAGVRHMLMDIDIGETLQGGRKGSKIVFIVSGVLI 119

Query: 120 LIVWI 124
           LI  I
Sbjct: 120 LIAGI 124


>gi|254994783|ref|ZP_05276973.1| succinate dehydrogenase cytochrome b556 subunit (sdhC) [Anaplasma
           marginale str. Mississippi]
 gi|255002908|ref|ZP_05277872.1| succinate dehydrogenase cytochrome b556 subunit (sdhC) [Anaplasma
           marginale str. Puerto Rico]
 gi|255004036|ref|ZP_05278837.1| succinate dehydrogenase cytochrome b556 subunit (sdhC) [Anaplasma
           marginale str. Virginia]
          Length = 120

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 25/130 (19%)

Query: 10  LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG--- 66
           +SPHLQ+Y+L     +SI HR +G  ++ G  V+  W F +         LRC  D    
Sbjct: 1   MSPHLQVYKLPVAALLSITHRASGLFLFFGLSVLS-WLFVL---------LRCAPDCIAP 50

Query: 67  ------SVFEVCLFLYTW--AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA---- 114
                   F V L  ++   A  +H   G+R+L+WD  + LDK   T  +   ++     
Sbjct: 51  FLANPLGFFLVKLLSFSCCVAFCYHYFNGVRHLLWDCGVGLDKTAVTASSAFVLLLTAAF 110

Query: 115 SILTVLIVWI 124
           S++    VW+
Sbjct: 111 SVVAFFFVWL 120


>gi|82701992|ref|YP_411558.1| succinate dehydrogenase, cytochrome b subunit [Nitrosospira
           multiformis ATCC 25196]
 gi|82410057|gb|ABB74166.1| succinate dehydrogenase subunit C [Nitrosospira multiformis ATCC
           25196]
          Length = 125

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVC 72
           L+I + +P + +SI+HRI+G++++  G P+V+             + L+ +++  + +  
Sbjct: 12  LKIRQPLPAV-ISILHRISGALLFFPGIPLVLCGLDMALGSSEDYARLQSFLNNPMAKFG 70

Query: 73  LFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI----NIIASILTVLIVW 123
           L L  W  +HH   GIRYL  D+   +  + A   +K+     I+ ++LT  ++W
Sbjct: 71  LILALWFFLHHFCAGIRYLALDLHYGVKLEQARLSSKVVVGAGIVLTLLTGAVIW 125


>gi|254455343|ref|ZP_05068772.1| succinate dehydrogenase, cytochrome b556 subunit [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082345|gb|EDZ59771.1| succinate dehydrogenase, cytochrome b556 subunit [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 127

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++N  PLSPH+QIYR   +  VSI HRITG +  +   ++  W   +  G+ + S++  +
Sbjct: 1   MENKSPLSPHIQIYRWHISSLVSISHRITGIINIIAITLICIWASMLILGDSSYSTINLF 60

Query: 64  MD---GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII--ASILT 118
            +   G  F + L    W+    +L  IR+LI D+    + K  T++  I +I  +  LT
Sbjct: 61  FNSLLGKFFAIGL---AWSFSFQILSEIRHLIMDMGYGFELK-TTRITGIAVIFGSVALT 116

Query: 119 VLIVWIIKDIV 129
           +LI  I K+ +
Sbjct: 117 ILIYLIGKNFI 127


>gi|288941679|ref|YP_003443919.1| succinate dehydrogenase, cytochrome b556 subunit [Allochromatium
           vinosum DSM 180]
 gi|288897051|gb|ADC62887.1| succinate dehydrogenase, cytochrome b556 subunit [Allochromatium
           vinosum DSM 180]
          Length = 128

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RP+   L   +L  +  VSI+HR++G ++ L  P+V   F    +     ++    
Sbjct: 1   MTTPRPVFLDLLRIKLPLSGIVSILHRVSGVLMVLTIPIVAILFHQALSSPEGFAATAAV 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS----ILTV 119
           +D  + ++ L    WA+ HH++ GIR+L  D  + LD+ +A + A++ + A+    +L++
Sbjct: 61  LDTWLIKLVLLGLLWALFHHLVAGIRHLFLDYGVGLDRAMARETARLTLYAAPVLLVLSI 120

Query: 120 LIVWIIKD 127
           ++ +++ D
Sbjct: 121 ILSFLLGD 128


>gi|164663263|ref|XP_001732753.1| hypothetical protein MGL_0528 [Malassezia globosa CBS 7966]
 gi|159106656|gb|EDP45539.1| hypothetical protein MGL_0528 [Malassezia globosa CBS 7966]
          Length = 193

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 64/146 (43%), Gaps = 38/146 (26%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCI 50
           +++ +N RP+SPHL IY+   T   SI+HR TG          ++ YL  P        I
Sbjct: 60  LNTQRNERPISPHLSIYQPQLTWVSSILHRATGTGMSWALYAYAIGYLAAP-------HI 112

Query: 51  ANGEHTLSSLRCYMDGSVFEVCLFLYTWAVI-----------HHMLGGIRYLIWDVSLC- 98
             GE  LSS      GS+ +    L  WA +           +H   G+R+L WD+  C 
Sbjct: 113 GLGE-MLSS------GSLVDAVSHLPAWAKVSVKAPLAAAFMYHFFNGLRHLAWDMGYCT 165

Query: 99  --LDKKIATQMAKINIIASILTVLIV 122
                 +A ++  +    S+  +L+V
Sbjct: 166 FLFSHVVANRLTTVQSRFSVRRILLV 191


>gi|120598552|ref|YP_963126.1| succinate dehydrogenase, cytochrome subunit B [Shewanella sp.
           W3-18-1]
 gi|146293369|ref|YP_001183793.1| succinate dehydrogenase, cytochrome subunit B [Shewanella
           putrefaciens CN-32]
 gi|120558645|gb|ABM24572.1| succinate dehydrogenase subunit C [Shewanella sp. W3-18-1]
 gi|145565059|gb|ABP75994.1| succinate dehydrogenase subunit C [Shewanella putrefaciens CN-32]
 gi|319426671|gb|ADV54745.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           putrefaciens 200]
          Length = 131

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 51/108 (47%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T   SI+HR++G ++     ++++          + +S++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIASILHRVSGVIMLFAVGILIWLLNSSLASAESFASVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
              D  + +  L+    A+ +H+ GG+R+L+ D     +    T  AK
Sbjct: 66  SLFDNFIMKFILWGIMTALAYHLFGGLRHLVMDTGRWEELASGTASAK 113


>gi|170722680|ref|YP_001750368.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          putida W619]
 gi|169760683|gb|ACA73999.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          putida W619]
          Length = 128

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 54/96 (56%)

Query: 2  SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++K+ RP++  L+  +L  T + SI+HRI+G +++LG  ++++        E     ++
Sbjct: 3  KAVKSQRPVNLDLRTIKLPVTAYTSILHRISGVILFLGLAIMLYALGKSLGSEEGFGEVK 62

Query: 62 CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
            +   + +   +    A+++H++ G+R+LI D+ +
Sbjct: 63 ACLTSPLAKFVTWGLLSALLYHLVAGVRHLIMDMGI 98


>gi|332283673|ref|YP_004415584.1| succinate dehydrogenase cytochrome B subunit [Pusillimonas sp.
           T7-7]
 gi|330427626|gb|AEC18960.1| succinate dehydrogenase cytochrome B subunit [Pusillimonas sp.
           T7-7]
          Length = 104

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 28  VHRITGSVVYLGTPVVVFWFFCIANGE-HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLG 86
           +HR +G++++L  P+V+   F ++ G   + +S++ ++   + ++ L    W  +HH   
Sbjct: 1   MHRASGALLFLCIPLVILPLFALSVGSPESFASIQDWVANPLCKLVLLALIWGYLHHFCA 60

Query: 87  GIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           GIRYL+ D+ +  DK  A + A +    S+   L+
Sbjct: 61  GIRYLVLDLHIGNDKHTAQKTAGVVFGVSLALTLV 95


>gi|296285024|ref|ZP_06863022.1| succinate dehydrogenase subunit C [Citromicrobium bathyomarinum
           JL354]
          Length = 108

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 23  MFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEH---TLSSLRCYMDGSVFEVCLFLYTW 78
           MF SI+HR+TG  + L G  V+++W   +A+G     T S++   + G +  V L   TW
Sbjct: 1   MFTSILHRVTGDGMALVGLAVLLWWLGAMASGPEAYATFSAVATSIPGYIVLVGL---TW 57

Query: 79  AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
           A   HM+ G+R+ + D+    +  I    + +  I  +L  +  W I
Sbjct: 58  AFFSHMMSGLRHFVLDIGAGYELTINKTWSTLAPILGVLLTIAFWAI 104


>gi|104782665|ref|YP_609163.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          entomophila L48]
 gi|95111652|emb|CAK16373.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          entomophila L48]
          Length = 128

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 55/96 (57%)

Query: 2  SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++K+ RP++  L+  +L  T + SI+HRI+G +++LG  ++++        E   + ++
Sbjct: 3  KAVKSQRPVNLDLRTIKLPITAYTSILHRISGVILFLGLAIMLYALGKSLGSEEGFAEVK 62

Query: 62 CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
            +   + ++  +     +++H++ G+R+LI D+ +
Sbjct: 63 ACLTSPLAKLVTWGLLSGLLYHLVAGVRHLIMDMGI 98


>gi|227114759|ref|ZP_03828415.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
 gi|227327541|ref|ZP_03831565.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 129

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 61/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            S+K  RP++  LQ  +   T   SI+HR++G + ++   ++++      + E       
Sbjct: 3   KSVKKQRPVNLELQTIQFPVTAIASILHRVSGVITFVAVGILLWLLGTSLSSEEGFLRAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-----LCLDKKIATQMAKINIIASI 116
             MD  + +  ++    A+ +H++GGIR+L+ D           K+ A     I ++ SI
Sbjct: 63  EIMDSFIVKFIVWGILVALAYHIVGGIRHLLMDFGYIEEDFAAGKRSANISFIITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|83647436|ref|YP_435871.1| succinate dehydrogenase (C subunit) [Hahella chejuensis KCTC 2396]
 gi|83635479|gb|ABC31446.1| succinate dehydrogenase (C subunit) [Hahella chejuensis KCTC 2396]
          Length = 132

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 64/125 (51%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++ + RP++  L  +        SI+HRI+G ++++    +++        + + +SL+
Sbjct: 7   EAVNSKRPVNLDLTKFHFPLPAITSILHRISGVIIFIAMAFLLWGLDASLASKESFASLQ 66

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             MD  + ++ L+    A+ +H + GI++LI D  +    K     AK+ I  S++ +L+
Sbjct: 67  SVMDSFLAKLILWGILAALFYHFVAGIKHLIMDAGIGETLKGGQIAAKVVIAVSVVLILL 126

Query: 122 --VWI 124
             VWI
Sbjct: 127 AGVWI 131


>gi|295311709|ref|YP_003587361.1| succinate dehydrogenase subunit 3 [Cucurbita pepo]
 gi|259156837|gb|ACV96698.1| succinate dehydrogenase subunit 3 [Cucurbita pepo]
          Length = 105

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 22/99 (22%)

Query: 8  RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
          RPLSPHL IY+   T   SI HRI+G+  +L T V+ F+  C+  G      L C+   S
Sbjct: 5  RPLSPHLPIYKPQLTSTFSIFHRISGA--FLATLVLFFYLLCLKMG------LICFTHES 56

Query: 68 VFEVCLFLYTWAVI------------HHMLGGIRYLIWD 94
           +    F Y+  +I            +H+  G+R+L+ D
Sbjct: 57 FYR--FFFYSSKLILISVEITALALSYHLYKGVRHLLTD 93


>gi|110834361|ref|YP_693220.1| succinate dehydrogenase, cytochrome b556 subunit [Alcanivorax
           borkumensis SK2]
 gi|110647472|emb|CAL16948.1| succinate dehydrogenase, cytochrome b556 subunit [Alcanivorax
           borkumensis SK2]
          Length = 125

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 9/127 (7%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L   +   T   SI HR+TG  ++L  P++++          + + L+  
Sbjct: 1   MNDKRPVNLDLSTIKFPVTAIASITHRVTGVAIFLALPILLWMLDRSLTSPESFADLKEL 60

Query: 64  MDGSVFEVCLFLYTWAV----IHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           M  S+    + L  WA+    ++H++ GIR+LI D  +    +   + AK+  + S++ +
Sbjct: 61  MMTSLL---VKLVVWAILSVLLYHLVAGIRHLIMDAGVGESLEGGRRGAKLTFLISVVLI 117

Query: 120 LIV--WI 124
           L+V  WI
Sbjct: 118 LLVGGWI 124


>gi|295311666|ref|YP_003587250.1| succinate dehydrogenase subunit 3 [Citrullus lanatus]
 gi|295311667|ref|YP_003587234.1| succinate dehydrogenase subunit 3 [Citrullus lanatus]
 gi|259156794|gb|ACV96656.1| succinate dehydrogenase subunit 3 [Citrullus lanatus]
 gi|259156795|gb|ACV96657.1| succinate dehydrogenase subunit 3 [Citrullus lanatus]
          Length = 95

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 22/101 (21%)

Query: 8  RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
          RPLSPHL IY+   T   SI HRI+G+  +L T V+ F+  C+  G      L C+   +
Sbjct: 5  RPLSPHLPIYKPQLTSTFSIFHRISGA--FLATLVLFFYLLCLKMG------LICFTYSN 56

Query: 68 VFEVCLFLYTWAVI------------HHMLGGIRYLIWDVS 96
           +    F Y+  +I            +H+  G+R+L+ D S
Sbjct: 57 FYR--FFFYSSKLILISAEITALALSYHLYNGVRHLLTDFS 95


>gi|221220716|gb|ACM09019.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
           K NRP+SPHL IY+    M +SI HR TG  V L   +  F    +    N  + L  + 
Sbjct: 47  KLNRPVSPHLTIYKWSLPMMMSITHRGTG--VGLSGGISAFALLALVLPGNYPYYLDLIH 104

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
               G ++  +  F   + V +H L GIR+L WD           +   + I+ SILT
Sbjct: 105 SLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILT 162


>gi|46132950|ref|XP_389188.1| hypothetical protein FG09012.1 [Gibberella zeae PH-1]
          Length = 187

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 16/125 (12%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIV-HRITG----------SVVYLGTPVVVFWFFCIANGEH 55
           NRP+SPHL IY+L  T F S   +RITG          S+ YL  PVV      +     
Sbjct: 62  NRPVSPHLAIYKLEQTWFGSSAWNRITGCTLSATLYGFSIAYLAAPVVGLHLESL----- 116

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
           +++S    +  +V     F   +  ++H + G+++L++D      K    Q  K    AS
Sbjct: 117 SIASFVAGLPLAVKGGLKFTLGFPFVYHAISGVKHLLYDAGKGFAKSTIIQADKYVWAAS 176

Query: 116 ILTVL 120
           +L  +
Sbjct: 177 VLGAI 181


>gi|58578853|ref|YP_197065.1| succinate dehydrogenase cytochrome B-556 subunit [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417479|emb|CAI26683.1| Succinate dehydrogenase cytochrome B-556 subunit [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 143

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 63/121 (52%), Gaps = 5/121 (4%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQ+Y+L  +  +SI HR TG ++++G  ++ + F   A     +     +   S
Sbjct: 16  RPLSPHLQVYKLPMSAVLSITHRFTGILLFIGLLLLAWTFIACAIYPELIHKAYLFFSTS 75

Query: 68  V-----FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                 F++ +F+    + +H L G+R+++WD  L L K        + ++ S+L   IV
Sbjct: 76  YFALYGFKLFIFVCLNVLCYHYLNGVRHILWDFGLGLTKSAVKISGIVVLVLSLLFSFIV 135

Query: 123 W 123
           +
Sbjct: 136 Y 136


>gi|77165931|ref|YP_344456.1| succinate dehydrogenase, cytochrome b subunit [Nitrosococcus oceani
           ATCC 19707]
 gi|76884245|gb|ABA58926.1| succinate dehydrogenase subunit C [Nitrosococcus oceani ATCC 19707]
          Length = 140

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 17/131 (12%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF-FCIANGE------HTL 57
            N RP+  +L + R      VS +HRI+G ++    PVVV+   F + + E         
Sbjct: 16  NNPRPIFFNLALIRFPANAVVSALHRISGVILLFFIPVVVYLLDFSLRDKESFVWVTEFF 75

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV---SLCLDKKIATQMAKINIIA 114
           SSL   + G V         WA++HH+  GIR+L++D+    +  D + +      +I+A
Sbjct: 76  SSLPVRLVGIV-------ALWALLHHIFAGIRFLLFDIHMGKIVKDYRPSWSARITSILA 128

Query: 115 SILTVLIVWII 125
            ++T+LIV ++
Sbjct: 129 LVVTLLIVGVL 139


>gi|2137070|pir||I48085 integral membrane protein CII-3 - Chinese hamster (fragment)
          Length = 171

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  + RP+SPHL IYR    M +SI HR TG  V L   V +F    +    N E  L  
Sbjct: 49  NTSSKRPVSPHLTIYRWSLPMVMSICHRGTG--VALSGGVSLFGLSALLLPGNFESYLMF 106

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F+  + +++H L GIR+LIWD+   L 
Sbjct: 107 IKSLCLGPALIHSAKFVLVFPLMYHSLNGIRHLIWDLGKGLS 148


>gi|21362398|sp|P70097|C560_CRIGR RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; AltName: Full=Integral membrane protein
           CII-3; AltName: Full=QPs-1; Short=QPs1; Flags: Precursor
 gi|1518874|gb|AAB07265.1| integral membrane protein CII-3 [Cricetulus griseus]
          Length = 169

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  + RP+SPHL IYR    M +SI HR TG  V L   V +F    +    N E  L  
Sbjct: 45  NTSSKRPVSPHLTIYRWSLPMVMSICHRGTG--VALSGGVSLFGLSALLLPGNFESYLMF 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F+  + +++H L GIR+LIWD+   L 
Sbjct: 103 IKSLCLGPALIHSAKFVLVFPLMYHSLNGIRHLIWDLGKGLS 144


>gi|221219992|gb|ACM08657.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
           K NRP+SPHL IY+    M +SI HR TG  V L   +  F    +    N  + L  + 
Sbjct: 47  KLNRPVSPHLTIYKWSLPMMMSITHRGTG--VGLSGGISAFALLALVLPGNYPYYLDLIH 104

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
               G ++  +  F   + V +H L GIR+L WD           +   + I+ SILT
Sbjct: 105 SLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILT 162


>gi|221219496|gb|ACM08409.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221219988|gb|ACM08655.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221221046|gb|ACM09184.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
           K NRP+SPHL IY+    M +SI HR TG  V L   +  F    +    N  + L  + 
Sbjct: 47  KLNRPVSPHLTIYKWSLPMMMSITHRGTG--VGLSGGISAFALLALVLPGNYPYYLDLIH 104

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
               G ++  +  F   + V +H L GIR+L WD           +   + I+ SILT
Sbjct: 105 SLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILT 162


>gi|242792819|ref|XP_002482034.1| succinate dehydrogenase cytochrome b560 subunit [Talaromyces
           stipitatus ATCC 10500]
 gi|218718622|gb|EED18042.1| succinate dehydrogenase cytochrome b560 subunit [Talaromyces
           stipitatus ATCC 10500]
          Length = 188

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 45/101 (44%), Gaps = 5/101 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPV-VVFWFFCIANGEHTLSSLRCYMD 65
            RP+SPHL IYR   T + S +HRITGS+   G  V    +      G H  S+      
Sbjct: 65  KRPVSPHLSIYRPQITWYASGLHRITGSIASGGLYVFATAYLVAPVFGWHLESASIAAAF 124

Query: 66  GSVFEVCLFLYTWA----VIHHMLGGIRYLIWDVSLCLDKK 102
           G++     FL        V  H   G+R+L+WD    L  K
Sbjct: 125 GALPFAAKFLVKLGLALPVTFHSFNGVRHLLWDTGRFLTNK 165


>gi|67903612|ref|XP_682062.1| hypothetical protein AN8793.2 [Aspergillus nidulans FGSC A4]
 gi|40741396|gb|EAA60586.1| hypothetical protein AN8793.2 [Aspergillus nidulans FGSC A4]
 gi|67517322|gb|AAY68233.1| cytochrome B-560 subunit of succinate dehydrogenase [Emericella
           nidulans]
 gi|259483001|tpe|CBF78009.1| TPA: Cytochrome B-560 subunit of succinate dehydrogenasePutative
           uncharacterized protein ;
           [Source:UniProtKB/TrEMBL;Acc:Q5ASD7] [Aspergillus
           nidulans FGSC A4]
          Length = 191

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 15/106 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
            RP+SPHL IYR   T ++S +HR+TG          +  YL  P +  W    A+   +
Sbjct: 68  RRPVSPHLTIYRPQITWYMSALHRVTGIILSGPLYIFATAYLAAP-LFGWHLESASLAAS 126

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            ++L      S+  +    +T+    H   G+R+L+WD    +  K
Sbjct: 127 FATLPLAAKFSLKTLAALPFTY----HSFNGLRHLMWDTGRGITNK 168


>gi|221220816|gb|ACM09069.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221221340|gb|ACM09331.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221221580|gb|ACM09451.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
           K NRP+SPHL IY+    M +SI HR TG  V L   +  F    +    N  + L  + 
Sbjct: 47  KLNRPVSPHLTIYKWSLPMMMSITHRGTG--VGLSGGISAFALLALVLPGNYPYYLDLIH 104

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
               G ++  +  F   + V +H L GIR+L WD           +   + I+ SILT
Sbjct: 105 SLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILT 162


>gi|224365626|ref|YP_002608354.1| succinate dehydrogenase subunit 3 [Vitis vinifera]
 gi|209954150|emb|CAQ77586.1| succinate dehydrogenase subunit 3 [Vitis vinifera]
 gi|239764777|gb|ACS15245.1| succinate dehydrogenase subunit 3 [Vitis vinifera]
          Length = 168

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 18/99 (18%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHL IY+   T    I HRI+G+  +L T V+ F+  C+  G      L C+   +
Sbjct: 66  RPLSPHLPIYKPQLTSTFPIYHRISGA--FLATLVLFFYLLCLKIG------LICFTYEN 117

Query: 68  VFEVCLF----------LYTWAVIHHMLGGIRYLIWDVS 96
            ++   F          +   A+ +H+  G+R+L+ D S
Sbjct: 118 FYQFFFFSSKLILISVGITALALSYHLYNGVRHLLTDFS 156


>gi|255713256|ref|XP_002552910.1| KLTH0D04312p [Lachancea thermotolerans]
 gi|238934290|emb|CAR22472.1| KLTH0D04312p [Lachancea thermotolerans]
          Length = 168

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 26/136 (19%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL---- 60
           + NRP+SPHL IY+   T ++S +HR++G ++  G     F+   IA G   L  L    
Sbjct: 42  RKNRPVSPHLTIYQPQLTWYLSSLHRVSGVILAFG-----FFATTIAFGTSALLGLGLTS 96

Query: 61  ----RCY-------MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV--SLCLDKKIATQM 107
               R Y       MD +      +L+ +    H   G+R+LIWD   +L L     T  
Sbjct: 97  NNLARWYHEKVPRWMDLTAKGSFAYLFAF----HFANGLRHLIWDAGKALTLRGVYTTGY 152

Query: 108 AKINIIASILTVLIVW 123
           A + ++A   T L+ W
Sbjct: 153 AVMAVMALGGTYLLTW 168


>gi|149040639|gb|EDL94596.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_c [Rattus norvegicus]
          Length = 150

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
            +NRP+SPHL IYR    M +S+ HR  GS + +   V +F    +    N E  L  ++
Sbjct: 28  SSNRPVSPHLTIYRWSLPMAMSVCHR--GSGIAMSGGVSLFGLSALLLPGNFESYLMLVK 85

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
               G ++     F+  + +++H L G+R+L+WD+   L 
Sbjct: 86  SLCLGPALIHAAKFVLVFPLMYHSLNGVRHLMWDLGKGLS 125


>gi|114563518|ref|YP_751031.1| succinate dehydrogenase, cytochrome b subunit [Shewanella
           frigidimarina NCIMB 400]
 gi|114334811|gb|ABI72193.1| succinate dehydrogenase subunit C [Shewanella frigidimarina NCIMB
           400]
          Length = 131

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ      T   SI+HRI+G ++     ++++            +S++
Sbjct: 6   QNVKKQRPVHLDLQTISFPATAIASILHRISGVIMLFAIGILLWLLNSTLTSADGFASVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASIL 117
              DG V +  ++    A+ +H+LGGIR+LI D     +       AK    + ++ SI+
Sbjct: 66  SLFDGFVMKFIIWGILTALGYHLLGGIRHLIMDAGHWEELASGVSSAKATFVLAVVFSII 125

Query: 118 TVLIVW 123
             + VW
Sbjct: 126 AGIWVW 131


>gi|262369422|ref|ZP_06062750.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter
           johnsonii SH046]
 gi|262315490|gb|EEY96529.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter
           johnsonii SH046]
          Length = 132

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 68/131 (51%), Gaps = 6/131 (4%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L++    P    SI+HR++G +V+L  PV+++      +    
Sbjct: 1   MPAVKSNRPVNLSMGQVLEVNLKSPVAIASILHRLSGVIVFLLVPVLLWILDKSLSSPEG 60

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            + ++   +  +    ++++   +I H + G+++L+ D+ +  + +     A I++I S 
Sbjct: 61  FAQVQAIFNSFIVRFVVWVFVAGLIFHFIAGVKHLLADIGIAEELQSGRIAATISLILSA 120

Query: 117 LTVL--IVWII 125
           + ++   VWI+
Sbjct: 121 IGIVAAFVWIV 131


>gi|126134539|ref|XP_001383794.1| succinate dehydrogenase [Scheffersomyces stipitis CBS 6054]
 gi|126095943|gb|ABN65765.1| succinate dehydrogenase [Scheffersomyces stipitis CBS 6054]
          Length = 160

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 45/104 (43%), Gaps = 23/104 (22%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRP+SPHL IY+   TM +S  HRITG V   G       F+ +  G    S L    
Sbjct: 35  RKNRPVSPHLTIYQPQLTMVLSSFHRITG-VAMAGA------FYALTCGYAATSILNIPF 87

Query: 65  DGSVF--------------EVCLFLYTWAVIHHMLGGIRYLIWD 94
           D SV                  L  Y +A   H   GIR+L+WD
Sbjct: 88  DASVLVGVFASLPVAVKLSAKALMAYPFAF--HFGNGIRHLVWD 129


>gi|192362455|ref|YP_001981987.1| Succinate dehydrogenase cytochrome b subunit [Cellvibrio japonicus
           Ueda107]
 gi|190688620|gb|ACE86298.1| Succinate dehydrogenase cytochrome b subunit [Cellvibrio japonicus
           Ueda107]
          Length = 128

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 18/133 (13%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI----ANGEHTL 57
           S++K NRP++  +   +L  T +VSI+HRI+G  ++ G    + W   I    A G   +
Sbjct: 3   STVKKNRPVNLDISTIKLPITAYVSILHRISGIFLFAGVA-FLLWMLDISLRSAEGFEQV 61

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVI----HHMLGGIRYLIWDVSLCLDKKIATQMAK-INI 112
            ++          +C F+  WAV+    +H++ GIR+LI D+ +    K     AK + +
Sbjct: 62  KAIGAS------PLCQFIL-WAVLAGLAYHLVAGIRHLIMDLGVGETLKGGQLGAKLVVV 114

Query: 113 IASILTVLI-VWI 124
           IA++L +L  VW+
Sbjct: 115 IATVLIILAGVWV 127


>gi|57238921|ref|YP_180057.1| succinate dehydrogenase cytochrome B-556 subunit [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57161000|emb|CAH57906.1| putative succinate dehydrogenase cytochrome b-556 subunit
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 132

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 5/121 (4%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQ+Y+L     +SI HR TG ++++G  ++ + F   A     +     +   S
Sbjct: 5   RPLSPHLQVYKLPMAAVLSITHRFTGILLFIGLLLLAWTFIACAIYPELIHKAYLFFSTS 64

Query: 68  V-----FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                 F++ +F+    + +H L G+R+++WD  L L K        + ++ S+L   IV
Sbjct: 65  YFALYGFKLFIFVCLNVLCYHYLNGVRHILWDFGLGLTKSAVKISGIVVLVLSLLFSFIV 124

Query: 123 W 123
           +
Sbjct: 125 Y 125


>gi|281352142|gb|EFB27726.1| hypothetical protein PANDA_018826 [Ailuropoda melanoleuca]
          Length = 144

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 9/118 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLRCY 63
           NRPLSPH+ IY     M +SI HR TG  V L   V +F    +    N E  L  ++  
Sbjct: 24  NRPLSPHITIYSWSLPMAMSICHRGTG--VALSAGVSLFGLSALLIPGNFESHLELVKSL 81

Query: 64  MDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             G S+     F   + +++H   GIR+L+WD+   L  KI  Q+ +  +   +LTVL
Sbjct: 82  CLGPSLIYTAKFALVFPLMYHTWNGIRHLVWDLGKGL--KIP-QLYQSGVAVLVLTVL 136


>gi|251790498|ref|YP_003005219.1| succinate dehydrogenase, cytochrome b556 subunit [Dickeya zeae
           Ech1591]
 gi|247539119|gb|ACT07740.1| succinate dehydrogenase, cytochrome b556 subunit [Dickeya zeae
           Ech1591]
          Length = 129

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 65/125 (52%), Gaps = 5/125 (4%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  R   T   SI+HR++G + ++   ++++      + +   +     
Sbjct: 5   VKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFAQAAAI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-KIATQMAKIN----IIASILT 118
           M G + +  ++    A+ +H++GG+R+L+ D     +  +  ++ AKI+    ++ S+L 
Sbjct: 65  MSGFIVKFIVWGILTALAYHIVGGLRHLLMDFGYIEENFEAGSRSAKISFIITVVLSLLA 124

Query: 119 VLIVW 123
            ++VW
Sbjct: 125 GVLVW 129


>gi|224020960|ref|YP_002608193.1| succinate dehydrogenase subunit 3 [Carica papaya]
 gi|170522372|gb|ACB20482.1| succinate dehydrogenase subunit 3 [Carica papaya]
          Length = 108

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 22/114 (19%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHL IY+   T    I HRI+G+  +L T V+ F+ FC+  G        C+   +
Sbjct: 5   RPLSPHLPIYKPQLTSTFPISHRISGA--FLATIVLFFYLFCLKIG------FICFTYEN 56

Query: 68  VFEVCLFLYTWAVI------------HHMLGGIRYLIWDVSLCLDKKIATQMAK 109
            ++   F Y+  +I            +H+  G+R+L+ D S  L  +I  +  K
Sbjct: 57  FYQ--FFFYSSKLILISAEIAALALSYHLYNGVRHLLTDFSGFLFLRIGRKRLK 108


>gi|57111445|ref|XP_536140.1| PREDICTED: similar to succinate dehydrogenase complex, subunit C
           precursor [Canis familiaris]
          Length = 169

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 59/118 (50%), Gaps = 9/118 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLRCY 63
           NRPLSPH+ IY     M +SI HR TG  V L   V +F    +    N E  L  ++  
Sbjct: 49  NRPLSPHITIYSWSLPMAMSICHRGTG--VALSAGVSLFGLSALLVPGNFESHLELVKSL 106

Query: 64  MDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             G S+     F   + +++H   GIR+LIWD+   L  KI  Q+ +  +   +LTVL
Sbjct: 107 CLGPSLIYTAKFALVFPLMYHTWNGIRHLIWDLGKGL--KIP-QLYQSGVAVLVLTVL 161


>gi|332528254|ref|ZP_08404259.1| succinate dehydrogenase subunit C [Hylemonella gracilis ATCC 19624]
 gi|332042274|gb|EGI78595.1| succinate dehydrogenase subunit C [Hylemonella gracilis ATCC 19624]
          Length = 147

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 57/117 (48%), Gaps = 9/117 (7%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH--------TLSSLRCYMD 65
           L  YRL    +VSI+HR++G++++L  P V+ W F  A              S+   ++ 
Sbjct: 24  LPTYRLPAAGWVSILHRVSGALMFLLLPFVI-WLFDTATTSELSYERFAAAFSAGIGFVP 82

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           G   ++      W  +HH++ G+R+L  D +  + K+     A + ++ SI   L++
Sbjct: 83  GWFVKLATLGLIWGYLHHIIAGLRHLWMDATHAVTKEFGRNSAVVTLVLSIGLTLVL 139


>gi|26990885|ref|NP_746310.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          putida KT2440]
 gi|148546899|ref|YP_001267001.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          putida F1]
 gi|167034759|ref|YP_001669990.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          putida GB-1]
 gi|325275376|ref|ZP_08141322.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas sp.
          TJI-51]
 gi|24985898|gb|AAN69774.1|AE016613_9 succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          putida KT2440]
 gi|148510957|gb|ABQ77817.1| succinate dehydrogenase subunit C [Pseudomonas putida F1]
 gi|166861247|gb|ABY99654.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          putida GB-1]
 gi|313497961|gb|ADR59327.1| SdhC [Pseudomonas putida BIRD-1]
 gi|324099493|gb|EGB97393.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas sp.
          TJI-51]
          Length = 128

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 54/96 (56%)

Query: 2  SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++K+ RP++  L+  +L  T + SI+HRI+G ++++G  ++++        E     ++
Sbjct: 3  KAVKSQRPVNLDLRTIKLPVTAYTSILHRISGVILFIGLAIMLYALGKSLGSEEGFGEVK 62

Query: 62 CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
            +   + +   +    A+++H++ G+R+LI D+ +
Sbjct: 63 ACLTSPLAKFVTWGLLSALLYHLVAGVRHLIMDMGI 98


>gi|289742767|gb|ADD20131.1| succinate dehydrogenase cytochrome b subunit [Glossina morsitans
           morsitans]
          Length = 173

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 18/106 (16%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG----------TPVVVFWFFCIANGEHT 56
            R +SPHL IY+   T  +S+ HR TG V+  G          +P  +  +  +  G H 
Sbjct: 53  GREMSPHLTIYQPQLTSLLSVTHRGTGMVLTAGVWALGLAALISPQDIGNYASVIEGLH- 111

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
                  + G    V  F++ + +  H   G+R+L+WD    L  K
Sbjct: 112 -------LGGGTLTVLKFMFAFPLAFHTANGVRHLLWDTGRFLKIK 150


>gi|90021755|ref|YP_527582.1| succinate dehydrogenase subunit C [Saccharophagus degradans 2-40]
 gi|89951355|gb|ABD81370.1| succinate dehydrogenase subunit C [Saccharophagus degradans 2-40]
          Length = 124

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 62/121 (51%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +  NRP++  +   RL  T  VSI HR+TG V+  G   +++        E + + L+  
Sbjct: 1   MNKNRPVNLDISTMRLPITALVSITHRVTGVVLLAGILGLIWMLDLSLASEESFNQLKDC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +     ++ L     A+ +H++ G+R+LI D+ +   K+     AKI +  S++ ++++ 
Sbjct: 61  LAQPFVKIALIAVLAALAYHLVAGVRHLIMDLGIGESKEGGKLGAKIAVALSVVLIVLMG 120

Query: 124 I 124
           I
Sbjct: 121 I 121


>gi|53850596|ref|NP_001005534.1| succinate dehydrogenase complex, subunit C [Rattus norvegicus]
 gi|51980592|gb|AAH82027.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein [Rattus norvegicus]
 gi|149040638|gb|EDL94595.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_b [Rattus norvegicus]
          Length = 169

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 66/129 (51%), Gaps = 14/129 (10%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRP+SPHL IYR    M +S+ HR  GS + +   V +F    +    N E  L  
Sbjct: 45  NTSSNRPVSPHLTIYRWSLPMAMSVCHR--GSGIAMSGGVSLFGLSALLLPGNFESYLML 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
           ++    G ++     F+  + +++H L G+R+L+WD    L K ++    ++    S +T
Sbjct: 103 VKSLCLGPALIHAAKFVLVFPLMYHSLNGVRHLMWD----LGKGLSISQVQL----SGVT 154

Query: 119 VLIVWIIKD 127
           VL++ ++  
Sbjct: 155 VLVLAVLSS 163


>gi|149040637|gb|EDL94594.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_a [Rattus norvegicus]
          Length = 132

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
            +NRP+SPHL IYR    M +S+ HR  GS + +   V +F    +    N E  L  ++
Sbjct: 10  SSNRPVSPHLTIYRWSLPMAMSVCHR--GSGIAMSGGVSLFGLSALLLPGNFESYLMLVK 67

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
               G ++     F+  + +++H L G+R+L+WD+   L 
Sbjct: 68  SLCLGPALIHAAKFVLVFPLMYHSLNGVRHLMWDLGKGLS 107


>gi|153001031|ref|YP_001366712.1| succinate dehydrogenase cytochrome b556 subunit [Shewanella baltica
           OS185]
 gi|151365649|gb|ABS08649.1| Succinate dehydrogenase cytochrome b556 subunit [Shewanella baltica
           OS185]
          Length = 131

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T  VSI+HR++G ++     ++++          + + ++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIVSILHRVSGVIMLFAVGILIWLLNSSLASAESFAGVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASIL 117
              D  V +  L+    A+ +H+ GG+R+L+ D     +       AK    + +  SI+
Sbjct: 66  SLFDNFVMKFILWGIMTALAYHLFGGLRHLVMDTGRWEELSSGAASAKAVFALTVAFSII 125

Query: 118 TVLIVW 123
             + VW
Sbjct: 126 AGIWVW 131


>gi|116199017|ref|XP_001225320.1| hypothetical protein CHGG_07664 [Chaetomium globosum CBS 148.51]
 gi|88178943|gb|EAQ86411.1| hypothetical protein CHGG_07664 [Chaetomium globosum CBS 148.51]
          Length = 188

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 16/107 (14%)

Query: 7   NRPLSPHLQIYRLIPTMF-VSIVHRITGSV----------VYLGTPVVVFWFFCIANGEH 55
           NRP+SPHL +Y    T F  SI  RITGS            YL  P+V  W    A+   
Sbjct: 63  NRPVSPHLDVYDKQQTWFGGSIWMRITGSAFSGSLYVFATAYLAAPLVG-WHLESASLAA 121

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
              +L     G++     FL  W    H + G+R+L++D+++   ++
Sbjct: 122 AFGALPFAAKGAL----KFLAAWPFAFHAINGVRHLLFDMAVGFKRQ 164


>gi|330811091|ref|YP_004355553.1| succinate dehydrogenase (succinate dehydrogenase cytochrome b556
           subunit) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379199|gb|AEA70549.1| Succinate dehydrogenase (Succinate dehydrogenase cytochrome b556
           subunit) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 124

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K+ RP++  L+  +L  T + SI+HRI+G ++++   ++++      + E     ++  
Sbjct: 1   MKSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVSLAIMLYALDKSLDSEEGFGQVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI-IASILTVLI- 121
           +   + ++ ++    A+++H++ G+R+LI D+ +    +     +KI I ++++L VL  
Sbjct: 61  LTSPLAKLVIWGILSALLYHLVAGVRHLIMDMGIGETLEGGKLGSKIIIAVSAVLIVLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|85544667|pdb|2FBW|C Chain C, Avian Respiratory Complex Ii With Carboxin Bound
 gi|85544671|pdb|2FBW|P Chain P, Avian Respiratory Complex Ii With Carboxin Bound
 gi|304445606|pdb|2WQY|C Chain C, Remodelling Of Carboxin Binding To The Q-Site Of Avian
           Respiratory Complex Ii
 gi|304445610|pdb|2WQY|P Chain P, Remodelling Of Carboxin Binding To The Q-Site Of Avian
           Respiratory Complex Ii
          Length = 141

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSLRC- 62
           K++RPLSPH+ IY+    M +SI HR TG  + LG  +  V          H ++ ++  
Sbjct: 18  KSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSVAALLLPEQFPHYVAVVKSL 77

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
            +  ++     F   + + +H   GIR+L+WD+         +Q+ +  ++  ILT+L
Sbjct: 78  SLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFK---LSQVEQSGVVVLILTLL 132


>gi|240848787|ref|NP_001155673.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial-like
           [Acyrthosiphon pisum]
 gi|239788025|dbj|BAH70709.1| ACYPI006695 [Acyrthosiphon pisum]
          Length = 175

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           NRP+SPHL IY+   T  +SI HR TG V   G    +   F   +    L +   ++ G
Sbjct: 55  NRPMSPHLAIYKPQLTTILSITHRGTG-VALSGVTAGLGALFIFTD----LPTFVQFVHG 109

Query: 67  -----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
                +       L  +   +H+  GIR+L+WD   CL  K         I+ S+L
Sbjct: 110 LELPSAAIMSAKGLVAYPFFYHLCNGIRHLVWDAGKCLTIKQVYSTGYGVIVGSLL 165


>gi|320038993|gb|EFW20928.1| succinate dehydrogenase cytochrome b560 subunit [Coccidioides
           posadasii str. Silveira]
          Length = 193

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----SVVYL-GTPVVVFWFFCIANGEHTLSSLR 61
           NRP+SPHL IY+   T  VS + R+TG      +YL GT  VV  +        +L++  
Sbjct: 69  NRPVSPHLSIYKFQITSVVSSLERLTGMMLSGGLYLFGTAYVVSPYLGWDLSSASLAAAF 128

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
             +  +      F   W  + H L G +Y++W     L+ K   Q  
Sbjct: 129 GALPFATKAAAKFSIAWPFLFHCLNGTKYMVWSWGKLLNNKAVIQAG 175


>gi|225713228|gb|ACO12460.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Lepeophtheirus salmonis]
          Length = 173

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 59/123 (47%), Gaps = 9/123 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----SVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           NRPLSPHL IY+   T  +SI HR TG     VVY G    +  F   +N    L SL  
Sbjct: 56  NRPLSPHLTIYKPQLTSMLSITHRGTGIFLTGVVYAGG---LIPFLLPSNFPTFLQSLE- 111

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +  S+  +  F   +    H   GIR+L WD+ + L  +       + +  +++T +I+
Sbjct: 112 -VAPSLILLFKFGIAFPFAFHSWNGIRHLFWDMGIGLKIREVYSSGSLVVALALVTSVIL 170

Query: 123 WII 125
            ++
Sbjct: 171 TVL 173


>gi|222111457|ref|YP_002553721.1| succinate dehydrogenase, cytochrome b556 subunit [Acidovorax ebreus
           TPSY]
 gi|221730901|gb|ACM33721.1| succinate dehydrogenase, cytochrome b556 subunit [Acidovorax ebreus
           TPSY]
          Length = 144

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 62/129 (48%), Gaps = 14/129 (10%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPT------MFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           M+ +   RP   ++  +R +P+        VS +HRI+G +++L  P+V++ F    + E
Sbjct: 1   MTELAKQRPEYRNIHAFRDLPSYRWPLAALVSGMHRISGMIMFLLLPLVIWMFDTSVSSE 60

Query: 55  -------HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQ 106
                     SS   +  G + ++      W  +HH + G+R+L+ D++   + K+    
Sbjct: 61  ISFGKFTSAFSSGLGFAPGWLIKLLTLGLIWGYLHHFIAGLRHLLMDMNHAAVTKEFGKS 120

Query: 107 MAKINIIAS 115
            A + ++AS
Sbjct: 121 SAAVTLVAS 129


>gi|290560974|gb|ADD37889.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           [Lepeophtheirus salmonis]
          Length = 173

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 59/123 (47%), Gaps = 9/123 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----SVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           NRPLSPHL IY+   T  +SI HR TG     VVY G    +  F   +N    L SL  
Sbjct: 56  NRPLSPHLTIYKPQLTSMLSITHRGTGIFLTGVVYAGG---LIPFLLPSNFPTFLQSLE- 111

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +  S+  +  F   +    H   GIR+L WD+ + L  +       + +  +++T +I+
Sbjct: 112 -VAPSLILLFKFGIAFPFAFHSWNGIRHLFWDMGIGLKIREVYSSGSLVVALALVTSVIL 170

Query: 123 WII 125
            ++
Sbjct: 171 TVL 173


>gi|301786725|ref|XP_002928776.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like isoform 1 [Ailuropoda melanoleuca]
          Length = 169

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 9/118 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLRCY 63
           NRPLSPH+ IY     M +SI HR TG  V L   V +F    +    N E  L  ++  
Sbjct: 49  NRPLSPHITIYSWSLPMAMSICHRGTG--VALSAGVSLFGLSALLIPGNFESHLELVKSL 106

Query: 64  MDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             G S+     F   + +++H   GIR+L+WD+   L  KI  Q+ +  +   +LTVL
Sbjct: 107 CLGPSLIYTAKFALVFPLMYHTWNGIRHLVWDLGKGL--KIP-QLYQSGVAVLVLTVL 161


>gi|321470744|gb|EFX81719.1| hypothetical protein DAPPUDRAFT_49817 [Daphnia pulex]
          Length = 169

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            RP+SPHL IY+    M +SI HR TG +   L   + +      A+  H L  L     
Sbjct: 50  QRPISPHLSIYQFQSNMALSITHRFTGLAQNGLMYGLAIGAMVLPASFPHYLGMLEAAHL 109

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
             V     FL  +   +H++ G+R+L+WD    L  K
Sbjct: 110 PLVVLSGKFLIAFPFSYHLINGMRHLVWDTGFNLTIK 146


>gi|15004510|gb|AAK77126.1|AF362730_1 succinate dehydrogenase subunit 3 [Solanum lycopersicum]
 gi|316996003|dbj|BAD83440.2| succinate dehydrogenase subunit 3 [Nicotiana tabacum]
          Length = 108

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 22/114 (19%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHL IY+   T   SI HRI+G+  +L T V  F+  C+  G      L C+   +
Sbjct: 5   RPLSPHLPIYKPQLTSTFSIFHRISGA--FLATIVFFFYLLCLKIG------LICFTYEN 56

Query: 68  VFEVCLFLYTWAVI------------HHMLGGIRYLIWDVSLCLDKKIATQMAK 109
            ++   F Y+  +I            +H+  G+R+L+ D S     +I  +  K
Sbjct: 57  FYQ--FFFYSSKLILISVEITALALSYHLYNGVRHLLTDFSGFFFLRIGRKRLK 108


>gi|293604090|ref|ZP_06686500.1| succinate dehydrogenase cytochrome b558 subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292817514|gb|EFF76585.1| succinate dehydrogenase cytochrome b558 subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 138

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRCYMDGSVFEVCLFL 75
           YRL     +SI+HRI+G +++L  P+V+   F  +     + + +       + ++   +
Sbjct: 24  YRLPLAGKLSILHRISGILLFLCLPLVIVPLFAASVTAPQSFAWIAAIATHPIVKLVFLV 83

Query: 76  YTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
             W  +HH   GIRYL+ D+ + +DK  A + A +
Sbjct: 84  LMWGYLHHFCAGIRYLLLDLHIGIDKLSAKKSAGV 118


>gi|262375851|ref|ZP_06069083.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           lwoffii SH145]
 gi|262309454|gb|EEY90585.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           lwoffii SH145]
          Length = 132

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 68/131 (51%), Gaps = 6/131 (4%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L++    P    SI+HR++G +V+L  PV+++      +    
Sbjct: 1   MPAVKSNRPVNLSMGQVLEVNLKSPVAIASILHRLSGVIVFLLVPVLLWILDKSLSSPEG 60

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            + ++   +G +    ++++   +I H + G+++L+ D+ +  + +     + I +I S 
Sbjct: 61  FAQVQEIFNGFIVRFIVWVFVAGMIFHFIAGVKHLLADIGVAEELESGRVASTIALILSA 120

Query: 117 LTVL--IVWII 125
           + ++   VWI+
Sbjct: 121 IGIVAAFVWIV 131


>gi|294655076|ref|XP_457157.2| DEHA2B04488p [Debaryomyces hansenii CBS767]
 gi|199429671|emb|CAG85151.2| DEHA2B04488p [Debaryomyces hansenii]
          Length = 147

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 46/110 (41%), Gaps = 19/110 (17%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRP SPHL IY+L  TM +S +HR+TG  +  G       F+ +  G    S L    
Sbjct: 22  RKNRPTSPHLTIYQLQLTMVMSGLHRVTGVFMASG-------FYALTCGYAAASILSIPF 74

Query: 65  DGSVF------------EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           D +                      +  ++H   G+R++IWD    L  K
Sbjct: 75  DAATLVGAFAGLPVAVKLAAKAAMAYPFVYHAFNGVRHIIWDFGKELTIK 124


>gi|225713156|gb|ACO12424.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Lepeophtheirus salmonis]
          Length = 173

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----SVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           NRPLSPHL IY+   T  +SI HR TG     VVY G    +  F   +N    L SL  
Sbjct: 56  NRPLSPHLTIYKPQLTSMLSITHRGTGIFLTGVVYAGG---LIPFLLPSNFPTFLQSLE- 111

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
            +  S+  +  F   +    H   GIR+L WD+ + L 
Sbjct: 112 -VAPSLILLFKFGIAFPFAFHSWNGIRHLFWDMGIGLK 148


>gi|239814437|ref|YP_002943347.1| succinate dehydrogenase, cytochrome b556 subunit [Variovorax
           paradoxus S110]
 gi|239801014|gb|ACS18081.1| succinate dehydrogenase, cytochrome b556 subunit [Variovorax
           paradoxus S110]
          Length = 148

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 7/90 (7%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC-------YMDG 66
           L  YRL P   VSI+HR++G +++L  P +++ F    + +++ +  +        ++ G
Sbjct: 24  LTTYRLPPAGIVSILHRVSGVLMFLLLPFIIWMFDTSLSSDYSFARFKAAFNSGLGFVPG 83

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
              ++      WA +HH + G+R+L  DVS
Sbjct: 84  WFIKLVALALIWAYLHHFIAGLRHLWMDVS 113


>gi|330991156|ref|ZP_08315109.1| Succinate dehydrogenase cytochrome b556 subunit [Gluconacetobacter
           sp. SXCC-1]
 gi|329761742|gb|EGG78233.1| Succinate dehydrogenase cytochrome b556 subunit [Gluconacetobacter
           sp. SXCC-1]
          Length = 130

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 56/111 (50%)

Query: 10  LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVF 69
           +SPHLQ+YR   +MF+SI +R  G     G+ + + W    A G  + S ++      + 
Sbjct: 1   MSPHLQVYRFRLSMFLSIANRAAGVAAAGGSALGLCWISAAAKGPKSFSKVQKVTGNPLG 60

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           ++ L  +  A+++H + G+R+L WD      KK   +   + +  ++ T L
Sbjct: 61  QLLLAGWALALVYHFVAGLRHLAWDSGYRFSKKEINEDGPVAVGVTLGTTL 111


>gi|119479383|ref|XP_001259720.1| succinate dehydrogenase cytochrome b560 subunit [Neosartorya
           fischeri NRRL 181]
 gi|119407874|gb|EAW17823.1| succinate dehydrogenase cytochrome b560 subunit [Neosartorya
           fischeri NRRL 181]
          Length = 188

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 19/111 (17%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T   S  HRITG          +  YL  P +  W    A+    
Sbjct: 65  NRPVSPHLSIYRPQITWIGSSAHRITGIALSGSLYLFATAYLAAP-LFGWHLESASIAAA 123

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
             +L       +     F +    ++H L G+R+L+WD    L + I+ Q 
Sbjct: 124 FGALPIAAKVFIKGTAAFPF----VYHCLNGVRHLVWD----LGRGISNQQ 166


>gi|120610878|ref|YP_970556.1| succinate dehydrogenase subunit C [Acidovorax citrulli AAC00-1]
 gi|120589342|gb|ABM32782.1| succinate dehydrogenase subunit C [Acidovorax citrulli AAC00-1]
          Length = 144

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 65/136 (47%), Gaps = 15/136 (11%)

Query: 1   MSSIKNNRPLSPH------LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           M+ I   RP   +      L  YRL    +VSI+HRI+G ++ L  P V++ F    + E
Sbjct: 1   MTEIAKKRPEFRNINALTDLPTYRLPAAGWVSILHRISGVIMLLLLPFVLWMFDTSVSSE 60

Query: 55  HTLSSLRC-------YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL-CLDKKIATQ 106
            +             ++ G   ++ +    WA +HH   G+R+L  DVS   ++K   + 
Sbjct: 61  ISFGKFTSAFTAGLGFVPGWFIKLVVLALIWAYLHHFTAGLRHLWMDVSHDAVNKDFGSM 120

Query: 107 MAKINIIASI-LTVLI 121
            AK  ++ S+ LTV++
Sbjct: 121 SAKATLVISLALTVVL 136


>gi|291336334|gb|ADD95894.1| succinate dehydrogenase cytochrome b556 subunit [uncultured
          marine bacterium MedDCM-OCT-S08-C1068]
          Length = 70

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
          ++N RPLSPH+QIYR   +  VSI HRITG +  +G  ++  W   +  G+   + +  +
Sbjct: 1  MENKRPLSPHIQIYRWHISSLVSISHRITGIINIVGITLICIWVSLLVLGDANYNFINQF 60

Query: 64 MD 65
          ++
Sbjct: 61 LN 62


>gi|326317737|ref|YP_004235409.1| succinate dehydrogenase, cytochrome b556 subunit [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323374573|gb|ADX46842.1| succinate dehydrogenase, cytochrome b556 subunit [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 144

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 65/136 (47%), Gaps = 15/136 (11%)

Query: 1   MSSIKNNRPLSPH------LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           M+ I   RP   +      L  YRL    +VSI+HRI+G ++ L  P V++ F    + E
Sbjct: 1   MTEIAKKRPEFRNINALTDLPTYRLPAAGWVSILHRISGVIMLLLLPFVLWMFDTSVSSE 60

Query: 55  HTLSSLRC-------YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL-CLDKKIATQ 106
            +             ++ G   ++ +    WA +HH   G+R+L  DVS   ++K   + 
Sbjct: 61  ISFGKFTSAFTAGLGFVPGWFIKLVVLALIWAYLHHFTAGLRHLWMDVSHDAVNKHFGSM 120

Query: 107 MAKINIIASI-LTVLI 121
            AK+ +  S+ LTV++
Sbjct: 121 SAKVTLAISLGLTVIL 136


>gi|57013903|ref|YP_173376.1| succinate dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|57013992|ref|YP_173464.1| succinate dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|57014032|ref|YP_173503.1| succinate dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|56806628|dbj|BAD83529.1| succinate dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|56806668|dbj|BAD83569.1| succinate dehydrogenase subunit 3 [Nicotiana tabacum]
          Length = 108

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 22/114 (19%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHL IY+   T   SI HRI+G+  +L T V  F+  C+  G      L C+   +
Sbjct: 5   RPLSPHLPIYKPQLTSTFSISHRISGA--FLATIVFFFYLLCLKIG------LICFTYEN 56

Query: 68  VFEVCLFLYTWAVI------------HHMLGGIRYLIWDVSLCLDKKIATQMAK 109
            ++   F Y+  +I            +H+  G+R+L+ D S     +I  +  K
Sbjct: 57  FYQ--FFFYSSKLILISVEITALALSYHLYNGVRHLLTDFSGFFFLRIGRKRLK 108


>gi|59711426|ref|YP_204202.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio fischeri ES114]
 gi|59479527|gb|AAW85314.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Vibrio fischeri ES114]
          Length = 133

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 63/125 (50%), Gaps = 4/125 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
            +K +RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +    
Sbjct: 9   KVKKSRPVNLDLQTIRFPITAIASILHRVSGVITFVSVGILLWLLNLSLSSPIGFAQAAD 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASILT 118
           Y+DG      ++    A+ +H++ GIR+L+ D+    + +  TQ AK    I  + S+L 
Sbjct: 69  YVDGFFVTFIMWGILTALAYHIVVGIRHLLMDMGYFEELESGTQSAKVAFAITAVLSLLA 128

Query: 119 VLIVW 123
            ++VW
Sbjct: 129 GVLVW 133


>gi|316972827|gb|EFV56474.1| putative succinate dehydrogenase, cytochrome b556 subunit
           [Trichinella spiralis]
          Length = 185

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 10/100 (10%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHL +Y+ + T  VS +HRI+G  V +GT V +F    +A      ++L  Y+  
Sbjct: 62  KRPLSPHLTVYKPMLTWMVSGLHRISG--VVMGTTVALFSIGLMA-APFDFTTLIEYIRN 118

Query: 67  SVFEVCLFLY------TWAVIHHMLGGIRYLIWDVSLCLD 100
               V +F+Y       W +  H L G+R+L +D++   D
Sbjct: 119 LHLPV-VFVYAVKYAIAWPLTFHTLNGVRFLAFDLAKGTD 157


>gi|146307530|ref|YP_001187995.1| succinate dehydrogenase subunit C [Pseudomonas mendocina ymp]
 gi|145575731|gb|ABP85263.1| succinate dehydrogenase subunit C [Pseudomonas mendocina ymp]
          Length = 128

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 56/97 (57%)

Query: 1  MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
          + ++ + RP++  L+  +L  T + SI+HRI+G ++++G  +++F        E   + +
Sbjct: 2  IKAVNSQRPVNLDLRTIKLPITAYTSILHRISGVILFVGIAILLFGLDKSLTSEEGFAQV 61

Query: 61 RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
          +  +   + +  ++    A+++H++ G+R+LI D+ +
Sbjct: 62 KECLTSPLAKFVIWGLLSALLYHLVAGVRHLIMDMGI 98


>gi|309380089|emb|CBX21500.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 125

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 57/117 (48%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP+   L   RL     + ++HRI+G  +++  P ++++     + E    + R  + 
Sbjct: 4   KPRPVYLDLPSIRLPIPGDIFLLHRISGVGLFIMLPFLLYFLSGTLSQESAFETYRAIVS 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLI 121
             + ++ L    WA +HH L GIR+L  D    L+   A   AK+   A+ +LTV++
Sbjct: 64  HPLVKLVLIGVLWAYLHHSLAGIRFLFLDAHKGLELNTARNTAKLVFTAALVLTVVL 120


>gi|39940728|ref|XP_359901.1| hypothetical protein MGG_04876 [Magnaporthe oryzae 70-15]
 gi|145010897|gb|EDJ95553.1| hypothetical protein MGG_04876 [Magnaporthe oryzae 70-15]
          Length = 184

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 16/124 (12%)

Query: 7   NRPLSPHLQIYRLIPT-MFVSIVHRITGSVV----------YLGTPVVVFWFFCIANGEH 55
            RP+SPHLQIY    T +  S+  RITGS++          YL  P+   W     +   
Sbjct: 59  KRPVSPHLQIYDYRQTWLSGSVWQRITGSLLTGGLYVFGAAYLVAPLT-GWHLETTSMAA 117

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
            +++   +  G +     FL  W    H + G+R+L+WD +L  +K    +   +  +  
Sbjct: 118 AVAAWPAFAKGGL----KFLIAWPFTQHAIAGVRHLVWDFALGFNKPTIAKTTNVLWVTG 173

Query: 116 ILTV 119
           IL+ 
Sbjct: 174 ILSA 177


>gi|126174732|ref|YP_001050881.1| succinate dehydrogenase, cytochrome subunit B [Shewanella baltica
           OS155]
 gi|217973009|ref|YP_002357760.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica OS223]
 gi|304409109|ref|ZP_07390730.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica OS183]
 gi|307303112|ref|ZP_07582867.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica BA175]
 gi|125997937|gb|ABN62012.1| succinate dehydrogenase subunit C [Shewanella baltica OS155]
 gi|217498144|gb|ACK46337.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica OS223]
 gi|304352930|gb|EFM17327.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica OS183]
 gi|306913472|gb|EFN43894.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica BA175]
          Length = 131

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 58/126 (46%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T  VSI+HR++G ++     ++++          + + ++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIVSILHRVSGVIMLFAVGILIWLLNSSLASAESFAGVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASIL 117
              D  V +  ++    A+ +H+ GG+R+L+ D     +       AK    + +  SI+
Sbjct: 66  SLFDNFVMKFIMWGIMTALAYHLFGGLRHLVMDTGRWEELSSGAASAKAVFALTVAFSII 125

Query: 118 TVLIVW 123
             + VW
Sbjct: 126 AGIWVW 131


>gi|119572986|gb|EAW52601.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa, isoform CRA_d [Homo sapiens]
          Length = 150

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRPLSPH+ IY     M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 26  NIGSNRPLSPHITIYSWSLPMAMSICHRGTG--IALSAGVSLFGMSALLLPGNFESYLEL 83

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 84  VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 125


>gi|126666300|ref|ZP_01737279.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Marinobacter sp. ELB17]
 gi|126629101|gb|EAZ99719.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Marinobacter sp. ELB17]
          Length = 109

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCL 73
           +Q+YR   T  +S  HR++G  + LG  ++V W    A      + L  ++  ++  + L
Sbjct: 1   MQVYRPQLTSVLSFGHRLSGLFLSLGAVLLVGWLLTAATEAQAFTHLNAWLGSALGLLLL 60

Query: 74  FLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           F++T A+  H+  GIR+L+WD  +  +
Sbjct: 61  FIWTLALFFHLCNGIRHLLWDAVIGFE 87


>gi|149759773|ref|XP_001503815.1| PREDICTED: similar to succinate dehydrogenase complex, subunit C
           [Equus caballus]
          Length = 169

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLS 58
            +I +NRP+SPH+ IY     M +SI HR TG  + L   V +F    +    N E  L 
Sbjct: 44  KNIGSNRPMSPHITIYSWSLPMVMSICHRGTG--IALSAGVSLFGLSALLVPGNFESHLE 101

Query: 59  SLRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
            ++    G ++     F   + +++H   GIR+LIWD+   L 
Sbjct: 102 LVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLIWDLGKGLK 144


>gi|148707185|gb|EDL39132.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_a [Mus musculus]
          Length = 150

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 53/101 (52%), Gaps = 6/101 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRPLSPHL IY+    M +S+ HR  GS + L   V +F    +    N E  L  
Sbjct: 26  NTSSNRPLSPHLTIYKWSLPMALSVCHR--GSGIALSGGVSLFGLSALLLPGNFESYLMF 83

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCL 99
           ++    G ++     F+  + +++H L GIR+L+WD+   L
Sbjct: 84  VKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGL 124


>gi|148707186|gb|EDL39133.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_b [Mus musculus]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRPLSPHL IY+    M +S+ HR  GS + L   V +F    +    N E  L  
Sbjct: 45  NTSSNRPLSPHLTIYKWSLPMALSVCHR--GSGIALSGGVSLFGLSALLLPGNFESYLMF 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           ++    G ++     F+  + +++H L GIR+L+WD+ 
Sbjct: 103 VKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLG 140


>gi|53237071|gb|AAH83091.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein [Mus musculus]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRPLSPHL IY+    M +S+ HR  GS + L   V +F    +    N E  L  
Sbjct: 45  NTSSNRPLSPHLTIYKWSLPMALSVCHR--GSGIALSGGVSLFGLSALLLPGNFESYLMF 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           ++    G ++     F+  + +++H L GIR+L+WD+ 
Sbjct: 103 VKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLG 140


>gi|13543226|gb|AAH05779.1| Sdhc protein [Mus musculus]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRPLSPHL IY+    M +S+ HR  GS + L   V +F    +    N E  L  
Sbjct: 45  NTSSNRPLSPHLTIYKWSLPMALSVCHR--GSGIALSGGVSLFGLSALVLPGNFESYLMF 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           ++    G ++     F+  + +++H L GIR+L+WD+ 
Sbjct: 103 VKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLG 140


>gi|149911925|ref|ZP_01900524.1| succinate dehydrogenase, cytochrome b556 subunit [Moritella sp.
           PE36]
 gi|149805018|gb|EDM65046.1| succinate dehydrogenase, cytochrome b556 subunit [Moritella sp.
           PE36]
          Length = 128

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 61/124 (49%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ   +  T   SI+HRI+G ++     ++++      + E    + +  
Sbjct: 5   VKKQRPVNLDLQTIDMPITAIASILHRISGVIMLFAVGILLWLLAESLSSEQGFQNAQEI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTV 119
           + G      L+    A+ +H+ GGIR+L+ D+    + +     AK++ +A    SIL  
Sbjct: 65  VSGFFGTFILWGILTALAYHIAGGIRHLLMDMGYFEELESGALSAKVSFVATVVLSILAG 124

Query: 120 LIVW 123
           ++VW
Sbjct: 125 IMVW 128


>gi|315052622|ref|XP_003175685.1| succinate dehydrogenase cytochrome B subunit [Arthroderma gypseum
           CBS 118893]
 gi|311341000|gb|EFR00203.1| succinate dehydrogenase cytochrome B subunit [Arthroderma gypseum
           CBS 118893]
          Length = 192

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 15/116 (12%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVV----------YLGTPVVVFWFFCI 50
           ++S + NRP++PHL IY+   T   S + RITG+V+          YL +P +  W    
Sbjct: 70  LASQRLNRPIAPHLSIYKWQVTSVNSSLQRITGAVLSGSLYLFAVSYLASPYLG-WDLSS 128

Query: 51  ANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQ 106
            +    ++SL      +V     F+  W  + H+   +R+L WD+      K  +Q
Sbjct: 129 DSLSAAMASLPWAGKATV----KFVIAWPFMFHVFNSLRHLAWDIGKGFAMKTVSQ 180


>gi|50308981|ref|XP_454496.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643631|emb|CAG99583.1| KLLA0E12123p [Kluyveromyces lactis]
          Length = 181

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 62/136 (45%), Gaps = 22/136 (16%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           S +  RP+SPHL IY+   T ++S VHR++G  V+LG   + F+   IA G  T+  L  
Sbjct: 53  SQRKVRPVSPHLTIYQPQLTWYLSSVHRVSG--VFLG---LAFYAVTIAFGVSTVFGLGM 107

Query: 63  YMDG-------------SVFEVCLFLYTWAVIHHMLGGIRYLIWDV--SLCLDKKIATQM 107
             +               +     F Y +A   H   GIR+LIWD    L L     T  
Sbjct: 108 STENLVQFYNEKIPSWIDLTAKAGFAYLFAF--HFGNGIRHLIWDTGKELTLKGVYRTGY 165

Query: 108 AKINIIASILTVLIVW 123
           A + + A + + L+ W
Sbjct: 166 AVLGLTAIMGSYLLTW 181


>gi|294676288|ref|YP_003576903.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter
           capsulatus SB 1003]
 gi|294475108|gb|ADE84496.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter
           capsulatus SB 1003]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 2/111 (1%)

Query: 7   NRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
            RPLSP +    YR   T   SI+ RITG+ +  G  +  +W     +       +   +
Sbjct: 8   ERPLSPFMIGPYYRPQMTSMSSILTRITGNALIAGFLLGAWWLIAAVSSPGYFGFVNWIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
              +  +      WA+ +H L G+R+L+WD    LD + A ++    II S
Sbjct: 68  TSWLGWLIFAGMAWAMWYHYLTGLRHLLWDTGKGLDIETAEKLGWGAIIGS 118


>gi|228008307|ref|NP_079597.2| succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Mus musculus]
 gi|21362402|sp|Q9CZB0|C560_MOUSE RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; AltName: Full=Integral membrane protein
           CII-3; AltName: Full=QPs-1; Short=QPs1; Flags: Precursor
 gi|12849813|dbj|BAB28491.1| unnamed protein product [Mus musculus]
 gi|26328275|dbj|BAC27878.1| unnamed protein product [Mus musculus]
 gi|74183258|dbj|BAE22557.1| unnamed protein product [Mus musculus]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRPLSPHL IY+    M +S+ HR  GS + L   V +F    +    N E  L  
Sbjct: 45  NTSSNRPLSPHLTIYKWSLPMALSVCHR--GSGIALSGGVSLFGLSALLLPGNFESYLMF 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           ++    G ++     F+  + +++H L GIR+L+WD+ 
Sbjct: 103 VKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLG 140


>gi|70997878|ref|XP_753671.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           fumigatus Af293]
 gi|66851307|gb|EAL91633.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           fumigatus Af293]
 gi|159126596|gb|EDP51712.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           fumigatus A1163]
          Length = 208

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 19/111 (17%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T   S  HRITG          +  YL  P +  W    A+    
Sbjct: 85  NRPVSPHLSIYRPQITWIGSSAHRITGIALSGSLYLFATAYLAAP-LFGWHLESASIAAA 143

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
             +L       +     F +    ++H L G+R+L+WD    L + I+ Q 
Sbjct: 144 FGALPIAAKVLIKGTAAFPF----VYHCLNGVRHLVWD----LGRGISNQQ 186


>gi|71064679|ref|YP_263406.1| succinate dehydrogenase subunit C [Psychrobacter arcticus 273-4]
 gi|71037664|gb|AAZ17972.1| succinate dehydrogenase subunit C [Psychrobacter arcticus 273-4]
          Length = 128

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 69/130 (53%), Gaps = 8/130 (6%)

Query: 1   MSSIKNNRPLS-PHLQIYRL--IPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL 57
           M ++K+NRP+  P  Q+  +   P    SI+HRI+G V++L  PV++   + + N   + 
Sbjct: 1   MPAVKSNRPIDLPLSQVISVNRSPIAIASILHRISGIVLFLLIPVML---WLLQNSLASP 57

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASI 116
            S     D  +     +++  A+ +H + G+++L  D+ +  + K     + I+ +IA+I
Sbjct: 58  ESFETVFDNVLVRFLAWIFVAAIAYHFVMGMKHLFADMGMNEELKSGRAASMISFVIAAI 117

Query: 117 LTVL-IVWII 125
           L V   VW++
Sbjct: 118 LIVASFVWVM 127


>gi|12832459|dbj|BAB22116.1| unnamed protein product [Mus musculus]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRPLSPHL IY+    M +S+ HR  GS + L   V +F    +    N E  L  
Sbjct: 45  NTSSNRPLSPHLTIYKWSLPMALSVCHR--GSGIALSGGVSLFGLSALLLPGNFESYLMF 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           ++    G ++     F+  + +++H L GIR+L+WD+ 
Sbjct: 103 VKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLG 140


>gi|119572987|gb|EAW52602.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa, isoform CRA_e [Homo sapiens]
          Length = 156

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRPLSPH+ IY     M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 32  NIGSNRPLSPHITIYSWSLPMAMSICHRGTG--IALSAGVSLFGMSALLLPGNFESYLEL 89

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 90  VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 131


>gi|71908478|ref|YP_286065.1| succinate dehydrogenase subunit C [Dechloromonas aromatica RCB]
 gi|71848099|gb|AAZ47595.1| succinate dehydrogenase subunit C [Dechloromonas aromatica RCB]
          Length = 129

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP +  L   RL     VSI+HR++G  ++L  P++++ F        + S ++    
Sbjct: 7   KKRPKNLDLTTIRLPLPGKVSILHRVSGVGLFLCLPLLLWLFGASLASPESFSGIKAIAG 66

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI-LTVLIVW 123
             + +V L    WA +HH   GIR+L+ D+ + ++K+ A + A + +  S+ L+ +++W
Sbjct: 67  MFLVKVILAGLIWAFMHHFCAGIRFLLLDLHVGIEKEAARKSAGVVLAVSLPLSAILIW 125


>gi|332219327|ref|XP_003258808.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like isoform 1 [Nomascus leucogenys]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRPLSPH+ IY     M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 45  NIGSNRPLSPHITIYSWSLPMAMSICHRGTG--IALSAGVSLFGMSALLLPGNFESYLEL 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 103 VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLVWDLGKGLK 144


>gi|322794003|gb|EFZ17241.1| hypothetical protein SINV_07470 [Solenopsis invicta]
          Length = 148

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 22/112 (19%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL---SS 59
           +++  RPLSPHL IY++  T  +SI HR TG         ++   + +  G  TL     
Sbjct: 24  NMRLKRPLSPHLSIYQVQLTTVLSITHRTTG---------IMLASYAMFLGLGTLFIPGG 74

Query: 60  LRCYMDGSVFEVCL---------FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           + C+++ +V  +CL          L      +H+  GIR+L WD+ + L  K
Sbjct: 75  IPCFIE-TVDNLCLPLPVLFAGKTLLALPATYHLFNGIRHLAWDLGMFLSIK 125


>gi|296818369|ref|XP_002849521.1| succinate dehydrogenase cytochrome b560 subunit [Arthroderma otae
           CBS 113480]
 gi|238839974|gb|EEQ29636.1| succinate dehydrogenase cytochrome b560 subunit [Arthroderma otae
           CBS 113480]
          Length = 197

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSV----VYL-GTPVVVFWFFCIANGEHTLSSLR 61
            RPLSPHL IY+   T   S + RITG V    +YL G   +   +F       +LS+  
Sbjct: 73  KRPLSPHLAIYKWQVTSVNSSLQRITGVVLSGGLYLFGISYLASSYFGWGLSSESLSAAM 132

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
             +  S      F+  W ++ H    +R+L WD+      K   Q   ++   SI+
Sbjct: 133 ASLPWSGKAAVKFVIAWPLMFHTFNNLRHLAWDMGKGFAMKTVCQTGYLSAGMSII 188


>gi|121605923|ref|YP_983252.1| succinate dehydrogenase, cytochrome b subunit [Polaromonas
           naphthalenivorans CJ2]
 gi|120594892|gb|ABM38331.1| succinate dehydrogenase subunit C [Polaromonas naphthalenivorans
           CJ2]
          Length = 148

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 8/108 (7%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD-------GSVF 69
           YRL     VSI+HRI+G +++L  P +++ F    + E +    +   +       G ++
Sbjct: 27  YRLPLAGLVSILHRISGFIMFLLMPFIIWMFDTSISSEISFDRFKAAFNVGMLGVPGILW 86

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASI 116
           ++      WA +HH L G+R+L  D S   + K    Q A   +  SI
Sbjct: 87  KLVALALIWAYLHHFLAGLRHLWMDASHEAVSKDFGRQSAAFTLAVSI 134


>gi|299470359|emb|CBN78408.1| SDH3, succinate dehydrogenase subunit 3 [Ectocarpus siliculosus]
          Length = 176

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RP+SPH+ IY   P    SI +R+TG  +  G   +        +    +S+L    
Sbjct: 58  RTGRPVSPHVTIYDFPPAALSSIANRVTGVALVAGLYGISGATLVGCDAAGLMSALGSSG 117

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
            G   ++ +   ++ +++H LG +R+ +WD
Sbjct: 118 VGPAVKLAV---SFPLVYHYLGAVRHTVWD 144


>gi|149191108|ref|ZP_01869367.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio shilonii AK1]
 gi|148835036|gb|EDL52014.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio shilonii AK1]
          Length = 126

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +     +
Sbjct: 4   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVSIGILLWLLSKSLSSPIGFAEAADIV 63

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H++GG+R+LI D+    + +  T+ AK+  I     S+L  +
Sbjct: 64  DGFFVKFILWGILTALAYHIVGGVRHLIMDLGYFEELESGTKSAKVAFIVTGVLSLLAGV 123

Query: 121 IVW 123
           +VW
Sbjct: 124 LVW 126


>gi|323529177|ref|YP_004231329.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1001]
 gi|323386179|gb|ADX58269.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1001]
          Length = 138

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G ++++  P +++ F      E 
Sbjct: 3   EAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRVSGGLLFVALPFLLYLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMA-KINII 113
           +    + +    + ++ + +  WA + H   G+R+L+ D +   + K+   Q +  + ++
Sbjct: 63  SFEGFKGFFSNLIVKLIVLVLAWAYMFHFCAGVRHLLMDTNHEAVTKEKGKQTSIVVFVV 122

Query: 114 ASILTV 119
           +S+LT+
Sbjct: 123 SSLLTL 128


>gi|307130093|ref|YP_003882109.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Dickeya dadantii 3937]
 gi|306527622|gb|ADM97552.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Dickeya dadantii 3937]
          Length = 129

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 64/127 (50%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            S+K  RP++  LQ  +   T   SI+HR++G + ++   ++++      + +   +   
Sbjct: 3   KSVKKQRPVNLDLQTIQFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFAQAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA-TQMAK----INIIASI 116
             MD  + +  ++    A+ +H++GG+R+L+ D     +   A ++ AK    I ++ S 
Sbjct: 63  AIMDSFIVKFIVWGILTALAYHIVGGLRHLLMDFGYIEENFAAGSRSAKLSFIITVVLSF 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|302381553|ref|YP_003817376.1| succinate dehydrogenase, cytochrome b556 subunit [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192181|gb|ADK99752.1| succinate dehydrogenase, cytochrome b556 subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 144

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQ +R   TM  SI+ R T   + +G  + V W   +A G    +S    + GS
Sbjct: 18  RPLSPHLQTWRWHITMTASILFRFTIGAISVGALIGVAWLAAVAFGPAAYAS-ALGLAGS 76

Query: 68  VFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
            F + + F  T  +   +L G R+LI D    L  K A  ++ I +   +
Sbjct: 77  WFGLIVGFGLTVVLFSLLLNGGRHLINDTGRGLTIKSADLLSNIAVYGPV 126


>gi|239993980|ref|ZP_04714504.1| succinate dehydrogenase, cytochrome b subunit [Alteromonas
           macleodii ATCC 27126]
          Length = 124

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 59/126 (46%), Gaps = 8/126 (6%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L   +  P+   SI+HR+TG  ++     V++ +    +     + ++  
Sbjct: 1   MKKQRPVNLELNTIKFPPSAISSILHRVTGVAMFFALLFVIWAWAVSVHSPEGFADVQAI 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           MDG   +        A+ +H+LGG+R+++ D+    + +     AK         V+ +W
Sbjct: 61  MDGFFGKFVAIGTASALTYHILGGLRHVVMDLGHWEELESGNTSAK--------AVIALW 112

Query: 124 IIKDIV 129
           ++  +V
Sbjct: 113 VVLTVV 118


>gi|91077182|ref|XP_972413.1| PREDICTED: similar to succinate dehydrogenase [Tribolium castaneum]
 gi|270002816|gb|EEZ99263.1| hypothetical protein TcasGA2_TC000992 [Tribolium castaneum]
          Length = 173

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 10/106 (9%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSV-----VYLGTPVVVFWFFCIANGEHTL 57
           +++  RP SPHL IY    T  +SI HR TG +     +  GT  VV          H L
Sbjct: 49  NMQLGRPQSPHLTIYSFQLTSMLSITHRATGMMLAGYAIMWGTGAVVLPDTI----PHYL 104

Query: 58  SSL-RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            +L + ++ G V  +  F+  + + +H   GIR+L WD+   L  K
Sbjct: 105 DALQQAHVGGFVLSMGKFMLAFPMCYHFWNGIRHLAWDLGRFLTIK 150


>gi|325089641|gb|EGC42951.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           capsulatus H88]
          Length = 194

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 59/123 (47%), Gaps = 9/123 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEHTLSSLRCY 63
           NRP+SPH+ IYR   T  +S++HR TG  + L  P  +F+    A+   G H  S+    
Sbjct: 64  NRPVSPHISIYRPQITSVLSLLHRNTG--LLLSGPFYLFFAAYAASPWLGWHIDSTSMAA 121

Query: 64  MDG--SVFEVCLFLYTWAV--IHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
             G   V    L   T A+    H + G+R+L+WD+      K   +  +  I  SI + 
Sbjct: 122 SFGILPVAAKVLLKTTAALPFTFHCINGVRHLVWDLGRGFSNKQVAKSGRTVIGLSISSA 181

Query: 120 LIV 122
           L++
Sbjct: 182 LLL 184


>gi|154281033|ref|XP_001541329.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150411508|gb|EDN06896.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 226

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 10/123 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEHTLSSLRCY 63
           NRP+SPH+ IY+   T  +S++HR TG    L  P  +F+    A+   G H  S+    
Sbjct: 81  NRPVSPHISIYQPQITSVLSLLHRNTG---LLSGPFYLFFAAYAASPWLGWHIDSTSMAA 137

Query: 64  MDGSV-FEVCLFLYTWAVIH---HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
             G++     + L T A +    H + G+R+L+WD+      K  T+  +  I  SI + 
Sbjct: 138 SFGTLPVAAKVLLKTTAALPFTFHCINGVRHLVWDLGRGFSNKQVTKSGRTVIGLSISSA 197

Query: 120 LIV 122
           L++
Sbjct: 198 LLL 200


>gi|262276218|ref|ZP_06054027.1| succinate dehydrogenase cytochrome b-556 subunit [Grimontia
           hollisae CIP 101886]
 gi|262220026|gb|EEY71342.1| succinate dehydrogenase cytochrome b-556 subunit [Grimontia
           hollisae CIP 101886]
          Length = 130

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K +RP++  LQ  R   T   SI HR++G + ++   ++++      +      +    
Sbjct: 7   VKKSRPVNLDLQTIRFPITAIASITHRVSGVITFISVAILLWLLSLSLSSPSGFEAASDI 66

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTVL-- 120
           ++    +  L+    A+ +H++GGIR+L+ D+    + +  +Q AK+  II ++L+VL  
Sbjct: 67  VNSFFAKFVLWGILTALAYHIVGGIRHLLMDMGHFEELESGSQSAKVGFIITAVLSVLAG 126

Query: 121 -IVW 123
            +VW
Sbjct: 127 ILVW 130


>gi|307726616|ref|YP_003909829.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1003]
 gi|307587141|gb|ADN60538.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1003]
          Length = 138

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G ++++  P +++ F      E 
Sbjct: 3   EAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRVSGGLLFVALPFLLYLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMA-KINII 113
           +    + +    + ++ + +  WA + H   G+R+L+ D +   + K+   Q +  + ++
Sbjct: 63  SFEGFKAFFSNIIVKLIVLVLGWAYMFHFCAGVRHLLMDTNHEAVTKEKGRQTSIVVFVV 122

Query: 114 ASILTV 119
           +S+LT+
Sbjct: 123 SSLLTL 128


>gi|283135232|ref|NP_001164371.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           [Nasonia vitripennis]
          Length = 175

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 51/104 (49%), Gaps = 16/104 (15%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY-------LGTPVVVFWFFCI--AN 52
            +++  RPLSPHL IY+L  T  +S+ HR TG V+        LGT  V     C+  A 
Sbjct: 50  KNMRLKRPLSPHLTIYQLQLTSMLSVTHRGTGIVLSSYAMILGLGTLFVPGGVPCMVQAI 109

Query: 53  GEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
               L S   Y+  ++F        + + +H L GIR+L WD+ 
Sbjct: 110 AAWGLPSAVLYLGKAMF-------VYPLTYHYLNGIRHLAWDLG 146


>gi|294787718|ref|ZP_06752962.1| succinate dehydrogenase, cytochrome b556 subunit [Simonsiella
           muelleri ATCC 29453]
 gi|294484011|gb|EFG31694.1| succinate dehydrogenase, cytochrome b556 subunit [Simonsiella
           muelleri ATCC 29453]
          Length = 133

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 51/98 (52%)

Query: 25  VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHM 84
           VSI+HR TG  ++L  P ++       +        + + D    ++ L+   WA IHH+
Sbjct: 31  VSILHRATGVALFLLLPFLLALLSGSRSSGEDFEYYKAWADNWFIKLILWGVLWAFIHHL 90

Query: 85  LGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
             GIR+LI D  +  D + A + A+I +IA+ +T  ++
Sbjct: 91  FAGIRFLIIDAHIGTDLQTARKSARIVLIAAAVTAFVL 128


>gi|212535344|ref|XP_002147828.1| succinate dehydrogenase cytochrome b560 subunit [Penicillium
           marneffei ATCC 18224]
 gi|210070227|gb|EEA24317.1| succinate dehydrogenase cytochrome b560 subunit [Penicillium
           marneffei ATCC 18224]
          Length = 186

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 7/102 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSLRCYM 64
            RP+SPHL IYR   T + S +HRITGS    G        + +A   G H  S+     
Sbjct: 63  KRPVSPHLSIYRPQITWYASALHRITGSAAS-GALYAFAAAYLVAPVFGWHLESASIAAA 121

Query: 65  DGSV-FEVCLFLY---TWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G++ F    F+         +H + G+R+LIWD    L  K
Sbjct: 122 FGALPFAAKFFVKLGLAMPFTYHCINGVRHLIWDTGRLLTNK 163


>gi|48146321|emb|CAG33383.1| SDHC [Homo sapiens]
          Length = 169

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRPLSPH+ IY     M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 45  NIGSNRPLSPHITIYSWSLPMAMSICHRGTG--IALSAGVSLFGMSALLLPGNFESYLEL 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 103 VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 144


>gi|93004938|ref|YP_579375.1| succinate dehydrogenase, cytochrome b subunit [Psychrobacter
           cryohalolentis K5]
 gi|92392616|gb|ABE73891.1| succinate dehydrogenase subunit C [Psychrobacter cryohalolentis K5]
          Length = 128

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 69/130 (53%), Gaps = 8/130 (6%)

Query: 1   MSSIKNNRPLS-PHLQIYRL--IPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL 57
           M ++K+NRP+  P  Q+  +   P    SI+HRI+G +++L  PV++   + + N   + 
Sbjct: 1   MPAVKSNRPIDLPLSQVISVNRSPIAIASILHRISGIILFLLIPVML---WLLQNSLASP 57

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASI 116
            S     D  +     +++  A+ +H + G+++L  D+ +  + K     + I+ +IA+I
Sbjct: 58  ESFETVFDNVLVRFLAWIFVAAIAYHFVMGMKHLFADMGMNEELKSGRAASMISFVIAAI 117

Query: 117 LTVL-IVWII 125
           L V   VW++
Sbjct: 118 LIVASFVWVM 127


>gi|121595114|ref|YP_987010.1| succinate dehydrogenase subunit C [Acidovorax sp. JS42]
 gi|120607194|gb|ABM42934.1| succinate dehydrogenase subunit C [Acidovorax sp. JS42]
          Length = 144

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 14/136 (10%)

Query: 1   MSSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           M+ +   RP   ++ I      YRL    +VSI+HR +G +++L  P V++ F    + E
Sbjct: 1   MTELAKKRPEYRNINIFNDVRTYRLPAAGWVSILHRASGMIMFLLLPFVLWMFDTSVSSE 60

Query: 55  HTLSSLRC-------YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQ 106
            +             ++ G   ++      WA +HH + G+R+L  DVS   + K+    
Sbjct: 61  ISFGRFTSAFTAGLGFVPGWFVKLVALALIWAYLHHFIAGLRHLWMDVSHEAVSKEFGKS 120

Query: 107 MAKINIIASILTVLIV 122
            A + ++ SI   L++
Sbjct: 121 SAIVTLVLSIGLTLVL 136


>gi|145299317|ref|YP_001142158.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852089|gb|ABO90410.1| succinate dehydrogenase cytochrome b556 subunit [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 129

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 65/127 (51%), Gaps = 5/127 (3%)

Query: 2   SSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
            ++KN  RP++  LQ      T   SI+HR++G + ++   ++++             ++
Sbjct: 3   KAVKNKQRPVNLDLQTISFPVTAIASILHRVSGVITFVALSILLWMLGTSLASPEGFETV 62

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTV 119
              MD  + +  L+    A+ +H++GG+R+L+ D+    + +   Q A++  +I +IL V
Sbjct: 63  VSIMDNFLVKFVLWGILTALAYHIVGGLRHLVMDMGYWEELESGNQSARVAFVITAILAV 122

Query: 120 L---IVW 123
           L   +VW
Sbjct: 123 LAGVLVW 129


>gi|16759671|ref|NP_455288.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|16764102|ref|NP_459717.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|29142556|ref|NP_805898.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56414151|ref|YP_151226.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|62179307|ref|YP_215724.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|197363073|ref|YP_002142710.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|205351996|ref|YP_002225797.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|207856176|ref|YP_002242827.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224582547|ref|YP_002636345.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|54036973|sp|P63726|DHSC_SALTI RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|54040872|sp|P63725|DHSC_SALTY RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|25284651|pir||AH0590 succinate dehydrogenase cytochrome b-556 chain [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16419242|gb|AAL19676.1| succinate dehydrogenase, cytochrome b556 [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16501964|emb|CAD05194.1| succinate dehydrogenase cytochrome b-556 subunit [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29138187|gb|AAO69758.1| succinate dehydrogenase cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56128408|gb|AAV77914.1| succinate dehydrogenase cytochrome b-556 subunit [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62126940|gb|AAX64643.1| succinate dehydrogenase, cytochrome b556 [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|197094550|emb|CAR60070.1| succinate dehydrogenase cytochrome b-556 subunit [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|205271777|emb|CAR36611.1| succinate dehydrogenase cytochrome b-556 subunit [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|206707979|emb|CAR32268.1| succinate dehydrogenase cytochrome b-556 subunit [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|224467074|gb|ACN44904.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261245995|emb|CBG23797.1| succinate dehydrogenase cytochrome b-556 subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267992470|gb|ACY87355.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|301157323|emb|CBW16812.1| succinate dehydrogenase cytochrome b-556 subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|322713775|gb|EFZ05346.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323129042|gb|ADX16472.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|326622456|gb|EGE28801.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|326627036|gb|EGE33379.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
 gi|332987669|gb|AEF06652.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 129

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +          
Sbjct: 4   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILLWLLGTSLSSPEGFQQAAD 63

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK-----INIIASIL 117
            MDG + +  ++    A+ +H++ GIR+++ D     +   A Q +      I ++ S+L
Sbjct: 64  IMDGFIVKFIMWGILTALAYHVIVGIRHMLMDFGYLEETFEAGQRSAKISFVITVVLSLL 123

Query: 118 TVLIVW 123
             ++VW
Sbjct: 124 AGVLVW 129


>gi|240279376|gb|EER42881.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           capsulatus H143]
          Length = 188

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 59/123 (47%), Gaps = 9/123 (7%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEHTLSSLRCY 63
           NRP+SPH+ IYR   T  +S++HR TG  + L  P  +F+    A+   G H  S+    
Sbjct: 58  NRPVSPHISIYRPQITSVLSLLHRNTG--LLLSGPFYLFFAAYAASPWLGWHIDSTSMAA 115

Query: 64  MDG--SVFEVCLFLYTWAV--IHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
             G   V    L   T A+    H + G+R+L+WD+      K   +  +  I  SI + 
Sbjct: 116 SFGILPVAAKVLLKTTAALPFTFHCINGVRHLVWDLGRGFSNKQVAKSGRTVIGLSISSA 175

Query: 120 LIV 122
           L++
Sbjct: 176 LLL 178


>gi|126311342|ref|XP_001381718.1| PREDICTED: similar to QPS1 [Monodelphis domestica]
          Length = 264

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +  +NRPLSPH+ IY     M +SI HR +G  +  G  V +F    +    N E  +  
Sbjct: 140 NTNSNRPLSPHITIYSWSLPMAMSICHRASGIALSAG--VSLFGLAALLLPGNFESHVEL 197

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
           L+    G ++     F     +++H   GIR+L WD+ + L  KI  Q+ +  ++   LT
Sbjct: 198 LKSLSLGPALIHTAKFALVSPLMYHTWNGIRHLTWDLGMGL--KI-PQLYQSGVVVLALT 254

Query: 119 VL 120
           VL
Sbjct: 255 VL 256


>gi|307203720|gb|EFN82680.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           [Harpegnathos saltator]
          Length = 140

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG----EHTLS 58
           +++  RP+SPHL IY       +SI HR TG ++      +     CI  G       L+
Sbjct: 16  NMRLKRPMSPHLTIYEFPLPAMLSITHRTTGIILSSYAMFLGLGTLCIPGGIPCAIEILN 75

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            L  Y+   +  V   L    +  H+L GIR+L WD+ + L  K
Sbjct: 76  DL--YIPSLILFVGKTLLALPITFHILNGIRHLAWDLGMFLKIK 117


>gi|85544002|pdb|1YQ3|C Chain C, Avian Respiratory Complex Ii With Oxaloacetate And
           Ubiquinone
 gi|85544006|pdb|1YQ4|C Chain C, Avian Respiratory Complex Ii With 3-Nitropropionate And
           Ubiquinone
          Length = 141

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRC- 62
           K++RPLSPH+ IY+    M +SI HR TG  + LG  +       +     H ++ ++  
Sbjct: 18  KSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSLAALLLPEQFPHYVAVVKSL 77

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
            +  ++     F   + + +H   GIR+L+WD+         +Q+ +  ++  ILT+L
Sbjct: 78  SLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFK---LSQVEQSGVVVLILTLL 132


>gi|4506863|ref|NP_002992.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           isoform 1 precursor [Homo sapiens]
 gi|5915811|sp|Q99643|C560_HUMAN RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; AltName: Full=Integral membrane protein
           CII-3; AltName: Full=QPs-1; Short=QPs1; AltName:
           Full=Succinate dehydrogenase complex subunit C; AltName:
           Full=Succinate-ubiquinone oxidoreductase cytochrome B
           large subunit; Short=CYBL; Flags: Precursor
 gi|1814226|gb|AAB41838.1| integral membrane protein CII-3 [Homo sapiens]
 gi|3366669|gb|AAC27993.1| succinate dehydrogenase subunit C [Homo sapiens]
 gi|3370989|dbj|BAA31998.1| cytochrome b large subunit of complex II [Homo sapiens]
 gi|18088742|gb|AAH20808.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Homo sapiens]
 gi|21708000|gb|AAH33626.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Homo sapiens]
 gi|42542834|gb|AAH66329.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Homo sapiens]
 gi|55665931|emb|CAH70271.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Homo sapiens]
 gi|119572985|gb|EAW52600.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa, isoform CRA_c [Homo sapiens]
          Length = 169

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRPLSPH+ IY     M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 45  NIGSNRPLSPHITIYSWSLPMAMSICHRGTG--IALSAGVSLFGMSALLLPGNFESYLEL 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 103 VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 144


>gi|170691023|ref|ZP_02882189.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           graminis C4D1M]
 gi|170144272|gb|EDT12434.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           graminis C4D1M]
          Length = 138

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G ++++  P +++ F      E 
Sbjct: 3   EAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRLSGGLLFVALPFLLYLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMA-KINII 113
           +    + ++   + ++   +  WA + H   G+R+L+ D +   + K+   Q +  + ++
Sbjct: 63  SFEVFKGFLSNLIVKLITLVLAWAYLFHFCAGVRHLLMDTNHEAVTKEKGKQTSIVVFVV 122

Query: 114 ASILTV 119
           +S+LT+
Sbjct: 123 SSLLTI 128


>gi|110590576|pdb|2H88|C Chain C, Avian Mitochondrial Respiratory Complex Ii At 1.8 Angstrom
           Resolution
 gi|110590580|pdb|2H88|P Chain P, Avian Mitochondrial Respiratory Complex Ii At 1.8 Angstrom
           Resolution
 gi|110590584|pdb|2H89|C Chain C, Avian Respiratory Complex Ii With Malonate Bound
          Length = 140

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRC- 62
           K++RPLSPH+ IY+    M +SI HR TG  + LG  +       +     H ++ ++  
Sbjct: 18  KSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSLAALLLPEQFPHYVAVVKSL 77

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
            +  ++     F   + + +H   GIR+L+WD+         +Q+ +  ++  ILT+L
Sbjct: 78  SLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFK---LSQVEQSGVVVLILTLL 132


>gi|323529267|ref|YP_004231419.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1001]
 gi|323386269|gb|ADX58359.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1001]
          Length = 138

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G ++++  P +++ F      E 
Sbjct: 3   ETLKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRVSGGLLFVALPFLLYLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMA-KINII 113
           +    + +    + ++ + +  WA + H   G+R+L+ D +   + K+   Q +  + ++
Sbjct: 63  SFEGFKGFFSNLIVKLIVLVLAWAYMFHFCAGVRHLLMDTNHEAVTKEKGKQTSIVVFVV 122

Query: 114 ASILTV 119
           +S+LT+
Sbjct: 123 SSLLTL 128


>gi|161615042|ref|YP_001589007.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|167552850|ref|ZP_02346601.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|167993008|ref|ZP_02574103.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168230610|ref|ZP_02655668.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238875|ref|ZP_02663933.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168240583|ref|ZP_02665515.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168264335|ref|ZP_02686308.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168467712|ref|ZP_02701549.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168820140|ref|ZP_02832140.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194444043|ref|YP_002039969.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194451536|ref|YP_002044762.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194470195|ref|ZP_03076179.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737993|ref|YP_002113838.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197248270|ref|YP_002145690.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197265498|ref|ZP_03165572.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198243969|ref|YP_002214700.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200390971|ref|ZP_03217582.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204930001|ref|ZP_03221022.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|213021698|ref|ZP_03336145.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           404ty]
 gi|213053349|ref|ZP_03346227.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213425381|ref|ZP_03358131.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E02-1180]
 gi|213581387|ref|ZP_03363213.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213615564|ref|ZP_03371390.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
 gi|213851935|ref|ZP_03381467.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|238911662|ref|ZP_04655499.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|161364406|gb|ABX68174.1| hypothetical protein SPAB_02802 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402706|gb|ACF62928.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194409840|gb|ACF70059.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194456559|gb|EDX45398.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194713495|gb|ACF92716.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195629175|gb|EDX48543.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197211973|gb|ACH49370.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197243753|gb|EDY26373.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197288360|gb|EDY27741.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197938485|gb|ACH75818.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199603416|gb|EDZ01962.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204320995|gb|EDZ06196.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205322576|gb|EDZ10415.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205328915|gb|EDZ15679.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334896|gb|EDZ21660.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339890|gb|EDZ26654.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205343208|gb|EDZ29972.1| succinate dehydrogenase,  cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205347161|gb|EDZ33792.1| succinate dehydrogenase, cytochrome b556 subunit [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|312911758|dbj|BAJ35732.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320085000|emb|CBY94789.1| succinate dehydrogenase, cytochrome b556 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322615835|gb|EFY12753.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322621231|gb|EFY18088.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322623651|gb|EFY20489.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322628923|gb|EFY25703.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322634903|gb|EFY31633.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322636569|gb|EFY33273.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322641778|gb|EFY38411.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322647810|gb|EFY44290.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322651860|gb|EFY48229.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322652643|gb|EFY48992.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322658451|gb|EFY54714.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322664946|gb|EFY61137.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322668384|gb|EFY64540.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322670528|gb|EFY66661.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322675268|gb|EFY71344.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322679694|gb|EFY75735.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322684830|gb|EFY80829.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|323193148|gb|EFZ78367.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323200599|gb|EFZ85674.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323202271|gb|EFZ87319.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323205462|gb|EFZ90428.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323213499|gb|EFZ98292.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323215333|gb|EGA00078.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323220913|gb|EGA05347.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323228078|gb|EGA12214.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323231016|gb|EGA15132.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323234151|gb|EGA18240.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323238154|gb|EGA22212.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323243589|gb|EGA27607.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323247387|gb|EGA31346.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2009159199]
 gi|323251375|gb|EGA35247.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008282]
 gi|323258486|gb|EGA42158.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008283]
 gi|323260640|gb|EGA44249.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323264712|gb|EGA48214.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008285]
 gi|323270976|gb|EGA54411.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008287]
          Length = 134

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +          
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILLWLLGTSLSSPEGFQQAAD 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK-----INIIASIL 117
            MDG + +  ++    A+ +H++ GIR+++ D     +   A Q +      I ++ S+L
Sbjct: 69  IMDGFIVKFIMWGILTALAYHVIVGIRHMLMDFGYLEETFEAGQRSAKISFVITVVLSLL 128

Query: 118 TVLIVW 123
             ++VW
Sbjct: 129 AGVLVW 134


>gi|289742765|gb|ADD20130.1| succinate dehydrogenase cytochrome b subunit [Glossina morsitans
           morsitans]
          Length = 173

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 18/106 (16%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG----------TPVVVFWFFCIANGEHT 56
            R +SPHL IY+   T  +S+ HR TG V+  G          +P  +  +  +  G H 
Sbjct: 53  GREMSPHLTIYQPQLTSLLSVTHRGTGMVLTAGVWALGLAALISPQDIGNYASVIEGLH- 111

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
                  + G       F++ + +  H   G+R+L+WD    L  K
Sbjct: 112 -------LGGGTLTFLKFMFAFPLAFHTANGVRHLLWDTGRFLKIK 150


>gi|188534435|ref|YP_001908232.1| Succinate dehydrogenase cytochrome b-556 subunit [Erwinia
           tasmaniensis Et1/99]
 gi|188029477|emb|CAO97354.1| Succinate dehydrogenase cytochrome b-556 subunit [Erwinia
           tasmaniensis Et1/99]
          Length = 129

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  L   R   T   SI+HR++G + ++   ++++      +         
Sbjct: 3   KTVKKQRPVNLDLSTIRFPLTAIASILHRVSGVITFVSIGILLWLLGLSLSSPEGFLQAS 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD----KKIATQMA-KINIIASI 116
             MD  + +  ++    A+ +H+ GGIR+++ D  L  +     K + Q+A  I ++ SI
Sbjct: 63  AVMDSFIAKFIMWGILTALAYHIAGGIRHMMMDFGLLGETLETGKFSAQIAFGITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|220934637|ref|YP_002513536.1| succinate dehydrogenase, cytochrome b556 subunit [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|219995947|gb|ACL72549.1| succinate dehydrogenase, cytochrome b556 subunit [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 126

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 66/122 (54%), Gaps = 1/122 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RP+  +L   RL      SI HRI+G +++L  P+ +F F     GE   +     +
Sbjct: 3   REGRPVFLNLLKIRLPVPGVASIAHRISGVLLFLAIPLFLFIFQRSLQGEAGYAEALALL 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA-KINIIASILTVLIVW 123
              +  +   +  W+++HH L GIRYL+ DV + +++  A + A  + I+A +LTV+I+ 
Sbjct: 63  RHPLVMLISLVLLWSLLHHWLAGIRYLLIDVDVGVERTAARKSAWTVLILAPVLTVIILG 122

Query: 124 II 125
           ++
Sbjct: 123 VL 124


>gi|289209041|ref|YP_003461107.1| succinate dehydrogenase, cytochrome b556 subunit [Thioalkalivibrio
           sp. K90mix]
 gi|288944672|gb|ADC72371.1| succinate dehydrogenase, cytochrome b556 subunit [Thioalkalivibrio
           sp. K90mix]
          Length = 126

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 57/117 (48%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+   L+  RL     VSI+HRITG  + L  PV+++            + +   +   
Sbjct: 6   RPVFLDLRKIRLPLNAVVSILHRITGIFLILSIPVLLWLLDRSLASPEGFAQVAAIIGHP 65

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           V    L +  W ++HH+  GIR+L+ +  +  D+  + + A+  + A+I   L VW+
Sbjct: 66  VGLALLLIGLWWLLHHLFAGIRFLLMEFGIGEDRAGSLRTARDALYAAIFATLAVWL 122


>gi|260811592|ref|XP_002600506.1| hypothetical protein BRAFLDRAFT_119291 [Branchiostoma floridae]
 gi|229285793|gb|EEN56518.1| hypothetical protein BRAFLDRAFT_119291 [Branchiostoma floridae]
          Length = 181

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 16/112 (14%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSV----VYLGT-------PVVVFWFFCIA 51
           + +  RP+SPHL IY+   T  +SI HR TG+     VY  +       P++ + F  I 
Sbjct: 52  NAQKKRPMSPHLTIYKPQLTAMLSITHRGTGAAMAGFVYAFSVGMLVVNPLLGWDFPTIF 111

Query: 52  NGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKI 103
           N   +L      + G   + C+    W + +H + GIR+L WD     D K+
Sbjct: 112 NFIKSLEIHPWLILGG--KWCM---AWPISYHAMNGIRHLNWDAGYGFDMKV 158


>gi|22126947|ref|NP_670370.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pestis KIM 10]
 gi|45440881|ref|NP_992420.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pestis biovar Microtus str. 91001]
 gi|51595487|ref|YP_069678.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pseudotuberculosis IP 32953]
 gi|108806584|ref|YP_650500.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pestis Antiqua]
 gi|108813049|ref|YP_648816.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pestis Nepal516]
 gi|145599853|ref|YP_001163929.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pestis Pestoides F]
 gi|149366891|ref|ZP_01888925.1| succinate dehydrogenase cytochrome b-556 subunit [Yersinia pestis
           CA88-4125]
 gi|162418632|ref|YP_001605906.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pestis Angola]
 gi|165924731|ref|ZP_02220563.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165938394|ref|ZP_02226952.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166011605|ref|ZP_02232503.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166211616|ref|ZP_02237651.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399739|ref|ZP_02305257.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419466|ref|ZP_02311219.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167424337|ref|ZP_02316090.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167468943|ref|ZP_02333647.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           FV-1]
 gi|170025194|ref|YP_001721699.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pseudotuberculosis YPIII]
 gi|186894540|ref|YP_001871652.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pseudotuberculosis PB1/+]
 gi|218928277|ref|YP_002346152.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pestis CO92]
 gi|229903490|ref|ZP_04518603.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis Nepal516]
 gi|21959988|gb|AAM86621.1|AE013908_4 succinate dehydrogenase, cytochrome b556 [Yersinia pestis KIM 10]
 gi|45435739|gb|AAS61297.1| succinate dehydrogenase cytochrome b-556 subunit [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51588769|emb|CAH20383.1| succinate dehydrogenase cytochrome b-556 subunit [Yersinia
           pseudotuberculosis IP 32953]
 gi|108776697|gb|ABG19216.1| succinate dehydrogenase subunit C [Yersinia pestis Nepal516]
 gi|108778497|gb|ABG12555.1| succinate dehydrogenase subunit C [Yersinia pestis Antiqua]
 gi|115346888|emb|CAL19775.1| succinate dehydrogenase cytochrome b-556 subunit [Yersinia pestis
           CO92]
 gi|145211549|gb|ABP40956.1| succinate dehydrogenase subunit C [Yersinia pestis Pestoides F]
 gi|149291265|gb|EDM41340.1| succinate dehydrogenase cytochrome b-556 subunit [Yersinia pestis
           CA88-4125]
 gi|162351447|gb|ABX85395.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           Angola]
 gi|165913772|gb|EDR32391.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923791|gb|EDR40923.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165989553|gb|EDR41854.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166207387|gb|EDR51867.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166962207|gb|EDR58228.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050447|gb|EDR61855.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167057186|gb|EDR66949.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169751728|gb|ACA69246.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia
           pseudotuberculosis YPIII]
 gi|186697566|gb|ACC88195.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679260|gb|EEO75363.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis Nepal516]
          Length = 129

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 65/133 (48%), Gaps = 17/133 (12%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W   +     ++SS  
Sbjct: 3   KTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGL-----SVSSQE 56

Query: 62  CYMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDV-----SLCLDKKIATQMAKI 110
            +M  +      F+    W ++    +H+ GGIR+L+ D      +L +  + A     +
Sbjct: 57  GFMQAATIMNSFFVKFIFWGILTALAYHICGGIRHLLMDFGYLEENLAVGTRSAQVAMGL 116

Query: 111 NIIASILTVLIVW 123
            ++ S+L  ++VW
Sbjct: 117 TLVLSVLAGVLVW 129


>gi|209731756|gb|ACI66747.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
           K NRP+SPH+ +Y+    M +SI HR TG  V L   +  F    +    N  + L  + 
Sbjct: 47  KLNRPMSPHITVYQRSVPMMMSITHRGTG--VGLSGGISAFALLALVLPGNYPYYLDLIH 104

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
               G ++  +  F   + + +H L GIR+L WD           +   + I+ SILT
Sbjct: 105 SLSIGPALLGLAKFGIAFPLSYHTLNGIRHLFWDSGKGFTLPEVYRSGYVVIVLSILT 162


>gi|330829371|ref|YP_004392323.1| succinate dehydrogenase cytochrome b556 subunit [Aeromonas veronii
           B565]
 gi|328804507|gb|AEB49706.1| Succinate dehydrogenase cytochrome b556 subunit [Aeromonas veronii
           B565]
          Length = 125

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 62/119 (52%), Gaps = 2/119 (1%)

Query: 4   IKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +KN  RP++  LQ      T   SI+HR++G + ++   ++++             ++  
Sbjct: 1   MKNKQRPVNLDLQTISFPVTAIASILHRVSGVITFVALGILLWMLGTSLASPEGFETVVA 60

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTVL 120
            MD  + ++ L+    A+ +H++GG+R+L+ D+    + +   Q A++  +I +IL VL
Sbjct: 61  IMDNFLVKLVLWGILTALAYHIVGGLRHLVMDMGYWEELESGNQSARVAFVITAILAVL 119


>gi|293397238|ref|ZP_06641511.1| succinate dehydrogenase [Serratia odorifera DSM 4582]
 gi|291420258|gb|EFE93514.1| succinate dehydrogenase [Serratia odorifera DSM 4582]
          Length = 129

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 64/133 (48%), Gaps = 17/133 (12%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W   +     +LSS  
Sbjct: 3   KTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGM-----SLSSQE 56

Query: 62  CYMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDV-----SLCLDKKIATQMAKI 110
            ++  +      F+    W ++    +H+ GGIR+L+ D      SL   ++ A     +
Sbjct: 57  GFLQAAAIMNSFFVKFIFWGILTALAYHICGGIRHLLMDFGYIEESLAAGQRSAQVAFVL 116

Query: 111 NIIASILTVLIVW 123
             + SIL  ++VW
Sbjct: 117 TAVLSILAGVLVW 129


>gi|209737836|gb|ACI69787.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|303658983|gb|ADM15942.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLR 61
           K NRP+SPH+ IY+    M +SI HR TG  V L   +  F    +    N  + L  + 
Sbjct: 47  KLNRPMSPHITIYQWSVPMMMSITHRGTG--VGLSGGISAFALLALVLPGNYPYYLDLIH 104

Query: 62  CYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
               G ++  +  F   + + +H L GIR+L WD           +   + I+ SILT
Sbjct: 105 SLSIGPALLGLAKFGIAFPLSYHTLNGIRHLFWDSGKGFTLPEVYRSGYVVIVLSILT 162


>gi|149248046|ref|XP_001528410.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448364|gb|EDK42752.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 189

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGE 54
           + NRP+SPHLQIY+   T  +S  HRITG          +  Y  T ++ + F       
Sbjct: 63  RKNRPVSPHLQIYQPQLTWIMSSFHRITGVALAGAFYALTCTYAATSILGYHF-----DT 117

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
            TL S    +  ++      L  +  ++H   GIR++IWD
Sbjct: 118 QTLVSAFTSLPVALQYGIKALGAYPFVYHAANGIRHIIWD 157


>gi|307726505|ref|YP_003909718.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1003]
 gi|307587030|gb|ADN60427.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1003]
          Length = 167

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G ++++  P +++ F      E 
Sbjct: 32  DTLKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRVSGGLLFVALPFLLYLFDQSLTSEL 91

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMA-KINII 113
           +    + +    + ++ + +  WA + H   G+R+L+ D +   + K+   Q +  + ++
Sbjct: 92  SFEGFKAFFSNIIVKLIVLVLGWAYMFHFCAGVRHLLMDTNHEAVTKEKGRQTSIVVFVV 151

Query: 114 ASILTV 119
           +S+LT+
Sbjct: 152 SSLLTL 157


>gi|330503170|ref|YP_004380039.1| succinate dehydrogenase subunit C [Pseudomonas mendocina NK-01]
 gi|328917456|gb|AEB58287.1| succinate dehydrogenase subunit C [Pseudomonas mendocina NK-01]
          Length = 124

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 54/94 (57%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
          + + RP++  L+  +L  T + SI+HRI+G ++++G  +++F        E   + ++  
Sbjct: 1  MNSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVGIAILLFGLDKSLTSEEGFAQVKEC 60

Query: 64 MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
          +   + +  ++    A+++H++ G+R+LI D+ +
Sbjct: 61 LTSPLAKFVIWGLLSALLYHLVAGVRHLIMDMGI 94


>gi|50085920|ref|YP_047430.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter sp.
           ADP1]
 gi|49531896|emb|CAG69608.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter sp.
           ADP1]
          Length = 133

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 69/132 (52%), Gaps = 7/132 (5%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L  PV+++      +    
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLIPVLLWILDKSLSSPEG 60

Query: 57  LSSLRCYMDGSVF-EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
              ++  + G++   + ++++   +I H + G+++L+ D+    + +     A I++I S
Sbjct: 61  FEYVKTVIFGNILVRLIVWVFVAGLIFHFIAGVKHLLADLGFAEELQSGRTAATISLILS 120

Query: 116 ILTVL--IVWII 125
           ++ ++   VWI+
Sbjct: 121 VIGIIAAFVWIV 132


>gi|19075212|ref|NP_587712.1| succinate dehydrogenase (ubiquinone) cytochrome b subunit
           [Schizosaccharomyces pombe 972h-]
 gi|74582587|sp|O74882|SDH3_SCHPO RecName: Full=Succinate dehydrogenase cytochrome B subunit,
           mitochondrial; Flags: Precursor
 gi|3646453|emb|CAA20917.1| succinate dehydrogenase (ubiquinone) cytochrome b subunit
           [Schizosaccharomyces pombe]
          Length = 180

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN------GE 54
           ++S + +RP SPHL IY    T ++S +HRITG VV  GT       + +A         
Sbjct: 51  LASQRVHRPNSPHLTIYEPQLTWYLSSLHRITGCVV-AGTLYAFAMGYLVAPLAGYSLDT 109

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA 114
            T+S L   +   +     F+ ++ +  H+  GIR+LIWD +  L  K   +     +  
Sbjct: 110 ATISGLIQQVPTWIKVPAKFVISYPLTFHIFNGIRHLIWDTTKELSLKGVYRTGYAVLAL 169

Query: 115 SILT 118
           S+LT
Sbjct: 170 SVLT 173


>gi|120554077|ref|YP_958428.1| fumarate reductase, D subunit [Marinobacter aquaeolei VT8]
 gi|120323926|gb|ABM18241.1| succinate dehydrogenase subunit C [Marinobacter aquaeolei VT8]
          Length = 125

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L  +        SI+HRI+G ++++G   +++      +GE   + +   
Sbjct: 1   MNSKRPVNLDLGKFHFPLPAITSILHRISGIIIFVGVAFLMYGLDLSLSGEDGFNRVNEL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +D  + ++ ++    A+++H++ GI++L+ D  +  + +     AK  I  S++ +++  
Sbjct: 61  LDSFLAKLIIWGILSALLYHLVAGIKHLLMDAGIGEELESGRLAAKATIAVSVVLIVLAG 120

Query: 122 VWI 124
           VW+
Sbjct: 121 VWV 123


>gi|160875744|ref|YP_001555060.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica OS195]
 gi|160861266|gb|ABX49800.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica OS195]
 gi|315267933|gb|ADT94786.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           baltica OS678]
          Length = 131

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 57/126 (45%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T   SI+HR++G ++     ++++          + + ++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIASILHRVSGVIMLFAVGILIWLLNSSLASAESFAGVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASIL 117
              D  V +  ++    A+ +H+ GG+R+L+ D     +       AK    + +  SI+
Sbjct: 66  SLFDNFVMKFIMWGIMTALAYHLFGGLRHLVMDTGRWEELSSGAASAKAVFALTVAFSII 125

Query: 118 TVLIVW 123
             + VW
Sbjct: 126 AGIWVW 131


>gi|117618735|ref|YP_856454.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560142|gb|ABK37090.1| succinate dehydrogenase, cytochrome b556 subunit [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 129

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 65/127 (51%), Gaps = 5/127 (3%)

Query: 2   SSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
            ++KN  RP++  LQ      T   SI+HR++G + ++   ++++             ++
Sbjct: 3   KAVKNKQRPVNLDLQTISFPVTAIASILHRVSGVITFVALSILLWMLGTSLASPEGFETV 62

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTV 119
              MD  + +  L+    A+ +H++GG+R+L+ D+    + +   Q A++  +I ++L V
Sbjct: 63  VSIMDNFLVKFVLWGILTALAYHIVGGLRHLVMDMGYWEELESGNQSARVAFVITAVLAV 122

Query: 120 L---IVW 123
           L   +VW
Sbjct: 123 LAGVLVW 129


>gi|297493990|gb|ADI40717.1| succinate dehydrogenase complex subunit C [Miniopterus
           schreibersii]
          Length = 139

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 6/99 (6%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSSLRC 62
           +NRPLSPH+ IY     M +SI HR TG  V L   V +F    +    N E  L  ++ 
Sbjct: 32  SNRPLSPHITIYSWSLPMAMSICHRGTG--VALSAGVSLFGLSALLLPGNFESHLELVKS 89

Query: 63  YMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
              G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 90  LCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 128


>gi|146282234|ref|YP_001172387.1| succinate dehydrogenase (C subunit) [Pseudomonas stutzeri A1501]
 gi|145570439|gb|ABP79545.1| succinate dehydrogenase (C subunit) [Pseudomonas stutzeri A1501]
          Length = 124

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K+ RP++  L+  +L  T + SI+HR++G ++++G  +++       +       +R Y
Sbjct: 1   MKSQRPVNLDLRTIKLPITAYTSILHRVSGVILFVGIALLLLALDTSLSSPEGFEEVRAY 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI-IASILTVLI- 121
           +   + ++  +    A+++H++ G+R+LI D       +     +KI I ++++L VL  
Sbjct: 61  LGSPLAKLVSWALLSALLYHLVAGVRHLIMDSGHGETLEGGKLGSKIVIAVSAVLIVLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|332141293|ref|YP_004427031.1| succinate dehydrogenase, cytochrome b subunit [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327551315|gb|AEA98033.1| succinate dehydrogenase, cytochrome b subunit [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 124

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 61/126 (48%), Gaps = 8/126 (6%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L   +  P+   SI+HR+TG  ++     V++ +    +     ++++  
Sbjct: 1   MKKQRPVNLELNTIKFPPSAISSILHRVTGVAMFFALLFVIWAWAVSVHSAEGFANVQAI 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           M+G + +        A+ +H+LGG+R+++ D+    + +     AK         V+ +W
Sbjct: 61  MNGFLGKFVAIGTASALTYHILGGLRHVVMDLGHWEELESGNTSAK--------AVIALW 112

Query: 124 IIKDIV 129
           ++  +V
Sbjct: 113 VVLTVV 118


>gi|259909082|ref|YP_002649438.1| Succinate dehydrogenase cytochrome b-556 subunit [Erwinia
           pyrifoliae Ep1/96]
 gi|224964704|emb|CAX56221.1| Succinate dehydrogenase cytochrome b-556 subunit [Erwinia
           pyrifoliae Ep1/96]
 gi|283479108|emb|CAY75024.1| succinate dehydrogenase, cytochrome b556 [Erwinia pyrifoliae DSM
           12163]
          Length = 129

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  L   R   T   SI+HR++G + ++   ++++      +         
Sbjct: 3   KTVKKQRPVNLDLSTIRFPLTAIASILHRVSGVITFVSIGILLWLLGLSLSSPEGFLQAS 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD----KKIATQMA-KINIIASI 116
             MD  + +  ++    A+ +H+ GGIR+++ D  L  +     K++ Q+A  I +  SI
Sbjct: 63  AVMDSFIVKFIMWGILTALAYHIAGGIRHMMMDFGLLGETLETGKLSAQIAFGITVALSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|170691142|ref|ZP_02882308.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           graminis C4D1M]
 gi|170144391|gb|EDT12553.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           graminis C4D1M]
          Length = 138

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G ++++  P +++ F      E 
Sbjct: 3   DTLKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRLSGGLLFVALPFLLYLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMA-KINII 113
           +    + ++   + ++   +  WA + H   G+R+L+ D +   + K+   Q +  + ++
Sbjct: 63  SFEVFKGFLSNIIVKLITLVLAWAYLFHFCAGVRHLLMDTNHEAVTKEKGKQTSIVVFVV 122

Query: 114 ASILTV 119
           +S+LT+
Sbjct: 123 SSLLTI 128


>gi|161504118|ref|YP_001571230.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160865465|gb|ABX22088.1| hypothetical protein SARI_02216 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 134

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +          
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILLWLLGTSLSSPEGFQQAAD 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK-----INIIASIL 117
            MDG + +  ++    A+ +H++ GIR+++ D     +   A Q +      I ++ S+L
Sbjct: 69  IMDGFLVKFIMWGILTALAYHVIVGIRHMLMDFGYLEETFEAGQRSAKISFVITVVLSLL 128

Query: 118 TVLIVW 123
             ++VW
Sbjct: 129 AGVLVW 134


>gi|292487649|ref|YP_003530522.1| succinate dehydrogenase, cytochrome b556 [Erwinia amylovora
           CFBP1430]
 gi|292898886|ref|YP_003538255.1| succinate dehydrogenase cytochrome b-556 subunit [Erwinia amylovora
           ATCC 49946]
 gi|291198734|emb|CBJ45843.1| succinate dehydrogenase cytochrome b-556 subunit [Erwinia amylovora
           ATCC 49946]
 gi|291553069|emb|CBA20114.1| succinate dehydrogenase, cytochrome b556 [Erwinia amylovora
           CFBP1430]
 gi|312171757|emb|CBX80015.1| succinate dehydrogenase, cytochrome b556 [Erwinia amylovora ATCC
           BAA-2158]
          Length = 129

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  L   R   T   SI+HR++G + ++   ++++      +         
Sbjct: 3   KTLKKQRPVNLDLSTIRFPLTAIASILHRVSGVITFVSIGILLWLLGLSLSSPEGFLQAS 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD----KKIATQMA-KINIIASI 116
             MD  + +  ++    A+ +H+ GGIR+++ D  L  +     K + Q+A  I ++ SI
Sbjct: 63  AVMDSFIAKFIMWGILTALAYHIAGGIRHMMMDFGLLGETLETGKFSAQIAFGITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|291614300|ref|YP_003524457.1| succinate dehydrogenase, cytochrome b556 subunit [Sideroxydans
           lithotrophicus ES-1]
 gi|291584412|gb|ADE12070.1| succinate dehydrogenase, cytochrome b556 subunit [Sideroxydans
           lithotrophicus ES-1]
          Length = 124

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 69/123 (56%), Gaps = 5/123 (4%)

Query: 7   NRPLSPHLQIYRL---IPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           N+    HL ++++   +P  +VSI+HR++G+V++L  P+++           T ++L  Y
Sbjct: 2   NKKRPKHLALHKIKLPLPG-YVSILHRVSGAVLFLSLPLLLMLLDQSLRSIETYTNLTEY 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   V ++ LF   WA +HH   G+RYL  D+ L L    A + + + ++A  LT+ +++
Sbjct: 61  LSNPVLKLVLFGLMWAFLHHFCAGLRYLAIDLHL-LPSLAAARASSMWVMAVSLTLTVLF 119

Query: 124 IIK 126
            ++
Sbjct: 120 GVE 122


>gi|169153945|emb|CAQ14310.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Danio rerio]
          Length = 169

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD- 65
           NRP+SPH+ IY+    M +SI HR TG  + L + +  F    +   E    S   Y+D 
Sbjct: 49  NRPMSPHMTIYKWSVPMAMSISHRGTG--IALSSGISAFALAALVLPE----SYPYYLDL 102

Query: 66  ------GSVF-EVCLFLYTWAVIHHMLGGIRYLIWDVS 96
                 G  F     F   + V++H   GIR+L WD  
Sbjct: 103 IHSLTFGPQFLAFSKFALAFPVVYHTYNGIRHLAWDAG 140


>gi|169153946|emb|CAQ14311.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Danio rerio]
          Length = 167

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD- 65
           NRP+SPH+ IY+    M +SI HR TG  + L + +  F    +   E    S   Y+D 
Sbjct: 47  NRPMSPHMTIYKWSVPMAMSISHRGTG--IALSSGISAFALAALVLPE----SYPYYLDL 100

Query: 66  ------GSVF-EVCLFLYTWAVIHHMLGGIRYLIWDVS 96
                 G  F     F   + V++H   GIR+L WD  
Sbjct: 101 IHSLTFGPQFLAFSKFALAFPVVYHTYNGIRHLAWDAG 138


>gi|332306145|ref|YP_004433996.1| succinate dehydrogenase, cytochrome b556 subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332173474|gb|AEE22728.1| succinate dehydrogenase, cytochrome b556 subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 124

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L      P    SI+HRITG  ++     V++ +    +     + ++  
Sbjct: 1   MKKQRPVNLQLNTISFPPAAITSILHRITGVAMFFALLFVIWAWAESVSSPDGFAFVQEQ 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
           M G + ++       A+ +H+LGG+R+L+ D+    + +     AKI
Sbjct: 61  MSGVIGKIIAIGTISALTYHILGGLRHLVMDMGHWEELESGNNSAKI 107


>gi|126668307|ref|ZP_01739266.1| succinate dehydrogenase (C subunit) [Marinobacter sp. ELB17]
 gi|126627224|gb|EAZ97862.1| succinate dehydrogenase (C subunit) [Marinobacter sp. ELB17]
          Length = 126

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L  +       VSI+HR++G +++ G   +++      +GE     +   
Sbjct: 1   MNSKRPVNLDLGKFHFPLPAIVSILHRVSGIIIFAGVAFMLYGLDLSLSGEEGYGHVSEL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINI-IASILTVLI- 121
           + G   ++ ++    A+++H++ GIR+L+ D+ +  + +     AK+ + IA IL VL  
Sbjct: 61  LSGFFAKLIIWGILSALLYHLVAGIRHLLLDMGIGEELESGLVAAKVTLAIAIILIVLAG 120

Query: 122 VWI 124
           VW+
Sbjct: 121 VWV 123


>gi|195389516|ref|XP_002053422.1| GJ23871 [Drosophila virilis]
 gi|194151508|gb|EDW66942.1| GJ23871 [Drosophila virilis]
          Length = 170

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 44/103 (42%), Gaps = 12/103 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN-------GEHTLSS 59
            R +SPHL IY+   T  +SI+HR TG  + +G      W   +         G +    
Sbjct: 50  GRQMSPHLTIYKPQLTSMLSIMHRGTGLALGIG-----VWGLGLGALIASQDIGHYVTMV 104

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
               + G+      F+  + V +H   GIR+LIWD    L  K
Sbjct: 105 EGLQLSGAALTAIKFIIAYPVGYHSANGIRHLIWDTGRFLKIK 147


>gi|45198725|ref|NP_985754.1| AFR207Cp [Ashbya gossypii ATCC 10895]
 gi|44984735|gb|AAS53578.1| AFR207Cp [Ashbya gossypii ATCC 10895]
          Length = 166

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 14/108 (12%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA------NGEHTLS 58
           + NRP+SPHL IY+   T ++S VHRI+G ++      V   F   A      N E+  +
Sbjct: 40  RKNRPVSPHLTIYQPQLTWYLSSVHRISGVLLGGAFYAVTISFGVSALLGLGLNAENLAT 99

Query: 59  SLRCYM----DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
               +M    D +V     +L+ +    H   GIR+LIWD+   L  K
Sbjct: 100 WYHSHMPTWGDLTVKGGAAYLFAF----HFGNGIRHLIWDMGRELSLK 143


>gi|119572984|gb|EAW52599.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa, isoform CRA_b [Homo sapiens]
          Length = 189

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRPLSPH+ IY     M +SI HR TG  +  G  V +F    +    N E  L  
Sbjct: 65  NIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAG--VSLFGMSALLLPGNFESYLEL 122

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 123 VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 164


>gi|109130264|ref|XP_001093391.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like isoform 4 [Macaca mulatta]
          Length = 169

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRP+SPH+ IY     M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 45  NISSNRPVSPHITIYSWSLPMAMSICHRGTG--IALSAGVSLFGMSALLLPGNFESYLEL 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 103 VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 144


>gi|11466582|ref|NP_066472.1| succinate:cytochrome c oxidoreductase subunit 3 [Rhodomonas salina]
 gi|10444169|gb|AAG17743.1|AF288090_19 succinate:cytochrome c oxidoreductase subunit 3 [Rhodomonas salina]
          Length = 128

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 7/104 (6%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI------ANGEHTLS 58
           K  RPL+PHL +Y+   T   SI HRI+  ++++   +++F  +C        +      
Sbjct: 3   KKIRPLAPHLLVYKPQLTSIFSIFHRISAGILFVVFTILLFLSYCFDYYLNFFSFYFIFY 62

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
               + +  ++ V  FL T+  + HM+ G+R++ WD  L L+ K
Sbjct: 63  YFFPFFNLIIYFVSYFL-TFIFLFHMVNGLRHISWDFGLGLEIK 105


>gi|302191657|ref|NP_001180516.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Macaca mulatta]
 gi|109086211|ref|XP_001093733.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like isoform 3 [Macaca mulatta]
          Length = 169

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI---ANGEHTLSS 59
           +I +NRP+SPH+ IY     M +SI HR TG  + L   V +F    +    N E  L  
Sbjct: 45  NISSNRPVSPHITIYSWSLPMAMSICHRGTG--IALSAGVSLFGMSALLLPGNFESYLEL 102

Query: 60  LRCYMDG-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++    G ++     F   + +++H   GIR+L+WD+   L 
Sbjct: 103 VKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLK 144


>gi|16127759|ref|NP_422323.1| succinate dehydrogenase, cytochrome b556 subunit [Caulobacter
           crescentus CB15]
 gi|221236580|ref|YP_002519017.1| succinate dehydrogenase cytochrome B-556 subunit [Caulobacter
           crescentus NA1000]
 gi|13425261|gb|AAK25491.1| succinate dehydrogenase, cytochrome b556 subunit [Caulobacter
           crescentus CB15]
 gi|220965753|gb|ACL97109.1| succinate dehydrogenase cytochrome B-556 subunit [Caulobacter
           crescentus NA1000]
          Length = 135

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ++R   TM  SI+HR     +++G  ++  W   +A G    +S    +  
Sbjct: 10  ERPMSPHLQVWRWHITMACSILHRGCVVGLWVGAVILAGWAAALAAGPDAYASYVGLLGS 69

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            + ++ L   T+AV  ++   IR   WD       + A     + I  +++  ++ W+I 
Sbjct: 70  PIGKLVLLGETFAVFFNVAYTIRQTFWDAGKGFAPRTADMTGAMAIAFAVVATIVTWVIA 129

Query: 127 D 127
            
Sbjct: 130 G 130


>gi|894229|gb|AAB33776.1| succinate-ubiquinone reductase QPs1 subunit [cattle, heart, Peptide
           Mitochondrial, 140 aa]
          Length = 140

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 5/116 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCYMD 65
           NRPLSPH+ IY     M +SI HR TG  +  G  +       +    E  L  ++    
Sbjct: 20  NRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSALLVPGSFESHLEFVKSLCL 79

Query: 66  G-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           G ++     F   + +++H   GIR+L+WD+   L     +Q+ +  +   +LTVL
Sbjct: 80  GPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLT---ISQLHQSGVAVLVLTVL 132


>gi|162939|gb|AAA21608.1| cytochrome b-560 [Bos taurus]
          Length = 132

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 5/116 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCYMD 65
           NRPLSPH+ IY     M +SI HR TG  +  G  +       +    E  L  ++    
Sbjct: 12  NRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSALLVPGSFESHLEFVKSLCL 71

Query: 66  G-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           G ++     F   + +++H   GIR+L+WD+   L     +Q+ +  +   +LTVL
Sbjct: 72  GPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLT---ISQLHQSGVAVLVLTVL 124


>gi|330862922|emb|CBX73057.1| succinate dehydrogenase cytochrome b556 subunit [Yersinia
           enterocolitica W22703]
          Length = 143

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 65/133 (48%), Gaps = 17/133 (12%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W   +     ++SS  
Sbjct: 17  KTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVMTFVAVGILL-WLLGL-----SVSSQE 70

Query: 62  CYMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDV-----SLCLDKKIATQMAKI 110
            +M  +      F+    W ++    +H+ GGIR+L+ D      SL    + A  +  +
Sbjct: 71  GFMQAAAVMNSFFVKFIFWGILTALAYHVCGGIRHLLMDFGYVEESLAAGTRSAQVVMVL 130

Query: 111 NIIASILTVLIVW 123
            ++ S+L  ++VW
Sbjct: 131 TLVLSVLAGVLVW 143


>gi|255065302|ref|ZP_05317157.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria sicca
          ATCC 29256]
 gi|255050723|gb|EET46187.1| succinate dehydrogenase, cytochrome b556 subunit [Neisseria sicca
          ATCC 29256]
          Length = 98

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%)

Query: 25 VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHM 84
          VSI+HRI+G  +++  PV+++      + E    + R  +   + ++ L    WA +HH 
Sbjct: 23 VSILHRISGVGLFIMLPVLLYLLSGTLSRESAFETYRAIVSNPLVKLILIGVLWAYLHHF 82

Query: 85 LGGIRYLIW 93
          L GIR+  W
Sbjct: 83 LAGIRFYFW 91


>gi|326561803|gb|EGE12138.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis 7169]
 gi|326563240|gb|EGE13507.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis 46P47B1]
 gi|326563354|gb|EGE13619.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis 12P80B1]
 gi|326565892|gb|EGE16053.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis 103P14B1]
 gi|326568971|gb|EGE19040.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis BC1]
 gi|326571947|gb|EGE21952.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis BC8]
 gi|326575458|gb|EGE25383.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis 101P30B1]
 gi|326576453|gb|EGE26361.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis CO72]
 gi|326577924|gb|EGE27788.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis O35E]
          Length = 129

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 19/136 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    LS  + +    P    SI+HR++G V++L  PV++    CI   + +
Sbjct: 1   MPAVKSNRPINLPLSQVIAVNSKSPIAMASILHRVSGIVLFLLVPVML----CIL--QTS 54

Query: 57  LSSLRCYMDGSVF-EVCLFLYTW----AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN 111
           LSS   +   +VF  + L    W    A  +H + GI++L+ D  +  + K     A I+
Sbjct: 55  LSSADSF--AAVFNNIALRFVAWIFVAATAYHFVMGIKHLLADAGMNEELKSGRTAAVIS 112

Query: 112 -IIASILTVL-IVWII 125
            +IA++L V   VW++
Sbjct: 113 FVIAAVLIVASFVWVM 128


>gi|123443162|ref|YP_001007136.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122090123|emb|CAL12986.1| succinate dehydrogenase cytochrome b-556 subunit [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 129

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 65/133 (48%), Gaps = 17/133 (12%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W   +     ++SS  
Sbjct: 3   KTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVMTFVAVGILL-WLLGL-----SVSSQE 56

Query: 62  CYMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDV-----SLCLDKKIATQMAKI 110
            +M  +      F+    W ++    +H+ GGIR+L+ D      SL    + A  +  +
Sbjct: 57  GFMQAAAVMNSFFVKFIFWGILTALAYHVCGGIRHLLMDFGYVEESLAAGTRSAQVVMVL 116

Query: 111 NIIASILTVLIVW 123
            ++ S+L  ++VW
Sbjct: 117 TLVLSVLAGVLVW 129


>gi|109898115|ref|YP_661370.1| succinate dehydrogenase, cytochrome b subunit [Pseudoalteromonas
           atlantica T6c]
 gi|109700396|gb|ABG40316.1| succinate dehydrogenase subunit C [Pseudoalteromonas atlantica T6c]
          Length = 124

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L      P    SI+HRITG  ++     V++ +    +     + ++  
Sbjct: 1   MKKQRPVNLQLNTISFPPAAITSILHRITGVAMFFALLFVIWAWAESVSSPDGFAFVQEQ 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
           M G + ++       A+ +H+LGG+R+L+ D+    + +     AKI
Sbjct: 61  MSGVIGKIIAIATISALTYHILGGLRHLVMDMGYWEELESGNISAKI 107


>gi|159462554|ref|XP_001689507.1| succinate dehydrogenase subunit b560 [Chlamydomonas reinhardtii]
 gi|158283495|gb|EDP09245.1| succinate dehydrogenase subunit b560 [Chlamydomonas reinhardtii]
          Length = 203

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 35/125 (28%)

Query: 6   NNRPLSPH-LQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLS 58
             RPLSP  ++I      Y+       SI +R+TG  + +G        F  A     + 
Sbjct: 71  KKRPLSPDVMEIDNKSAHYKFPLGALSSITNRVTGVALSVG--------FAGAG----VF 118

Query: 59  SLRCYMDGSVFEVCL----------FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
           +LR  +DG V   C           FL ++A+I+H LGG+R+++WDVS     KI  Q  
Sbjct: 119 ALRGSLDG-VVAACAGSFLIGFPLKFLVSYAIIYHWLGGLRHIVWDVS-----KIGNQAD 172

Query: 109 KINII 113
           + +++
Sbjct: 173 RTSLL 177


>gi|293610901|ref|ZP_06693200.1| succinate dehydrogenase [Acinetobacter sp. SH024]
 gi|292826553|gb|EFF84919.1| succinate dehydrogenase [Acinetobacter sp. SH024]
          Length = 133

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 70/138 (50%), Gaps = 19/138 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L  PV++ W       + +
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLVPVLL-WIL-----DKS 54

Query: 57  LSSLRC--YMDGSVF-----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
           LSS     Y+   VF        ++++   +I H + GI++L+ D+    + +     A 
Sbjct: 55  LSSPEGFDYVKNVVFGNILVRFVVWVFAAGLIFHFIAGIKHLLADLGFAEELQSGRIAAT 114

Query: 110 INIIASILTVL--IVWII 125
           I++I S++ ++   VWI+
Sbjct: 115 ISLILSVVAIIAAFVWIM 132


>gi|308497614|ref|XP_003110994.1| CRE-MEV-1 protein [Caenorhabditis remanei]
 gi|308242874|gb|EFO86826.1| CRE-MEV-1 protein [Caenorhabditis remanei]
          Length = 184

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 8/106 (7%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M     NRP++PHL IY+   T  +S  HRI+G V+  GT +V    F +   + T  + 
Sbjct: 45  MKQRAKNRPIAPHLTIYQPQLTWMLSGFHRISGCVM-AGTLLVGGIGFAVLPFDFT--TF 101

Query: 61  RCYMDG-----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
             Y+ G     +V  V  ++  + +I H L GIR+L +D++  +D 
Sbjct: 102 VEYIRGWNLPCAVTAVFKYIIAFPIIFHTLNGIRFLGFDLAKGVDN 147


>gi|321465564|gb|EFX76564.1| hypothetical protein DAPPUDRAFT_36257 [Daphnia pulex]
          Length = 126

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP--VVVFWFFCIANGEHTLSSLRCYM 64
            RPLS HL I++L   M +S+ HR TG V+  G P  +         +  + L  L C M
Sbjct: 9   KRPLSAHLSIHKLQNNMIISMTHRFTG-VILCGIPFGLATVAILLPESYPYYLEILEC-M 66

Query: 65  DGSVFEVCL--FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           + S F +    FL       H L GIR+LIWD+   L  K
Sbjct: 67  NLSRFMITTGKFLVVLPFSFHYLNGIRHLIWDLGYWLTIK 106


>gi|95769404|gb|ABF57433.1| succinate dehydrogenase complex, subunit C isoform 1 precursor [Bos
           taurus]
          Length = 168

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 5/116 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCYMD 65
           NRPLSPH+ IY     M +SI HR TG  +  G  +       +    E  L  ++    
Sbjct: 48  NRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSALLVPGSFESHLEFVKSLCL 107

Query: 66  G-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           G ++     F   + +++H   GIR+L+WD+   L     +Q+ +  +   +LTVL
Sbjct: 108 GPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLT---ISQLHQSGVAVLVLTVL 160


>gi|254524825|ref|ZP_05136880.1| succinate dehydrogenase, cytochrome b556 subunit [Stenotrophomonas
           sp. SKA14]
 gi|219722416|gb|EED40941.1| succinate dehydrogenase, cytochrome b556 subunit [Stenotrophomonas
           sp. SKA14]
          Length = 117

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 52/108 (48%)

Query: 16  IYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFL 75
           +YR    M  SI+HR TG  + +G  ++      +  G  + +    +       V LF 
Sbjct: 1   MYRWQIQMATSILHRATGVFLSVGALIIAAGLLALMMGPESWNCFTGHAGAWYGRVFLFA 60

Query: 76  YTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +TW+  +H+  GIR+++ D ++        + + +++  S++  L+VW
Sbjct: 61  WTWSFAYHLCNGIRHVVQDFAIGFSIPAFIRSSWLSVTGSLVITLLVW 108


>gi|169632620|ref|YP_001706356.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii SDF]
 gi|169151412|emb|CAP00143.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii]
          Length = 133

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 70/138 (50%), Gaps = 19/138 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L  PV++ W       + +
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLVPVLL-WIL-----DKS 54

Query: 57  LSSLRC--YMDGSVF-----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
           LSS     Y+   VF        ++++   +I H + G+++L+ D+    + +     A 
Sbjct: 55  LSSPEGFDYVKNVVFGNILVRFVVWVFVAGLIFHFIAGVKHLLADLGFAEELQSGRIAAT 114

Query: 110 INIIASILTVL--IVWII 125
           I++I S++ ++   VWI+
Sbjct: 115 ISLILSVVAIIAAFVWIV 132


>gi|121712948|ref|XP_001274085.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           clavatus NRRL 1]
 gi|119402238|gb|EAW12659.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           clavatus NRRL 1]
          Length = 188

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 15/106 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP++PHL IYR   T   S +HRITG          +  YL  P +  W    A+    
Sbjct: 65  NRPVAPHLSIYRPQITWIGSSLHRITGVALSGSLYLFATAYLAAP-LFGWHLESASLVAA 123

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
             +L       +     F +    ++H L G+R+L+WD+   +  +
Sbjct: 124 FGALPLAAKVLLKSTAAFPF----VYHCLNGVRHLVWDLGRGMTNQ 165


>gi|83950428|ref|ZP_00959161.1| succinate dehydrogenase, cytochrome b556 subunit [Roseovarius
           nubinhibens ISM]
 gi|83838327|gb|EAP77623.1| succinate dehydrogenase, cytochrome b556 subunit [Roseovarius
           nubinhibens ISM]
          Length = 103

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 26  SIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHML 85
           SI+ RITG+ + LG  ++V+WF   A G    +++   +   + ++ +    WA+ +H+L
Sbjct: 3   SILTRITGNALLLGALLMVWWFLAAATGPEYFATVDGIVTSFLGDLIMVGSLWALWYHLL 62

Query: 86  GGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
            G+R+LIWD +L L+ + A +M   ++IA 
Sbjct: 63  AGVRHLIWDNALMLELERA-EMLGWSVIAG 91


>gi|28461247|ref|NP_787008.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Bos taurus]
 gi|1705529|sp|P35720|C560_BOVIN RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; AltName: Full=Integral membrane protein
           CII-3; AltName: Full=QPs-1; Short=QPs1; AltName:
           Full=Succinate dehydrogenase complex subunit C; Flags:
           Precursor
 gi|786511|gb|AAB32390.1| succinate-ubiquinone oxidoreductase complex II membrane-intrinsic
           subunit [Bos taurus]
 gi|74267618|gb|AAI02063.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Bos taurus]
 gi|296489839|gb|DAA31952.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Bos taurus]
 gi|1092498|prf||2024211A succinate ubiquinone oxidoreductase
          Length = 169

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 5/116 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCYMD 65
           NRPLSPH+ IY     M +SI HR TG  +  G  +       +    E  L  ++    
Sbjct: 49  NRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSALLVPGSFESHLEFVKSLCL 108

Query: 66  G-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           G ++     F   + +++H   GIR+L+WD+   L     +Q+ +  +   +LTVL
Sbjct: 109 GPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLT---ISQLHQSGVAVLVLTVL 161


>gi|209694421|ref|YP_002262349.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Aliivibrio salmonicida LFI1238]
 gi|208008372|emb|CAQ78527.1| succinate dehydrogenase cytochrome b556 subunit [Aliivibrio
           salmonicida LFI1238]
          Length = 133

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 67/125 (53%), Gaps = 4/125 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
            +K +RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +    
Sbjct: 9   KVKKSRPVNLDLQTIRFPITAIASILHRVSGVITFVSVGILLWLLNLSLSSPIGFAQAAD 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTVL- 120
           ++DG      ++    A+ +H++ GIR+L+ D+    + + A+Q AKI  +I ++L++L 
Sbjct: 69  HIDGFFVTFIMWGILTALAYHIVVGIRHLLMDMGHFEELESASQSAKIAFVITAVLSLLA 128

Query: 121 --IVW 123
             +VW
Sbjct: 129 GVLVW 133


>gi|159462552|ref|XP_001689506.1| succinate dehydrogenase subunit b560 [Chlamydomonas reinhardtii]
 gi|158283494|gb|EDP09244.1| succinate dehydrogenase subunit b560 [Chlamydomonas reinhardtii]
          Length = 183

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 35/125 (28%)

Query: 6   NNRPLSPH-LQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLS 58
             RPLSP  ++I      Y+       SI +R+TG  + +G        F  A     + 
Sbjct: 51  KKRPLSPDVMEIDNKSAHYKFPLGALSSITNRVTGVALSVG--------FAGAG----VF 98

Query: 59  SLRCYMDGSVFEVCL----------FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
           +LR  +DG V   C           FL ++A+I+H LGG+R+++WDVS     KI  Q  
Sbjct: 99  ALRGSLDG-VVAACAGSFLIGFPLKFLVSYAIIYHWLGGLRHIVWDVS-----KIGNQAD 152

Query: 109 KINII 113
           + +++
Sbjct: 153 RTSLL 157


>gi|118594808|ref|ZP_01552155.1| succinate dehydrogenase cytochrome b-556 subunit [Methylophilales
           bacterium HTCC2181]
 gi|118440586|gb|EAV47213.1| succinate dehydrogenase cytochrome b-556 subunit [Methylophilales
           bacterium HTCC2181]
          Length = 123

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 8/91 (8%)

Query: 18  RLIPTMFVSIVHRITGSVVYLGTPVVVFWF----FCIANGEHTLSSLRCYMDGSVFEVCL 73
           RL     VSI+HR++G+V+++  P +V  F      ++  E T+S L  +       + L
Sbjct: 15  RLPMPALVSILHRMSGAVLFIFMPFLVVAFCNSLTSVSFYERTISQLFSF----PLVLIL 70

Query: 74  FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA 104
           +L  W  IHH++ G R+L+ D+ +  D  +A
Sbjct: 71  YLMVWGFIHHLIAGFRHLLLDMQIGNDLIVA 101


>gi|328775159|gb|AEB39974.1| succinate dehydrogenase subunit 3 [Funaria hygrometrica]
          Length = 131

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 21/110 (19%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVF---WFFCIANGEHT---- 56
           +K NRPLSPHL IY+   T  +SI HRI+G+ +     ++VF    F  I +   T    
Sbjct: 1   MKINRPLSPHLTIYKPQLTSTLSIFHRISGAFL----AIMVFSSILFLKIGDLNLTSYYF 56

Query: 57  ------LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
                  +S   ++  S+    L     A+ +HM  GIR+L+WD+   L+
Sbjct: 57  YRYAFFFTSYSYWLILSLVNFSLL----ALCYHMSNGIRHLLWDLGFFLE 102


>gi|57768830|ref|NP_001003523.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Danio rerio]
 gi|50417100|gb|AAH78306.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein [Danio rerio]
          Length = 144

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD- 65
           NRP+SPH+ IY+    M +SI HR TG  + L + +  F    +   E    S   Y+D 
Sbjct: 24  NRPMSPHMTIYKWSVPMAMSISHRGTG--IALSSGISAFALAALVLPE----SYPYYLDL 77

Query: 66  ------GSVF-EVCLFLYTWAVIHHMLGGIRYLIWDVS 96
                 G  F     F   + V++H   GIR+L WD  
Sbjct: 78  IHSLTFGPQFLAFSKFALAFPVVYHTYNGIRHLAWDAG 115


>gi|326569270|gb|EGE19331.1| succinate dehydrogenase, cytochrome b556 subunit [Moraxella
           catarrhalis BC7]
          Length = 129

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 19/136 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    LS  + +    P    SI+HR++G V++L  PV++    CI   + +
Sbjct: 1   MPAVKSNRPINLPLSQVIAVNSKSPIAMASILHRMSGIVLFLLVPVML----CIL--QTS 54

Query: 57  LSSLRCYMDGSVF-EVCLFLYTW----AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN 111
           LSS   +   +VF  + L    W    A  +H + GI++L+ D  +  + K     A I+
Sbjct: 55  LSSADSF--AAVFNNIALRFVAWIFVAATAYHFVMGIKHLLADAGMNEELKSGRTAAVIS 112

Query: 112 -IIASILTVL-IVWII 125
            +IA++L V   VW++
Sbjct: 113 FVIAAVLIVASFVWVM 128


>gi|153948100|ref|YP_001401848.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Yersinia pseudotuberculosis IP 31758]
 gi|152959595|gb|ABS47056.1| succinate dehydrogenase, cytochrome b556 subunit [Yersinia
           pseudotuberculosis IP 31758]
          Length = 125

 Score = 43.9 bits (102), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 64/131 (48%), Gaps = 17/131 (12%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  R   T   SI+HR++G + ++   +++ W   +     ++SS   +
Sbjct: 1   MKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGL-----SVSSQEGF 54

Query: 64  MDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDV-----SLCLDKKIATQMAKINI 112
           M  +      F+    W ++    +H+ GGIR+L+ D      +L +  + A     + +
Sbjct: 55  MQAATIMNSFFVKFIFWGILTALAYHICGGIRHLLMDFGYLEENLAVGTRSAQVAMGLTL 114

Query: 113 IASILTVLIVW 123
           + S+L  ++VW
Sbjct: 115 VLSVLAGVLVW 125


>gi|317491182|ref|ZP_07949618.1| succinate dehydrogenase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920729|gb|EFV42052.1| succinate dehydrogenase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 129

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           + ++K  RP++  LQ  R   T   SI+HR +G + ++   ++++            +  
Sbjct: 2   IKNVKKQRPVNLDLQTIRFPVTAIASILHRASGVITFVSIGILLWLLGLSLASPEGFAQA 61

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIAS 115
              MD  + +  ++    A+ +H+ GGIR+++ D      S     + A     I ++ S
Sbjct: 62  AAVMDSFIVKFIVWGILTALAYHICGGIRHMLMDFGYIEESFAAGSRTAYISFAITVVLS 121

Query: 116 ILTVLIVW 123
           IL  ++VW
Sbjct: 122 ILAGVLVW 129


>gi|296412597|ref|XP_002836009.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629809|emb|CAZ80166.1| unnamed protein product [Tuber melanosporum]
          Length = 181

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 15/108 (13%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG----------TPVVVFWFFCIANGE 54
           +  RP+SPHL IY+   T   S  +RITGS++ +G           PV  + F  +    
Sbjct: 56  RKQRPISPHLGIYQPQLTWCGSAANRITGSILSVGAYGFFAAYAVAPVFGWPFDSV---- 111

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            T+++    +  +      F  T    +H   GIR+L+WD    LD K
Sbjct: 112 -TIAAAFSGLPAATKFGIKFAVTLPFSYHSWNGIRHLLWDTGKALDIK 158


>gi|261856937|ref|YP_003264220.1| succinate dehydrogenase, cytochrome b556 subunit [Halothiobacillus
           neapolitanus c2]
 gi|261837406|gb|ACX97173.1| succinate dehydrogenase, cytochrome b556 subunit [Halothiobacillus
           neapolitanus c2]
          Length = 124

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +  +RP+S +L   +L     VSI+HRI+G+ ++L  PV+++ F          + ++ +
Sbjct: 1   MAGSRPVSLNLLKIKLPLPGIVSIMHRISGAFLFLLLPVLLYVFQLSLGSAEGFAEVQSW 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               V ++ L +  WA +HH   G+RYL  D+ + +    A   AK+ ++ SI   L++ 
Sbjct: 61  FHSPVAKLALLVVVWAYLHHFCMGLRYLALDLDIGVHLAQARFTAKLVLVVSIALTLLIG 120

Query: 124 II 125
           ++
Sbjct: 121 VL 122


>gi|119186307|ref|XP_001243760.1| hypothetical protein CIMG_03201 [Coccidioides immitis RS]
          Length = 205

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITG----SVVYL-GTPVVVFWFFCIANGEH 55
           +++ + NRP+SPHL IY+   T  VS + R+TG      +YL GT  VV  +        
Sbjct: 75  LAAQRLNRPVSPHLSIYKFQITSVVSSLERLTGMMLSGGLYLFGTAYVVSPYLGWDLSSA 134

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
           +L++    +  +      F   W  + H L G +Y++W     L+ K   Q  
Sbjct: 135 SLAAAFGALPFAAKAAAKFSIAWPFLFHCLNGTKYMVWSWGKLLNNKAVIQAG 187


>gi|11465650|ref|NP_049321.1| succinate:cytochrome c oxidoreductase subunit 3 [Porphyra
          purpurea]
 gi|1705530|sp|P80478|C560_PORPU RecName: Full=Succinate dehydrogenase cytochrome b560 subunit;
          AltName: Full=Succinate dehydrogenase, subunit III
 gi|4106957|gb|AAD03124.1| succinate:cytochrome c oxidoreductase subunit 3 [Porphyra
          purpurea]
          Length = 125

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (54%), Gaps = 8/93 (8%)

Query: 7  NRPLSPHLQIYRLIPTMFVSIVHRITGSVVY--LGTPVVVFWFFCIANGEH-TLSSLRCY 63
          NRP+SPHL IY    +   SI HRI+G  ++  + +P +   F  +A   + + + L   
Sbjct: 5  NRPISPHLTIYNTQKSSLFSIWHRISGVAMFTLIASPPL---FLKLATFSYKSFNILDLM 61

Query: 64 MDGSVFEVCLFLYTWAVI--HHMLGGIRYLIWD 94
          ++ S   +  F+   +VI  +H++ GIR+ +WD
Sbjct: 62 LNNSSLILPWFIVIISVIFLYHIINGIRHFLWD 94


>gi|254786526|ref|YP_003073955.1| succinate dehydrogenase, cytochrome b556 subunit [Teredinibacter
           turnerae T7901]
 gi|237685297|gb|ACR12561.1| succinate dehydrogenase, cytochrome b556 subunit [Teredinibacter
           turnerae T7901]
          Length = 124

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K NRP++  +   +L  T +VSI+HR++G V+  G  V+++        E +   L+  
Sbjct: 1   MKTNRPVNLDISTIKLPVTAYVSILHRVSGVVLLAGVLVLLYMLDMSLTSEESFDELKEL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ L+    A+ +H + G+R+LI D  +    +   + AK+ ++ +I+ ++   
Sbjct: 61  LASPLAKIVLWGVLSALAYHFVAGVRHLIMDAGVGESLEGGKRGAKVALVLAIVLIIAAG 120

Query: 122 VWI 124
           VW+
Sbjct: 121 VWV 123


>gi|126642742|ref|YP_001085726.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|169794942|ref|YP_001712735.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AYE]
 gi|260557308|ref|ZP_05829524.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|301346639|ref|ZP_07227380.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB056]
 gi|332854231|ref|ZP_08435251.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii 6013150]
 gi|332866326|ref|ZP_08436931.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii 6013113]
 gi|332872541|ref|ZP_08440510.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii 6014059]
 gi|126388626|gb|ABO13124.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|169147869|emb|CAM85732.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AYE]
 gi|260409414|gb|EEX02716.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|332728156|gb|EGJ59544.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii 6013150]
 gi|332734674|gb|EGJ65778.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii 6013113]
 gi|332739227|gb|EGJ70085.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii 6014059]
          Length = 133

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 70/138 (50%), Gaps = 19/138 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L  PV++ W       + +
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLVPVLL-WIL-----DKS 54

Query: 57  LSSLRC--YMDGSVF-----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
           LSS     Y+   VF        ++++   +I H + G+++L+ D+    + +     A 
Sbjct: 55  LSSPEGFDYVKNVVFGNILVRFVVWVFVAGLIFHFIAGVKHLLADLGFAEELQSGRIAAT 114

Query: 110 INIIASILTVL--IVWII 125
           I++I S++ ++   VWI+
Sbjct: 115 ISLILSVVAIIAAFVWIM 132


>gi|170050185|ref|XP_001859594.1| mitochondrial succinate dehydrogenase cytochrome b subunit [Culex
           quinquefasciatus]
 gi|167871715|gb|EDS35098.1| mitochondrial succinate dehydrogenase cytochrome b subunit [Culex
           quinquefasciatus]
          Length = 171

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 3/120 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            RP SPHL IY    T  +SI HR+TG ++    T + +       +  H L+ L   + 
Sbjct: 53  QRPQSPHLTIYSFQLTAVLSITHRMTGMALAGYATALGLGALAMPHDATHYLTMLEG-LS 111

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTVLIVWI 124
                   F   +   +H + G+R+L WD+   L  K++ T    + +++ +L   + ++
Sbjct: 112 APTLMALKFTMAYPFSYHTVNGVRHLFWDLGKFLSIKEVYTTGYTMLLVSGVLAAGLTFL 171


>gi|332020713|gb|EGI61118.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           [Acromyrmex echinatior]
          Length = 154

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 22/112 (19%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL---SS 59
           +++  RPLSPHL IY++  T  +SI HR TG         ++   + +  G  TL     
Sbjct: 30  NMRLKRPLSPHLTIYQVQLTTLLSITHRTTG---------IILSSYAMFLGLGTLLIPGG 80

Query: 60  LRCYMDGSVFEVCL---------FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           + C+++ ++  +CL          L       H   GIR+L+WD+ + L  K
Sbjct: 81  IPCFIE-TMDNLCLPLPILFVGKTLLALPATFHTYNGIRHLLWDLGMFLTIK 131


>gi|331215943|ref|XP_003320651.1| hypothetical protein PGTG_02673 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309299641|gb|EFP76232.1| hypothetical protein PGTG_02673 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 189

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 45/108 (41%), Gaps = 18/108 (16%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP SPH  IY+   T + SI +R+TG  +  G       F+  A G   L         +
Sbjct: 68  RPSSPHFTIYQPQLTWYSSIANRVTGCALSAG-------FYAYALGYMALPGSIPLDSDT 120

Query: 68  VFEVCLFLYTWAVI-----------HHMLGGIRYLIWDVSLCLDKKIA 104
           V +V      WA +           +H   G+R+L WD+   LD K +
Sbjct: 121 VVQVVASSPEWAKVAGKAIVALPFTYHTFNGVRHLAWDMGYLLDLKTS 168


>gi|157369506|ref|YP_001477495.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Serratia proteamaculans 568]
 gi|270263768|ref|ZP_06192037.1| succinate dehydrogenase, cytochrome b556 subunit [Serratia
           odorifera 4Rx13]
 gi|157321270|gb|ABV40367.1| Succinate dehydrogenase cytochrome b556 subunit [Serratia
           proteamaculans 568]
 gi|270042652|gb|EFA15747.1| succinate dehydrogenase, cytochrome b556 subunit [Serratia
           odorifera 4Rx13]
          Length = 129

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  +   T   SI+HR++G + ++   ++++      + +       
Sbjct: 3   KNVKKQRPVNLDLQTIQFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFMQAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASI 116
             M+  V +   +    A+ +H+ GGIR+L+ D      SL    + A     + ++ S+
Sbjct: 63  AIMNSFVVKFIFWGILTALAYHICGGIRHLLMDFGYIEESLAAGTRSAQVAIGLTVVLSV 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|114332434|ref|YP_748656.1| succinate dehydrogenase, cytochrome b subunit [Nitrosomonas
           eutropha C91]
 gi|114309448|gb|ABI60691.1| succinate dehydrogenase subunit C [Nitrosomonas eutropha C91]
          Length = 130

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 25  VSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHH 83
           VSI+HRI+G +++  G P+ +     +     + + L+  +   +  + L   TW  +HH
Sbjct: 27  VSILHRISGVLLFFPGIPLFLCGLQMMLESPESFARLQSILIHPLSRLFLLFATWFFLHH 86

Query: 84  MLGGIRYLIWDVSLCLDKKIATQMAKINII-ASILTVLI-VWI 124
           +  GIR+L  D+   L  + A   +K+ +I  +ILTVL  +W+
Sbjct: 87  LFAGIRHLGLDMHYGLQLQHARLSSKLVLIFGAILTVLAGIWL 129


>gi|224061007|ref|XP_002300314.1| predicted protein [Populus trichocarpa]
 gi|222847572|gb|EEE85119.1| predicted protein [Populus trichocarpa]
          Length = 282

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG 53
           RPLSPHL IYR       SIV+RI+G+  +L T V+ F+F C+  G
Sbjct: 194 RPLSPHLPIYRPQVNSTFSIVNRISGA--FLSTIVLCFYFICLKTG 237


>gi|311694408|gb|ADP97281.1| succinate dehydrogenase, cytochrome b560 subunit [marine bacterium
           HP15]
          Length = 125

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 64/123 (52%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L  +        SI+HRI+G ++++    +++      +GE   S +   
Sbjct: 1   MNSKRPVNLDLGKFHFPLPAITSILHRISGIILFVAVAFMLYGLQLSLSGEEGFSRVSEL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +D  + ++  +    A+++H++ GI++L  D+ +  + +     +KI +  S++ +L+  
Sbjct: 61  LDSFLAKLITWGILSALLYHLVAGIKHLFMDMGIGEELESGRLASKITVAVSVILILLAG 120

Query: 122 VWI 124
           VW+
Sbjct: 121 VWV 123


>gi|312884960|ref|ZP_07744650.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367437|gb|EFP94999.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 130

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HRI+G + ++   ++++      +     +     +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRISGVITFVAIGILLWLLSISLSSPVGYAQAASLV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  ++    A+ +H++GGIR+L+ D+    + +     AK++ +A    S+L  +
Sbjct: 68  DGFFVKFIIWGILTALAYHIVGGIRHLLMDMGHFEELESGAMSAKVSFVATIVLSVLAGV 127

Query: 121 IVW 123
           +VW
Sbjct: 128 MVW 130


>gi|48727574|gb|AAT46090.1| integral membrane protein CII-3 [Branchiostoma belcheri
           tsingtauense]
          Length = 165

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 16/112 (14%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSV----VY---LG----TPVVVFWFFCIA 51
           + +  RP+SPHL IY+   T  +S+ HR TG+     VY   +G     P++ + F  I 
Sbjct: 52  NAQKKRPMSPHLTIYKPQLTAMLSMTHRGTGAAMAGCVYAFSMGMLVVNPLLGWDFPTII 111

Query: 52  NGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKI 103
           +   +L      + G  +  C+    W + +H + GIR+L WD     D K+
Sbjct: 112 SFVKSLELHPWLILGGKW--CM---AWPISYHAMNGIRHLTWDTGYGFDMKV 158


>gi|195038233|ref|XP_001990564.1| GH19420 [Drosophila grimshawi]
 gi|193894760|gb|EDV93626.1| GH19420 [Drosophila grimshawi]
          Length = 171

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGT-PVVVFWFFCIANGEHTLSSLRC-YM 64
            R +SPHL IY+   T  +SI+HR TG  + +G   + +       +  H ++ +    +
Sbjct: 51  GREMSPHLTIYKPQLTSMLSIMHRGTGLALGMGVWGLGLGALIASQDISHYVTMVEGLQL 110

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  + V +H   GIR+L+WD    L  K
Sbjct: 111 SGATLTAIKFIIAYPVGYHSANGIRHLLWDTGRFLKIK 148


>gi|260549001|ref|ZP_05823223.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter sp.
           RUH2624]
 gi|260408169|gb|EEX01640.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter sp.
           RUH2624]
          Length = 133

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 70/138 (50%), Gaps = 19/138 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L  PV++ W       + +
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLVPVLL-WIL-----DKS 54

Query: 57  LSSLRC--YMDGSVF-----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
           LSS     Y+   VF        ++++   +I H + G+++L+ D+    + +     A 
Sbjct: 55  LSSPEGFDYVKNVVFGNILVRFIVWVFVAGLIFHFIAGVKHLLADLGFAEELQSGRIAAT 114

Query: 110 INIIASILTVL--IVWII 125
           I++I S++ ++   VWI+
Sbjct: 115 ISLILSVVAIIAAFVWIM 132


>gi|119774560|ref|YP_927300.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           amazonensis SB2B]
 gi|119767060|gb|ABL99630.1| succinate dehydrogenase subunit C [Shewanella amazonensis SB2B]
          Length = 131

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 57/126 (45%), Gaps = 4/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ      T  VSI+HR++G ++     ++++          +   ++
Sbjct: 6   QNVKKQRPVHLDLQTIHFPATAKVSILHRVSGVIMLFAMGILIWLLHASLASAESFQGVQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASIL 117
              D  + +  ++    A+ +H+LGGIR+L+ D     +       AK    + I  SI+
Sbjct: 66  ALFDNFLVKFVIWGILTALGYHLLGGIRHLVMDTGRWEELGSGNASAKAVFVLAITFSII 125

Query: 118 TVLIVW 123
             + VW
Sbjct: 126 AGIWVW 131


>gi|319943670|ref|ZP_08017951.1| succinate dehydrogenase cytochrome b558 subunit [Lautropia
           mirabilis ATCC 51599]
 gi|319742903|gb|EFV95309.1| succinate dehydrogenase cytochrome b558 subunit [Lautropia
           mirabilis ATCC 51599]
          Length = 168

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 19  LIPTMFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYT 77
           + P   VSI+HR +G++++L G P +++        E +       +   + ++ L +  
Sbjct: 57  MAPAAQVSILHRASGALMFLIGIPFMLYLLSQSITSESSFEVYSAVVHSWLGKLVLLVLI 116

Query: 78  WAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           W+  HHM  G R+++ D+    +K  A   AK+ ++A  LT+ +++
Sbjct: 117 WSFCHHMAAGFRFIVLDMHFLTEKSKAMFSAKV-VLAVSLTMTVIF 161


>gi|323649888|ref|YP_004237261.1| succinate dehydrogenase subunit 3 [Ricinus communis]
 gi|322394268|gb|ADW96025.1| succinate dehydrogenase subunit 3 [Ricinus communis]
          Length = 103

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 18/99 (18%)

Query: 8  RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
          RPLSPHL IY+   T    I HRI+G+  +L T V  F+  C+        SL C+   +
Sbjct: 5  RPLSPHLPIYKPQLTSTYPISHRISGA--FLATIVFFFYVLCLK------ISLICFTYEN 56

Query: 68 VFEVCLF----------LYTWAVIHHMLGGIRYLIWDVS 96
           ++   F          +   A+ +H+  G+R+L+ D S
Sbjct: 57 FYQFFFFSSKLIKISVEMTALALSYHLYNGLRHLLTDFS 95


>gi|283784477|ref|YP_003364342.1| succinate dehydrogenase cytochrome b-556 subunit [Citrobacter
           rodentium ICC168]
 gi|282947931|emb|CBG87495.1| succinate dehydrogenase cytochrome b-556 subunit [Citrobacter
           rodentium ICC168]
          Length = 134

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 62/132 (46%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDKKIATQMAK-----IN 111
           +   S      F+    W ++    +H++GG+R++  D     +   A Q +      I 
Sbjct: 63  FQQASAIMGSFFVKFIMWGILTALAYHVVGGVRHMFMDFGYLEETFEAGQRSAKIAFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|194664933|ref|XP_001787720.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like isoform 1 [Bos taurus]
 gi|297472053|ref|XP_002685667.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like isoform 1 [Bos taurus]
 gi|296490234|gb|DAA32347.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial-like
           isoform 1 [Bos taurus]
          Length = 169

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 2/114 (1%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCYMD 65
           NRPLSPH+ IY     M +SI HR TG  +  G  +       +    E  L  ++    
Sbjct: 49  NRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSALLVPGSFESHLEFVKSLCL 108

Query: 66  G-SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILT 118
           G ++     F   + +++H   GIR+L+WD+   L      Q  +  ++ ++L+
Sbjct: 109 GPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLTISQLHQSGEAVLVLTVLS 162


>gi|85708849|ref|ZP_01039915.1| hypothetical protein NAP1_06400 [Erythrobacter sp. NAP1]
 gi|85690383|gb|EAQ30386.1| hypothetical protein NAP1_06400 [Erythrobacter sp. NAP1]
          Length = 111

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 1/102 (0%)

Query: 23  MFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVI 81
           M VSI+HR++G  + L G  V+V+W   +A+G     +        +  V L   TWA  
Sbjct: 1   MLVSILHRVSGDGMALVGLAVLVWWLGALASGPDAYETFLWAAASPLGYVVLIGLTWAFF 60

Query: 82  HHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            HM+ G+R+ + D+    +       + ++ I +I   +++W
Sbjct: 61  THMMSGLRHFVLDIGAGYELDTNRFWSIVSPIIAIALTVVLW 102


>gi|254586589|ref|XP_002498862.1| ZYRO0G20350p [Zygosaccharomyces rouxii]
 gi|238941756|emb|CAR29929.1| ZYRO0G20350p [Zygosaccharomyces rouxii]
          Length = 178

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 16/107 (14%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           + + + NRP+SPHL IY+   T ++S +HR++G  V LG     F+   IA G  TL  L
Sbjct: 48  LRAQRKNRPISPHLTIYQPQMTWYLSSLHRVSG--VMLG---AAFYCLTIAFGVSTLFGL 102

Query: 61  RCYMDGSVF---EVCLFLYTWAV--------IHHMLGGIRYLIWDVS 96
               +       E     + W            H+  G+R+L+WD+ 
Sbjct: 103 GLNTENLTTWYKEKVPTWFDWTAKGGVAYLFAFHISNGVRHLVWDLG 149


>gi|294637440|ref|ZP_06715730.1| succinate dehydrogenase, cytochrome b556 subunit [Edwardsiella
           tarda ATCC 23685]
 gi|291089381|gb|EFE21942.1| succinate dehydrogenase, cytochrome b556 subunit [Edwardsiella
           tarda ATCC 23685]
          Length = 146

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 59/117 (50%), Gaps = 1/117 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           +++K  RP++  L   R   T   SI+HR++G +V++   ++++            +   
Sbjct: 20  NTVKKQRPVNLDLPTIRFPITAIASILHRVSGVIVFVSIGILLWLLGLSLLSAEGFAQAS 79

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-KIATQMAKINIIASIL 117
             +DG + ++ L+    A+ +H+ GGIR+L+ D     +   +  + A++   A++L
Sbjct: 80  AVVDGVLVKLVLWGILTALAYHICGGIRHLLMDFGYLEETFSVGCRSAQVAFAATVL 136


>gi|145237506|ref|XP_001391400.1| cytochrome B-560 subunit of succinate dehydrogenase [Aspergillus
           niger CBS 513.88]
 gi|134075872|emb|CAL00251.1| unnamed protein product [Aspergillus niger]
          Length = 188

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 15/103 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T   S +HRITG          +  YL +P ++ W    A+    
Sbjct: 65  NRPVSPHLSIYRPQITWIGSSIHRITGIALSGSLYLYASAYLASP-MLGWDLGSASAAAA 123

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCL 99
            ++L      ++       +T+    H + G+R+LIWD    L
Sbjct: 124 FAALPVVAKVALKTTMALPFTY----HCMNGVRHLIWDTGAGL 162


>gi|254419838|ref|ZP_05033562.1| succinate dehydrogenase, cytochrome b556 subunit [Brevundimonas sp.
           BAL3]
 gi|196186015|gb|EDX80991.1| succinate dehydrogenase, cytochrome b556 subunit [Brevundimonas sp.
           BAL3]
          Length = 154

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%)

Query: 9   PLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSV 68
           PLSPH+ I+R   TM  SI+ R T     +G  +VV W   +A G    ++        +
Sbjct: 29  PLSPHIGIWRWHVTMAASILFRATIIAATVGALIVVAWLGALAFGPDAYAAALALAGSPL 88

Query: 69  FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
                F  T  +   +L G R+ I D    L  K +T +++I + A +   ++ W++
Sbjct: 89  GLFVSFGLTVVLFSFILNGTRHTINDTGNGLTIKSSTILSRIAVWAPVPLAILFWVV 145


>gi|194743886|ref|XP_001954429.1| GF18258 [Drosophila ananassae]
 gi|190627466|gb|EDV42990.1| GF18258 [Drosophila ananassae]
          Length = 152

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 46/103 (44%), Gaps = 12/103 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSLRCYM 64
            R LSPHL IY    T  +SI+HR TG  + LG  V   W   +      H ++     +
Sbjct: 32  GRKLSPHLTIYSPQLTSMLSIMHRGTG--LALGAGV---WALGVGALISSHDINHYATMV 86

Query: 65  D-----GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +     G+      F+  + V +H   GIR+L+WD    L  K
Sbjct: 87  EGLQLSGATLTALKFIIAYPVGYHTANGIRHLLWDTGRFLKIK 129


>gi|328785048|ref|XP_393056.2| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial [Apis mellifera]
          Length = 153

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 19/101 (18%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            +++  RPLSPHL IY++  T F+SI HR TG ++     +       I  G+  L+   
Sbjct: 49  KNLRLKRPLSPHLTIYQIQLTAFLSITHRTTGMILSSYAMLFGIGTLLIPGGKTLLA--- 105

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
                               +H   G+R+L WD+ + L  K
Sbjct: 106 ----------------LPATYHTFNGLRHLAWDLGMFLTIK 130


>gi|68466667|ref|XP_722529.1| hypothetical protein CaO19.1480 [Candida albicans SC5314]
 gi|68466950|ref|XP_722390.1| hypothetical protein CaO19.9055 [Candida albicans SC5314]
 gi|46444361|gb|EAL03636.1| hypothetical protein CaO19.9055 [Candida albicans SC5314]
 gi|46444509|gb|EAL03783.1| hypothetical protein CaO19.1480 [Candida albicans SC5314]
 gi|238881974|gb|EEQ45612.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 176

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 44/102 (43%), Gaps = 19/102 (18%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRP SPHLQIY    T  +S  HRITG V   G       F+ +  G    S L    
Sbjct: 50  RKNRPTSPHLQIYEPQLTWIMSSFHRITG-VAMAGA------FYALTCGFAATSILNIPF 102

Query: 65  DG----SVFEVCLFLYTWAV--------IHHMLGGIRYLIWD 94
           D     S F        + +        ++H+  GIR+L+WD
Sbjct: 103 DTTTLVSAFTTLPTFAQYGIKAICAYPFVYHIGNGIRHLVWD 144


>gi|189209924|ref|XP_001941294.1| succinate dehydrogenase cytochrome b560 subunit [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187977387|gb|EDU44013.1| succinate dehydrogenase cytochrome b560 subunit [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 177

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 47/106 (44%), Gaps = 15/106 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA------NGEH----T 56
           NRP+SPHL IYR   T   S  +RITG VV  G+     + F IA       G H    +
Sbjct: 53  NRPVSPHLAIYRPQITSIASAFNRITG-VVLSGS----LYLFGIAYLVAPYTGWHLETQS 107

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           + +       +V       Y +    H L G+R+L WDV +    +
Sbjct: 108 MVATVAAWPAAVKAGIKAFYAFPFFFHSLNGLRHLAWDVGVGFKNQ 153


>gi|321251937|ref|XP_003192230.1| hypothetical protein CGB_B4140C [Cryptococcus gattii WM276]
 gi|317458698|gb|ADV20443.1| Hypothetical Protein CGB_B4140C [Cryptococcus gattii WM276]
          Length = 154

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%), Gaps = 4/124 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRIT----GSVVYLGTPVVVFWFFCIANGEHT 56
           ++S + +RP SPHL IY+   T ++S +HRIT    G  +YL     +      A     
Sbjct: 25  LNSQRQHRPTSPHLAIYQPQLTWYLSSLHRITGVAVGGALYLSAMAYLLHPLVPAIDSAH 84

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
           L  L   + G +     F+       H   G+R+L WD+   L  K   +     + A++
Sbjct: 85  LIQLVHDLPGWLKGSAKFIIALPFTFHCFNGLRHLNWDIGKALTIKGVYRTGYAVLGATV 144

Query: 117 LTVL 120
           L+ L
Sbjct: 145 LSSL 148


>gi|322833847|ref|YP_004213874.1| succinate dehydrogenase, cytochrome b556 subunit [Rahnella sp.
           Y9602]
 gi|321169048|gb|ADW74747.1| succinate dehydrogenase, cytochrome b556 subunit [Rahnella sp.
           Y9602]
          Length = 129

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +   
Sbjct: 3   KTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSPEGFAHAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASI 116
             M+    +   +    A+ +H+ GG+R+L+ D      SL    + A     + ++ SI
Sbjct: 63  AIMNSFFVKFIFWGILTALAYHVCGGVRHLLMDFGYIEESLAAGTRSAQVAIGLTVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|196003862|ref|XP_002111798.1| expressed hypothetical protein [Trichoplax adhaerens]
 gi|190585697|gb|EDV25765.1| expressed hypothetical protein [Trichoplax adhaerens]
          Length = 139

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 18/98 (18%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN----GEH-----TL 57
           NRP+SPHL IY+   T  +SI HR +G +  L      F  + +++     EH     TL
Sbjct: 20  NRPMSPHLTIYKPQLTSMMSITHRASGMI--LSAYAATFAIYTMSSSGTLAEHIEVWKTL 77

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV 95
            ++  +        C F++   + +H + G+R+LIWD+
Sbjct: 78  PAIVPFT-----LKCGFIF--PLYYHAINGVRHLIWDM 108


>gi|255724056|ref|XP_002546957.1| succinate dehydrogenase cytochrome B subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
 gi|240134848|gb|EER34402.1| succinate dehydrogenase cytochrome B subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
          Length = 186

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 15/100 (15%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGE 54
           + NRP SPHLQIY+   T  +S  HRITG          +  +  T ++    F  A   
Sbjct: 59  RRNRPSSPHLQIYQPQLTWILSSFHRITGVAMAGAFYALTCTFAATSILGI-HFDTATLV 117

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
              + L   +  +V   C + +    + H+  GIR+L+WD
Sbjct: 118 SAFTELPVTLQYAVKAACAYPF----VFHVGNGIRHLVWD 153


>gi|310800693|gb|EFQ35586.1| succinate dehydrogenase cytochrome b subunit [Glomerella
           graminicola M1.001]
          Length = 188

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 46/105 (43%), Gaps = 14/105 (13%)

Query: 7   NRPLSPHLQIYRLIPTMF-VSIVHRITGS------VVYLGTPVV---VFWFFCIANGEHT 56
           NRP+SPHL IY++  T F  SI  RITG        VY GT +V   + W     +    
Sbjct: 63  NRPVSPHLSIYKMEQTWFGASIWTRITGGGLSAAFYVYFGTYLVAPLLGWHVESQSLVAA 122

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
             +L     G +     FL  W    H   GIR+L +D+     K
Sbjct: 123 FGALPLAAKGGL----KFLVAWPFTFHFFNGIRHLTYDLVKGFTK 163


>gi|195111370|ref|XP_002000252.1| GI22625 [Drosophila mojavensis]
 gi|193916846|gb|EDW15713.1| GI22625 [Drosophila mojavensis]
          Length = 152

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGT-PVVVFWFFCIANGEHTLSSLRC-YM 64
            R +SPHL IY+   T  +S++HR TG V+ LG   + +       +  H ++ +    +
Sbjct: 32  GREMSPHLTIYKPQLTSLLSVMHRGTGLVLGLGVWGLGIGALVASQDISHYVTMVEGLQL 91

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  +   +H   G+R+L+WD    L  K
Sbjct: 92  SGASLTAIKFILAYPFGYHAANGVRHLLWDTGRFLKIK 129


>gi|320582704|gb|EFW96921.1| succinate dehydrogenase cytochrome b subunit, mitochondrial
           precursor, putative [Pichia angusta DL-1]
          Length = 170

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 47/103 (45%), Gaps = 5/103 (4%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV--VFWFFCIANGEHTLSSLRC 62
           + NRP SPHLQIY+   T  +S  HRITG  +  G   V   + F  +A      ++L  
Sbjct: 45  RKNRPSSPHLQIYQPQLTWILSSFHRITGVGLAAGFYAVTCTYAFTSLAGIPFDTATLVS 104

Query: 63  YMDGSVFEVCLFLYTWAVIH---HMLGGIRYLIWDVSLCLDKK 102
            + G      + L   A      H+  G+R+L+WD    L  K
Sbjct: 105 VVAGLPVAAKVGLKAAASFPFAFHVANGVRHLVWDFGKELTLK 147


>gi|90406983|ref|ZP_01215173.1| succinate dehydrogenase cytochrome b556 subunit [Psychromonas sp.
           CNPT3]
 gi|90311854|gb|EAS39949.1| succinate dehydrogenase cytochrome b556 subunit [Psychromonas sp.
           CNPT3]
          Length = 124

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 58/124 (46%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +  NRP +  L   +   T   SI+HR++G +V++   + +F      +       +  Y
Sbjct: 1   MHKNRPKNLDLATVKFPITATASILHRVSGIIVFISLAIFMFLLNLSLSSALGFHQVLGY 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASILTV 119
            D    E  ++     + +HM+ G+R++I D+    + + A+  A+    +  I S+L  
Sbjct: 61  FDNLFIEFIMWGALTGLAYHMVFGVRHMIQDLGFWEEMESASTSARYGFVLTFILSVLAG 120

Query: 120 LIVW 123
           ++VW
Sbjct: 121 VLVW 124


>gi|88798678|ref|ZP_01114261.1| putative succinate dehydrogenase, hydrophobic subunit [Reinekea sp.
           MED297]
 gi|88778441|gb|EAR09633.1| putative succinate dehydrogenase, hydrophobic subunit [Reinekea sp.
           MED297]
          Length = 124

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 8/123 (6%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +KNNRP++  L   R+  T   SI HR+TG  +++    V F  + ++    +    R  
Sbjct: 1   MKNNRPVNLDLTTIRMPVTAIASITHRVTGVGLFV---AVGFLLWALSTSLESAEGFR-Q 56

Query: 64  MDGSVFEVCLFLYTWA----VIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           + G +        TW     V++H++ GI++L  D      K+     +K+ ++ S + +
Sbjct: 57  VQGVMSHWFAKFITWGIVSFVVYHLIAGIKHLFMDAGYFETKETGPVASKVVLVLSAIGI 116

Query: 120 LIV 122
           ++V
Sbjct: 117 VLV 119


>gi|261343509|ref|ZP_05971154.1| succinate dehydrogenase, cytochrome b556 subunit [Providencia
           rustigianii DSM 4541]
 gi|282568655|gb|EFB74190.1| succinate dehydrogenase, cytochrome b556 subunit [Providencia
           rustigianii DSM 4541]
          Length = 129

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 7/126 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ      T   SI+HR++G +  +   ++++      +           
Sbjct: 5   VKKQRPVNLDLQTIHFPITAISSILHRVSGVITLIAVGILLWLLGTSLSSPEGFQYASEL 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK------INIIASIL 117
           M G   +  L+    A+ +H+ GGIR+++ D   C+D+ +A   +       I +I +IL
Sbjct: 65  MTGFFAKFILWGILTALAYHICGGIRHMLMDFG-CVDETLAAGNSSAKITFVITVILAIL 123

Query: 118 TVLIVW 123
             ++VW
Sbjct: 124 AGILVW 129


>gi|85090713|ref|XP_958549.1| hypothetical protein NCU07756 [Neurospora crassa OR74A]
 gi|28919920|gb|EAA29313.1| hypothetical protein NCU07756 [Neurospora crassa OR74A]
          Length = 180

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 16/112 (14%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMF-VSIVHRITG----------SVVYLGTPVVVFWFFC 49
           ++  + NRP+SPHL+IY    T F  S   RITG          +V YL  P+V  W   
Sbjct: 49  LAKQRLNRPVSPHLEIYDPKQTWFGGSAWQRITGASFSGALYASAVAYLAAPLVG-WHLE 107

Query: 50  IANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
            A+     ++L   + G++     FL  W  + H + G+R+L +D+ +   +
Sbjct: 108 SASLVAAAAALPVAVKGAL----KFLVAWPFVFHAINGVRHLAFDLGIGFSR 155


>gi|256822762|ref|YP_003146725.1| succinate dehydrogenase, cytochrome b556 subunit [Kangiella
           koreensis DSM 16069]
 gi|256796301|gb|ACV26957.1| succinate dehydrogenase, cytochrome b556 subunit [Kangiella
           koreensis DSM 16069]
          Length = 125

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 63/124 (50%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC- 62
           +   RP + +L   R       SI+HRITG +++   P+++ W    +      S L+  
Sbjct: 1   MNQKRPTNLNLATIRFPVPAISSILHRITGVILFFAVPILL-WMLQKSLTPAGFSELQTM 59

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL--TVL 120
           + +  +++  L+  T AV +H++ G+R+L+ D+ +    +   + A + II S +   VL
Sbjct: 60  FAESFLWQFILWAITTAVAYHVIAGVRHLLMDMDIGESLEGGRRGAWLVIILSAVAAAVL 119

Query: 121 IVWI 124
            VW+
Sbjct: 120 GVWV 123


>gi|158562454|gb|ABW74134.1| succinate dehydrogenase cytochrome b560 subunit [Mucor racemosus]
          Length = 180

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 19/107 (17%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RP+SPHLQIY+   T ++S +HR+TG  V LG       F+  A       +L   +D +
Sbjct: 58  RPVSPHLQIYQPQITWYLSGLHRVTG--VALGGA-----FYLGALAYVAAPALGVTIDTA 110

Query: 68  VFEVCLFLYTWAV------------IHHMLGGIRYLIWDVSLCLDKK 102
                     +A+            + H L G+R+L+WD +  LD K
Sbjct: 111 SIISAATAAPFALKFAAKTTVAAPFVFHCLNGVRHLVWDATKMLDIK 157


>gi|295096572|emb|CBK85662.1| succinate dehydrogenase subunit C [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 159

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L+  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 34  NVKKQRPVNLDLKTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 87

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLD-----KKIATQMAKIN 111
           ++  S      F+    W ++    +H++GG+R+++ D     +     K+ A     I 
Sbjct: 88  FLQASAIMNSFFVKFIMWGILTALAYHVVGGVRHMLMDFGYLEETFEAGKRTANISFVIT 147

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 148 VVLSLLAGVLVW 159


>gi|92113339|ref|YP_573267.1| succinate dehydrogenase subunit C [Chromohalobacter salexigens DSM
           3043]
 gi|91796429|gb|ABE58568.1| succinate dehydrogenase subunit C [Chromohalobacter salexigens DSM
           3043]
          Length = 125

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 9/127 (7%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L   +       SI HRITG ++++G   ++F F+ +     +       
Sbjct: 1   MNSKRPVNLDLTTIKFPLPALTSIAHRITGIILFIG---LIFGFWALDVSLSSPEGFEAV 57

Query: 64  MDGSVFEVCLFLYTWAVIH----HMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILT 118
            D     V   L  W ++     H + GI++L+ D  + +D +   + A+I  +I++IL 
Sbjct: 58  RDTLANNVLAKLIAWGLLSALGFHFVAGIKHLLMDAGIGVDLEGGYRKAQITVVISAILV 117

Query: 119 VLI-VWI 124
           VL  VW+
Sbjct: 118 VLAGVWV 124


>gi|323332076|gb|EGA73487.1| YMR118C-like protein [Saccharomyces cerevisiae AWRI796]
          Length = 228

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 16/111 (14%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-------EH 55
           S +  RP+SPHL +Y    + ++S +HRI+G ++ LG     F+ F I  G       + 
Sbjct: 100 SQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALG-----FYAFTITLGVTTIMGMDT 154

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIH----HMLGGIRYLIWDVSLCLDKK 102
           T   L  +    + +   ++   +  +    H   GIR+LIWD+   L  +
Sbjct: 155 TFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNR 205


>gi|58258559|ref|XP_566692.1| succinate dehydrogenase (ubiquinone) [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134106659|ref|XP_778340.1| hypothetical protein CNBA3400 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50261043|gb|EAL23693.1| hypothetical protein CNBA3400 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57222829|gb|AAW40873.1| succinate dehydrogenase (ubiquinone), putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 221

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 22/133 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCI 50
           ++S + +RP SPHL IY+   T ++S +HRITG          ++ YL  P+V      +
Sbjct: 92  LNSQRQHRPTSPHLAIYQPQLTWYLSSLHRITGVAFGGALYLSAMAYLLHPLV-----PV 146

Query: 51  ANGEHTLS---SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
            +  H +     L  +  GS   +    +T+    H   G+R+L WD+   L  K   + 
Sbjct: 147 IDSAHLIQLVHDLPGWFKGSAKFIIALPFTF----HCYNGLRHLNWDIGKALTIKGVYRT 202

Query: 108 AKINIIASILTVL 120
               + A++L+ L
Sbjct: 203 GYAVLGATVLSSL 215


>gi|171693117|ref|XP_001911483.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946507|emb|CAP73308.1| unnamed protein product [Podospora anserina S mat+]
          Length = 184

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 46/107 (42%), Gaps = 16/107 (14%)

Query: 7   NRPLSPHLQIYRLIPTMF-VSIVHRITGS----------VVYLGTPVVVFWFFCIANGEH 55
           NRP+SPHL IY    T F  SI  R TGS            YL  P++  W    A    
Sbjct: 59  NRPVSPHLDIYDKQQTFFGGSIWQRFTGSGLSGGLYVFGAAYLAAPLLG-WHLESA---- 113

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +L S    +  +V     FL  W    H   G+R+L  D+ + + ++
Sbjct: 114 SLVSAFGALPFAVKSGVKFLVAWPFAFHAFNGVRHLALDLGMFMKRQ 160


>gi|212712449|ref|ZP_03320577.1| hypothetical protein PROVALCAL_03543 [Providencia alcalifaciens DSM
           30120]
 gi|212684906|gb|EEB44434.1| hypothetical protein PROVALCAL_03543 [Providencia alcalifaciens DSM
           30120]
          Length = 129

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 7/126 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ      T   SI+HR++G +  +   ++++      +           
Sbjct: 5   VKKQRPVNLDLQTIHFPITAISSILHRVSGVITLIAVGILLWLLGTSLSSPEGFQYASEI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK------INIIASIL 117
           M G   +  L+    A+ +H+ GGIR+++ D   C+D+ +A   +       I +I +IL
Sbjct: 65  MTGFFAKFILWGILTALAYHICGGIRHMLMDFG-CVDETLAAGNSSAKITFVITVILAIL 123

Query: 118 TVLIVW 123
             ++VW
Sbjct: 124 AGILVW 129


>gi|262281274|ref|ZP_06059056.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|262257505|gb|EEY76241.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter
           calcoaceticus RUH2202]
          Length = 133

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 70/138 (50%), Gaps = 19/138 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L  PV++ W       + +
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLVPVLL-WIL-----DKS 54

Query: 57  LSSLRC--YMDGSVF-----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
           LSS     Y+   VF        ++++   ++ H + G+++L+ D+    + +     A 
Sbjct: 55  LSSPEGFDYVKNVVFGNILVRFIVWVFVAGLLFHFIAGVKHLLADLGFAEELQSGRIAAT 114

Query: 110 INIIASILTVL--IVWII 125
           I++I S++ ++   VWI+
Sbjct: 115 ISLILSVVAIIAAFVWIM 132


>gi|328876220|gb|EGG24583.1| succinate dehydrogenase [Dictyostelium fasciculatum]
          Length = 216

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (68%)

Query: 5  KNNRPLSPHLQIYRLIPTMFVSIVHRITG 33
          KNNRP SPHL IY+L     +SI HR TG
Sbjct: 68 KNNRPTSPHLTIYKLPQPAILSITHRATG 96


>gi|195157732|ref|XP_002019750.1| GL12041 [Drosophila persimilis]
 gi|198455279|ref|XP_002138040.1| GA19764 [Drosophila pseudoobscura pseudoobscura]
 gi|194116341|gb|EDW38384.1| GL12041 [Drosophila persimilis]
 gi|198133177|gb|EDY68598.1| GA19764 [Drosophila pseudoobscura pseudoobscura]
          Length = 152

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 51/126 (40%), Gaps = 12/126 (9%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSL---- 60
            R LSPHL IY+   T  +S++HR TG  + +G      W   +      H +S      
Sbjct: 32  GRELSPHLSIYQPQLTSILSVMHRGTGMALGVGV-----WALGLGALISSHDISHYVTMV 86

Query: 61  -RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               + G+      F+  +   +H   GIR+L WD    L  K         + AS +  
Sbjct: 87  EGLQLSGATLTALKFIIAYPAGYHTANGIRHLFWDTGRFLKIKEVYSTGYAMVAASFVLT 146

Query: 120 LIVWII 125
            I+ +I
Sbjct: 147 AILALI 152


>gi|281206854|gb|EFA81038.1| succinate dehydrogenase [Polysphondylium pallidum PN500]
          Length = 205

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 52/121 (42%), Gaps = 5/121 (4%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RP+SPHL IY+L     +S+ HR TG  + LG  +       +         +  + 
Sbjct: 79  QPERPISPHLTIYKLPMPAILSVTHRATG--IALGVGLATLAGLSVFGAHDVPYYIELFK 136

Query: 65  DG--SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL-CLDKKIATQMAKINIIASILTVLI 121
               S+     F   + +  H   GIR++ WD  L  ++ K A     I + AS+   LI
Sbjct: 137 QSYPSLVYPARFCVAFPITFHAFAGIRHIYWDTFLKGINTKPAEFTGMIILAASLGVSLI 196

Query: 122 V 122
           V
Sbjct: 197 V 197


>gi|268590352|ref|ZP_06124573.1| succinate dehydrogenase, cytochrome b556 subunit [Providencia
           rettgeri DSM 1131]
 gi|291314262|gb|EFE54715.1| succinate dehydrogenase, cytochrome b556 subunit [Providencia
           rettgeri DSM 1131]
          Length = 129

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 7/126 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ      T   SI+HR++G +  +   ++++      +           
Sbjct: 5   VKKQRPVNLDLQTIHFPITAISSILHRVSGVITLIAVGILLWLLGTSLSSPEGFQYASEI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK------INIIASIL 117
           M G   +  L+    A+ +H+ GGIR+++ D   C+D+ +A   +       I +I +IL
Sbjct: 65  MTGFFAKFILWGILTALAYHICGGIRHMLMDFG-CVDETLAAGNSSAKITFVITVILAIL 123

Query: 118 TVLIVW 123
             ++VW
Sbjct: 124 AGVLVW 129


>gi|213408543|ref|XP_002175042.1| succinate dehydrogenase (ubiquinone) cytochrome b subunit
           [Schizosaccharomyces japonicus yFS275]
 gi|212003089|gb|EEB08749.1| succinate dehydrogenase (ubiquinone) cytochrome b subunit
           [Schizosaccharomyces japonicus yFS275]
          Length = 178

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 19/106 (17%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFC- 49
           ++  + +RP SPHL IY+   T ++S  HRITG          S  YL  P   + F   
Sbjct: 49  LAQQRVHRPNSPHLTIYQPQLTWYLSSAHRITGVALSGTLYLFSTAYLLAPAFGYGFDSN 108

Query: 50  -IANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
            IA   H +S +  ++         F+  + +  HM  G R+L+WD
Sbjct: 109 MIA---HAVSQVPVWLK----VPAKFIVAYPLAFHMFNGFRHLLWD 147


>gi|330929855|ref|XP_003302800.1| hypothetical protein PTT_14754 [Pyrenophora teres f. teres 0-1]
 gi|311321608|gb|EFQ89104.1| hypothetical protein PTT_14754 [Pyrenophora teres f. teres 0-1]
          Length = 177

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 48/106 (45%), Gaps = 15/106 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA------NGEH----T 56
           NRP+SPHL IYR   T   S ++RITG +V  G+     + F IA       G H    +
Sbjct: 53  NRPVSPHLAIYRPQITWLASSLNRITG-IVLSGS----LYLFGIAYLVAPYTGWHLETQS 107

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           + +       +V       Y +    H L G+R+L WDV +    +
Sbjct: 108 MVATVAAWPAAVKAGLKAFYAFPFFFHSLNGLRHLAWDVGVGFKNQ 153


>gi|119503172|ref|ZP_01625256.1| succinate dehydrogenase (C subunit) [marine gamma proteobacterium
           HTCC2080]
 gi|119460818|gb|EAW41909.1| succinate dehydrogenase (C subunit) [marine gamma proteobacterium
           HTCC2080]
          Length = 129

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 57/112 (50%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           K+ RP++  L   +L  T +VSI HR++G  ++L + ++V+        E   +S+   +
Sbjct: 7   KDKRPVNLDLGSMQLPITAYVSITHRLSGVFLFLVSGLMVWALDTSLRSEEGFNSVASTL 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
              + +  L+L   A+ +H L G++++I D  +    +     A+I I  +I
Sbjct: 67  TMPLSKAILWLIASALSYHALSGVKHIIMDFGIGETMQGGVTGARIVIALAI 118


>gi|271499747|ref|YP_003332772.1| succinate dehydrogenase, cytochrome b556 subunit [Dickeya dadantii
           Ech586]
 gi|270343302|gb|ACZ76067.1| succinate dehydrogenase, cytochrome b556 subunit [Dickeya dadantii
           Ech586]
          Length = 129

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 61/125 (48%), Gaps = 5/125 (4%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  R   T   SI+HR++G + ++   ++++      + +         
Sbjct: 5   VKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFVQAAAI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-KIATQMAK----INIIASILT 118
           M   + +  ++    A+ +H++GG+R+L+ D     +  +  ++ AK    I ++ S L 
Sbjct: 65  MGSFIVKFVVWGILTALAYHIVGGLRHLLMDFGYIEENFEAGSRSAKTSFIITVVLSFLA 124

Query: 119 VLIVW 123
            ++VW
Sbjct: 125 GVLVW 129


>gi|323353090|gb|EGA85390.1| YMR118C-like protein [Saccharomyces cerevisiae VL3]
          Length = 196

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 16/111 (14%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-------EH 55
           S +  RP+SPHL +Y    + ++S +HRI+G ++ LG     F+ F I  G       + 
Sbjct: 68  SQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALG-----FYAFTITLGVTTIMGMDT 122

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIH----HMLGGIRYLIWDVSLCLDKK 102
           T   L  +    + +   ++   +  +    H   GIR+LIWD+   L  +
Sbjct: 123 TFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNR 173


>gi|151946274|gb|EDN64505.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|190408347|gb|EDV11612.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|207342306|gb|EDZ70103.1| YMR118Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|259148692|emb|CAY81937.1| EC1118_1M3_2916p [Saccharomyces cerevisiae EC1118]
 gi|323303544|gb|EGA57336.1| YMR118C-like protein [Saccharomyces cerevisiae FostersB]
 gi|323307750|gb|EGA61013.1| YMR118C-like protein [Saccharomyces cerevisiae FostersO]
 gi|323336310|gb|EGA77581.1| YMR118C-like protein [Saccharomyces cerevisiae Vin13]
 gi|323347196|gb|EGA81471.1| YMR118C-like protein [Saccharomyces cerevisiae Lalvin QA23]
          Length = 196

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 16/126 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-------EH 55
           S +  RP+SPHL +Y    + ++S +HRI+G ++ LG     F+ F I  G       + 
Sbjct: 68  SQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALG-----FYAFTITLGVTTIMGMDT 122

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIH----HMLGGIRYLIWDVSLCLDKKIATQMAKIN 111
           T   L  +    + +   ++   +  +    H   GIR+LIWD+   L  +   +   I 
Sbjct: 123 TFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNRGVIKTGSIV 182

Query: 112 IIASIL 117
           +  +++
Sbjct: 183 LAGTLV 188


>gi|6323765|ref|NP_013836.1| hypothetical protein YMR118C [Saccharomyces cerevisiae S288c]
 gi|2493413|sp|Q04487|YM07_YEAST RecName: Full=Putative succinate dehydrogenase [ubiquinone]
           cytochrome b subunit, mitochondrial; Flags: Precursor
 gi|817878|emb|CAA89756.1| unknown [Saccharomyces cerevisiae]
 gi|45269828|gb|AAS56294.1| YMR118C [Saccharomyces cerevisiae]
 gi|285814120|tpg|DAA10015.1| TPA: hypothetical protein YMR118C [Saccharomyces cerevisiae S288c]
          Length = 196

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 16/111 (14%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-------EH 55
           S +  RP+SPHL +Y    + ++S +HRI+G ++ LG     F+ F I  G       + 
Sbjct: 68  SQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALG-----FYAFTITLGVTTIMGMDT 122

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIH----HMLGGIRYLIWDVSLCLDKK 102
           T   L  +    + +   ++   +  +    H   GIR+LIWD+   L  +
Sbjct: 123 TFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNR 173


>gi|56478026|ref|YP_159615.1| putative succinate dehydrogenase cytochrome B subunit (succinate
          dehydrogenase, cytochrome b556 subunit [Aromatoleum
          aromaticum EbN1]
 gi|56314069|emb|CAI08714.1| putative succinate dehydrogenase cytochrome B subunit (Succinate
          dehydrogenase, cytochrome b556 subunit [Aromatoleum
          aromaticum EbN1]
          Length = 128

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 25 VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHM 84
           SI HRI+G ++ +  P +         GE    +LR  +      + L +  WA  HH+
Sbjct: 25 ASIGHRISGVLLLITLPFLALALDRSLRGEAEFEALRDLVSAPGRALLLIVVVWAASHHV 84

Query: 85 LGGIRYLIWDVS 96
          L G+R+L+ D+ 
Sbjct: 85 LAGLRHLLMDLG 96


>gi|256269648|gb|EEU04929.1| YMR118C-like protein [Saccharomyces cerevisiae JAY291]
          Length = 196

 Score = 42.0 bits (97), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 16/111 (14%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-------EH 55
           S +  RP+SPHL +Y    + ++S +HRI+G ++ LG     F+ F I  G       + 
Sbjct: 68  SQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALG-----FYAFTITLGVTTIMGMDT 122

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIH----HMLGGIRYLIWDVSLCLDKK 102
           T   L  +    + +   ++   +  +    H   GIR+LIWD+   L  +
Sbjct: 123 TFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNR 173


>gi|77457837|ref|YP_347342.1| succinate dehydrogenase subunit C [Pseudomonas fluorescens Pf0-1]
 gi|77381840|gb|ABA73353.1| succinate dehydrogenase cytochrome b556 subunit [Pseudomonas
           fluorescens Pf0-1]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K+ RP++  L+  +L  T   S +HR++G +++LG  ++++        E     ++  
Sbjct: 1   MKSQRPVNLDLRTIKLPITGVTSFLHRVSGIILFLGLGIMLYALGKSLGSEEGYVEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + +   +    A+++H++ G+R+LI D+ +    +     +K+ I  S++ +++  
Sbjct: 61  LTSPLAKFVAWGLLSALLYHLVAGVRHLIMDMGIGETLEGGRLGSKLIIAVSVVLIVLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|85058850|ref|YP_454552.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Sodalis glossinidius str. 'morsitans']
 gi|84779370|dbj|BAE74147.1| succinate dehydrogenase cytochrome b-556 subunit [Sodalis
           glossinidius str. 'morsitans']
          Length = 128

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 60/126 (47%), Gaps = 5/126 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  R   T  VSI+HR++G ++++   ++++      +         
Sbjct: 3   KTVKKQRPVNLDLQTIRFPVTAIVSILHRVSGVIMFVAIGILLWVLGLSLSSPEGFIQAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASI 116
             MD  + +   +    A+ +H L GIR+++ D      +L + K  A     + ++ SI
Sbjct: 63  AMMDSFIVKFIFWGILTALAYHTLCGIRHMLMDFGYLEETLAMGKTTANVTFLLTVVLSI 122

Query: 117 LTVLIV 122
           L  ++V
Sbjct: 123 LAGVLV 128


>gi|328772132|gb|EGF82171.1| hypothetical protein BATDEDRAFT_36733 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 205

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           S + +RP+SPHL IY+   T ++S   R T   + +G   V   +  +      ++S   
Sbjct: 83  SERLHRPISPHLTIYQPQLTWYLSAAFRATSGALAVGFYGVALAYVFLPISSVAIASFIH 142

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            +  +   +  F     +  H+  G+R+LIWD +  L+ K
Sbjct: 143 SLPAAALFLGKFTLAAPISFHLFNGLRHLIWDTATLLNLK 182


>gi|296112295|ref|YP_003626233.1| succinate dehydrogenase subunit C [Moraxella catarrhalis RH4]
 gi|295919989|gb|ADG60340.1| succinate dehydrogenase subunit C [Moraxella catarrhalis RH4]
          Length = 126

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (51%), Gaps = 19/133 (14%)

Query: 4   IKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           +K+NRP    LS  + +    P    SI+HR++G V++L  PV++    CI   + +LSS
Sbjct: 1   MKSNRPINLPLSQVIAVNSKSPIAMASILHRVSGIVLFLLVPVML----CIL--QTSLSS 54

Query: 60  LRCYMDGSVF-EVCLFLYTW----AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-II 113
              +   +VF  + L    W    A  +H + GI++L+ D  +  + K     A I+ +I
Sbjct: 55  ADSF--AAVFNNIALRFVAWIFVAATAYHFVMGIKHLLADAGMNEELKSGRTAAVISFVI 112

Query: 114 ASILTVL-IVWII 125
           A++L V   VW++
Sbjct: 113 AAVLIVASFVWVM 125


>gi|226287137|gb|EEH42650.1| succinate dehydrogenase cytochrome b560 subunit [Paracoccidioides
           brasiliensis Pb18]
          Length = 188

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 15/106 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSLRCYM 64
           NRP+SPHL IY+   T  +S ++RITG V   G+  +   F+ ++   G H    L  +M
Sbjct: 64  NRPVSPHLSIYQPQVTWVLSSLNRITG-VALAGSLYIFSSFYLVSPLLGWH----LESHM 118

Query: 65  DGSVFEVCLFL------YTWAV--IHHMLGGIRYLIWDVSLCLDKK 102
             + F            +T AV  + H L G R+LIWD+      K
Sbjct: 119 IAAAFGALPLAAKVGLKFTAAVPFMFHALNGCRHLIWDLGKQFSNK 164


>gi|237730685|ref|ZP_04561166.1| succinate dehydrogenase cytochrome b-556 subunit [Citrobacter sp.
           30_2]
 gi|226906224|gb|EEH92142.1| succinate dehydrogenase cytochrome b-556 subunit [Citrobacter sp.
           30_2]
          Length = 146

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 62/126 (49%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +      +   
Sbjct: 21  NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFLTASS 80

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-KIATQMAKIN----IIASIL 117
            M+    E+ L+    A+ +H + GIR+L+ D     +  +  T+ AKI     ++ S+L
Sbjct: 81  IMNNFFVELILWGILIALAYHAVMGIRHLLMDFGYIEETLEAGTRSAKICFVIIVVLSLL 140

Query: 118 TVLIVW 123
             ++VW
Sbjct: 141 AGVLVW 146


>gi|118781278|ref|XP_311387.3| AGAP010672-PA [Anopheles gambiae str. PEST]
 gi|116130095|gb|EAA07051.3| AGAP010672-PA [Anopheles gambiae str. PEST]
          Length = 175

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 51/122 (41%), Gaps = 11/122 (9%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA---NGEHTLSSLRCY 63
            RP SPHL IY    T  +SI HR TG  + L   +       +A   +  H L+ L   
Sbjct: 57  KRPQSPHLTIYSFQLTSMLSITHRFTG--LALTGYITALGLGALAMPHDATHYLTMLEG- 113

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA-----TQMAKINIIASILT 118
           +         F   +   +H + G+R+L WD+   L  K       T +    ++A +LT
Sbjct: 114 LSAPTLIALKFTMAYPFAYHTVNGVRHLFWDMGKFLTIKEVYTTGYTMLGVSGVLAGLLT 173

Query: 119 VL 120
            L
Sbjct: 174 AL 175


>gi|242238586|ref|YP_002986767.1| succinate dehydrogenase, cytochrome b556 subunit [Dickeya dadantii
           Ech703]
 gi|242130643|gb|ACS84945.1| succinate dehydrogenase, cytochrome b556 subunit [Dickeya dadantii
           Ech703]
          Length = 129

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 63/126 (50%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           S+K  RP++  LQ  R   T   SI+HR++G + ++   ++++      + +        
Sbjct: 4   SVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFVHAAA 63

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA-TQMAKIN----IIASIL 117
            M   + +  ++    A+ +H++GG+R+L+ D     +   A +  AKI+    ++ S+L
Sbjct: 64  IMGSFIVKFIVWGILTALSYHIVGGLRHLLMDFGYIEETFAAGSSSAKISFIITVVLSLL 123

Query: 118 TVLIVW 123
             ++VW
Sbjct: 124 AGVLVW 129


>gi|312959839|ref|ZP_07774355.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           fluorescens WH6]
 gi|311286005|gb|EFQ64570.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           fluorescens WH6]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T   S +HR++G +++LG  ++++        E   + ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPITGVTSFLHRVSGIILFLGLGIMLYALSKSLGSEEGYAEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + +   +    A+++H++ G+R+LI D+ +    +     +KI I  S++ +++  
Sbjct: 61  LTSPLAKFVAWGLLSALLYHLVAGVRHLIMDMGIGETLEGGRLGSKIIIAISVVLIVLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|119897840|ref|YP_933053.1| succinate dehydrogenase [Azoarcus sp. BH72]
 gi|119670253|emb|CAL94166.1| succinate dehydrogenase [Azoarcus sp. BH72]
          Length = 129

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 62/120 (51%), Gaps = 1/120 (0%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +++  RP    +   RL     VSI+HR++G+ ++L  P +++          + ++   
Sbjct: 5   TVRKQRPKHLAINEIRLPLPGIVSILHRVSGAGLFLLLPFLLYLLDRSLGSPESFATFEA 64

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI-LTVLI 121
            +   + ++ L    WA +HH   GIR+L+ D+   L+ + A   ++I ++ SI LTV+I
Sbjct: 65  VVGHPLVKLILIGLLWAFLHHFCAGIRFLLLDLHKGLELQAARNSSRIVLVVSIALTVII 124


>gi|87119172|ref|ZP_01075070.1| succinate dehydrogenase (C subunit) [Marinomonas sp. MED121]
 gi|86165563|gb|EAQ66830.1| succinate dehydrogenase (C subunit) [Marinomonas sp. MED121]
          Length = 138

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 64/124 (51%), Gaps = 3/124 (2%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RP++  +    +  T  VSI+HR+TG ++++G   + + F    + +     +   
Sbjct: 14  VNKKRPVNLDIATISMPVTAIVSILHRVTGVILFVGLAFLFYAFDLSLDSQEGFDQVVNA 73

Query: 64  MDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTVLI 121
           +  S + +  ++    A+++H + GI++L  D+    + +     AK N +IA+IL +++
Sbjct: 74  LQTSFIAKFIIWGVVSALMYHFVAGIKHLFMDIGYFEELESGQLAAKANLVIAAILILVV 133

Query: 122 -VWI 124
            VWI
Sbjct: 134 GVWI 137


>gi|156934786|ref|YP_001438702.1| hypothetical protein ESA_02626 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533040|gb|ABU77866.1| hypothetical protein ESA_02626 [Cronobacter sakazakii ATCC BAA-894]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           +  +   RP++  L   R   T   SI+HR++G + ++   ++++      + +    + 
Sbjct: 2   IKKVNKQRPVNLDLTTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFLTA 61

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK-----INIIAS 115
              MD    +  L+    A+ +H++GG+R+++ D     +   A Q +      I ++ S
Sbjct: 62  SNIMDSFFVKFILWGILTALAYHVVGGVRHMLMDFGYLEETFAAGQRSAKFAFIITVVLS 121

Query: 116 ILTVLIVW 123
           IL  ++VW
Sbjct: 122 ILAGVLVW 129


>gi|90411595|ref|ZP_01219605.1| putative succinate dehydrogenase; fumarate reductase, cytochrome
           bsubunit [Photobacterium profundum 3TCK]
 gi|90327485|gb|EAS43838.1| putative succinate dehydrogenase; fumarate reductase, cytochrome
           bsubunit [Photobacterium profundum 3TCK]
          Length = 126

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 63/125 (50%), Gaps = 6/125 (4%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRC 62
           +K  RP++  LQ  R   T   SI+HR++G + ++   +++ W   I+ +     +S   
Sbjct: 3   VKKPRPVNLDLQTIRFPLTAIASILHRVSGVITFVSVAILL-WLLNISLSSPEGFASAAS 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTVL- 120
             D    +  L+    A+ +H++ G+R+LI D+    + +      K++ +I ++L+V  
Sbjct: 62  IADSFFVKFILWGVLTALFYHIVVGVRHLIMDMGYFEEMETGIASTKVSFVIVAVLSVFA 121

Query: 121 --IVW 123
             +VW
Sbjct: 122 GGLVW 126


>gi|326387615|ref|ZP_08209221.1| succinate dehydrogenase subunit C [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207661|gb|EGD58472.1| succinate dehydrogenase subunit C [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 120

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 12/113 (10%)

Query: 23  MFVSIVHRITGSVVYLGTPVVVFWFF-CIANGEHTLSSLRCYM---DGS--------VFE 70
           M VSI+HR+TG+ +      ++ W+   IA GE +  +   ++    GS        + +
Sbjct: 1   MLVSILHRVTGNGLAFAGLALLLWWVGAIAGGEQSYQTFISFVWTGAGSPLAALTAILAK 60

Query: 71  VCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           + L   TWA   HM  G+R+L+ D+ +  +     + + + ++ S+L   + W
Sbjct: 61  LVLVGLTWAFFQHMASGLRHLVLDIGVGYELHTNARWSVLTLVFSVLATALFW 113


>gi|261341308|ref|ZP_05969166.1| succinate dehydrogenase, cytochrome b556 subunit [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316612|gb|EFC55550.1| succinate dehydrogenase, cytochrome b556 subunit [Enterobacter
           cancerogenus ATCC 35316]
          Length = 134

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L+  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLKTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLD-----KKIATQMAKIN 111
           ++  S      F+    W ++    +H++GG+R+++ D     +     K+ A     + 
Sbjct: 63  FLQASAIMNSFFVKFIMWGILTALAYHVVGGVRHMLMDFGYLEETFEAGKRSANISFVLT 122

Query: 112 IIASILTVLIVW 123
           ++ SIL  ++VW
Sbjct: 123 VVLSILAGVLVW 134


>gi|225717610|gb|ACO14651.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Caligus clemensi]
          Length = 173

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 9/94 (9%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----SVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           NRP+SPHL IY+   T  +SI HRI+G    +++Y G     F  F + N   T      
Sbjct: 56  NRPMSPHLTIYKPQLTSMLSISHRISGMYLTAILYSGG----FLPFVLPNNFPTFIQ-SI 110

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
            +   +     F   +    H   G+R+L+WD+ 
Sbjct: 111 EIAPLLVTAGKFAIAFPFAFHTYNGLRHLLWDMG 144


>gi|71278847|ref|YP_268940.1| succinate dehydrogenase, cytochrome b556 subunit [Colwellia
          psychrerythraea 34H]
 gi|71144587|gb|AAZ25060.1| succinate dehydrogenase, cytochrome b556 subunit [Colwellia
          psychrerythraea 34H]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 49/93 (52%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
          +K  RP++  L   ++ P    SI+HR++G ++     +++F      +     + ++ Y
Sbjct: 1  MKKQRPVNLDLTTIKMHPAANASILHRVSGVIMVFAIGILLFTLSTSLSSAEGFAQIQGY 60

Query: 64 MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
          +DG  F+  +F    A+  H+L G+R+L+ D+ 
Sbjct: 61 LDGFFFKFIIFGCLSALTFHVLAGVRHLLMDLG 93


>gi|209738020|gb|ACI69879.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 12/121 (9%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE-------HTL 57
           K NRP+SPH+ IY+    M +SI HR TG  +  G          +           H+L
Sbjct: 47  KLNRPMSPHITIYQWSVPMMMSITHRGTGVGLSGGILAFALLALVLPGNYPYYLDLIHSL 106

Query: 58  SSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
           S     +  ++  +  F   + + +H L GIR+L WD           +   + I+ SIL
Sbjct: 107 S-----IGPALLGLAKFGIAFPLSYHTLNGIRHLFWDSGKGFTLPEVYRSGYVVIVLSIL 161

Query: 118 T 118
           T
Sbjct: 162 T 162


>gi|255949166|ref|XP_002565350.1| Pc22g14260 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592367|emb|CAP98714.1| Pc22g14260 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 187

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 47/110 (42%), Gaps = 21/110 (19%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP++PHL IY+       S +HRITG          +  YL +P  + W    A     
Sbjct: 64  NRPVAPHLTIYKPQIGWIGSSLHRITGVALSGTLYIWATAYLASP-ALGWHLESA----- 117

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVI---HHMLGGIRYLIWDVSLCLDKKI 103
             S+   M        + L T   +   +H + GIR+L+WD+   L   +
Sbjct: 118 --SMVAAMGALPLAAKVLLKTTLALPFTYHAMNGIRHLMWDLGRGLTNPV 165


>gi|160897868|ref|YP_001563450.1| succinate dehydrogenase, cytochrome b556 subunit [Delftia
           acidovorans SPH-1]
 gi|160363452|gb|ABX35065.1| succinate dehydrogenase, cytochrome b556 subunit [Delftia
           acidovorans SPH-1]
          Length = 140

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS----VF 69
           L  YRL P   VSI+HRI+G ++++  P +++        E +         G     + 
Sbjct: 20  LPTYRLPPAGIVSILHRISGLLMFILLPFILWMMDMSLTSEISFDGFTSVFAGPFGWFLK 79

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDVS 96
            VCL L  WA +HH   G+R+L  DV+
Sbjct: 80  LVCLAL-IWAYLHHFCAGVRHLFMDVN 105


>gi|242788126|ref|XP_002481157.1| succinate dehydrogenase, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218721304|gb|EED20723.1| succinate dehydrogenase, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 194

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 11/106 (10%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
            RP+SPH+ IY+       SI+ R +G          +  Y+ TP+V   +  + + E  
Sbjct: 66  RRPVSPHMTIYKWQYQSLTSILQRFSGIFLAGGLYVFATGYVLTPIVSPGYTDLFDIETI 125

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           + +LR  + G +  V  F  +    +H   G+++L+WD+ + L  K
Sbjct: 126 VGALRE-VPGWIKGVGKFALSMPFTYHFYNGVKHLMWDLGVGLSHK 170


>gi|300715874|ref|YP_003740677.1| succinate dehydrogenase cytochrome b-556 subunit [Erwinia
           billingiae Eb661]
 gi|299061710|emb|CAX58826.1| Succinate dehydrogenase cytochrome b-556 subunit [Erwinia
           billingiae Eb661]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  L   R   T   SI+HR++G + ++   ++++      +         
Sbjct: 3   KTVKKQRPVNLDLSTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSPEGFLQAS 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKIN----IIASI 116
             M     +  ++    A+ +H++GGIR+++ D   L    +I T+ A+I+    ++ SI
Sbjct: 63  AVMGSFFVKFIMWGILTALAYHIVGGIRHMLMDFGYLGETLQIGTRSAQISFGITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|295687606|ref|YP_003591299.1| succinate dehydrogenase cytochrome b556 subunit [Caulobacter segnis
           ATCC 21756]
 gi|295429509|gb|ADG08681.1| succinate dehydrogenase, cytochrome b556 subunit [Caulobacter
           segnis ATCC 21756]
          Length = 135

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ++R   TM  SI+HR     +++G  ++  W   +A G    +     +  
Sbjct: 10  ERPMSPHLQVWRWHITMACSILHRACVVGLWVGAVILAGWAAALAAGPDAYAGYTAVLGS 69

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
            + ++ L   T+AV  ++   IR   WD       + A     + I  ++   ++ W+I
Sbjct: 70  PIGKLVLLGETFAVFFNVAYTIRQTFWDAGKGFQPRTADMTGAMAIAFAVAATIVTWVI 128


>gi|149040640|gb|EDL94597.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_d [Rattus norvegicus]
          Length = 140

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 27/98 (27%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +  +NRP+SPHL IYR    M +S+ HR  GS + +   V +F                 
Sbjct: 45  NTSSNRPVSPHLTIYRWSLPMAMSVCHR--GSGIAMSGGVSLFGLS-------------- 88

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
                      F+  + +++H L G+R+L+WD+   L 
Sbjct: 89  -----------FVLVFPLMYHSLNGVRHLMWDLGKGLS 115


>gi|241950825|ref|XP_002418135.1| succinate dehydrogenase cytochrome b subunit, mitochondrial
           precursor, putative [Candida dubliniensis CD36]
 gi|223641474|emb|CAX43435.1| succinate dehydrogenase cytochrome b subunit, mitochondrial
           precursor, putative [Candida dubliniensis CD36]
          Length = 176

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 46/102 (45%), Gaps = 19/102 (18%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRP SPHLQIY+   T  +S  HRITG V   G       F+ +  G    S L    
Sbjct: 50  RKNRPTSPHLQIYQPQLTWIMSSFHRITG-VAMAGA------FYGLTCGFAATSILNIPF 102

Query: 65  DGSV---FEVCLFLY---------TWAVIHHMLGGIRYLIWD 94
           D +    +   L ++          +  + H+  GIR+LIWD
Sbjct: 103 DTTTLISYFTALPIFAQYGLKAICAYPFVFHIGNGIRHLIWD 144


>gi|317047341|ref|YP_004114989.1| succinate dehydrogenase, cytochrome b556 subunit [Pantoea sp.
           At-9b]
 gi|316948958|gb|ADU68433.1| succinate dehydrogenase, cytochrome b556 subunit [Pantoea sp.
           At-9b]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  L   R   T   SI+HR++G + ++   ++++      +         
Sbjct: 3   KTVKKQRPVNLDLSTIRFPVTAISSILHRVSGVITFVALGILLWLLGLSLSSPEGFLQAA 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-KIATQMAK----INIIASI 116
             MD    +  ++    A+ +H++GGIR+++ D     +  ++ T+ A+    I ++ SI
Sbjct: 63  SIMDSFFAKFIMWGILTALAYHVVGGIRHMLADFGFMEETLQVGTRSAQAAFVITVVLSI 122

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 123 LAGVLVW 129


>gi|218847754|ref|NP_001136371.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Xenopus (Silurana) tropicalis]
 gi|163915714|gb|AAI57547.1| LOC496650 protein [Xenopus (Silurana) tropicalis]
          Length = 169

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           NRPLSPH+ IY+    M +SI HR TG  +  G  V +F    +       S L      
Sbjct: 49  NRPLSPHITIYKWSLPMAMSISHRGTGIAMTAG--VSLFGLAALVLPGDFASYLELVKSL 106

Query: 67  SVFEVCL----FLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           S+    +    F   + + +H+  GIR+L WD+   L 
Sbjct: 107 SLGPALIYSAKFALAFPLTYHVWNGIRHLTWDLGKGLK 144


>gi|242021634|ref|XP_002431249.1| succinate dehydrogenase, cytochrome B560 subunit [Pediculus humanus
           corporis]
 gi|212516503|gb|EEB18511.1| succinate dehydrogenase, cytochrome B560 subunit [Pediculus humanus
           corporis]
          Length = 220

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 49/101 (48%), Gaps = 12/101 (11%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR----CY 63
           RP SPHL IY+      +SI HR TG  + LG   V F    + + +  L  ++    CY
Sbjct: 35  RPTSPHLTIYKFELPAVLSISHRFTG--IILGGYAVTFATVSLLSSKPMLDVVQRISHCY 92

Query: 64  MDGS-VFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
                +F+V L F +T+    H   G+R+L+WD    L  K
Sbjct: 93  PGFFLIFKVGLIFPFTY----HFFNGVRHLVWDNGKSLSLK 129


>gi|260597120|ref|YP_003209691.1| succinate dehydrogenase cytochrome b556 subunit [Cronobacter
           turicensis z3032]
 gi|260216297|emb|CBA29263.1| Succinate dehydrogenase cytochrome b556 subunit [Cronobacter
           turicensis z3032]
          Length = 129

 Score = 41.2 bits (95), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           +  +   RP++  L   R   T   SI+HR++G + ++   ++++      + +    + 
Sbjct: 2   IKKVNKQRPVNLDLTTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFLTA 61

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK-----INIIAS 115
              MD    +  ++    A+ +H++GGIR+++ D     +   A Q +      I ++ S
Sbjct: 62  SDIMDSFFVKFIMWGILTALAYHVVGGIRHMLMDFGYLEETFAAGQRSAKFAFIITVVLS 121

Query: 116 ILTVLIVW 123
           IL  ++VW
Sbjct: 122 ILAGVLVW 129


>gi|290510449|ref|ZP_06549819.1| LOW QUALITY PROTEIN: succinate dehydrogenase, cytochrome b556
           subunit [Klebsiella sp. 1_1_55]
 gi|289777165|gb|EFD85163.1| LOW QUALITY PROTEIN: succinate dehydrogenase, cytochrome b556
           subunit [Klebsiella sp. 1_1_55]
          Length = 147

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +      +   
Sbjct: 22  NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFLTAAS 81

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASIL 117
            MD    +  ++    A+ +H++ GIR+L+ D      +L   K+ A     I ++ S+L
Sbjct: 82  IMDSFFVKFIMWGILTALAYHVVVGIRHLMMDFGYLDETLEAGKRSAKISFVITVVLSLL 141

Query: 118 TVLIVW 123
             ++VW
Sbjct: 142 AGVLVW 147


>gi|138519774|gb|AAI35209.1| LOC496650 protein [Xenopus (Silurana) tropicalis]
          Length = 164

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           NRPLSPH+ IY+    M +SI HR TG  +  G  V +F    +       S L      
Sbjct: 44  NRPLSPHITIYKWSLPMAMSISHRGTGIAMTAG--VSLFGLAALVLPGDFASYLELVKSL 101

Query: 67  SVFEVCL----FLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           S+    +    F   + + +H+  GIR+L WD+   L 
Sbjct: 102 SLGPALIYSAKFALAFPLTYHVWNGIRHLTWDLGKGLK 139


>gi|56611131|gb|AAH87773.1| LOC496650 protein [Xenopus (Silurana) tropicalis]
          Length = 167

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           NRPLSPH+ IY+    M +SI HR TG  +  G  V +F    +       S L      
Sbjct: 47  NRPLSPHITIYKWSLPMAMSISHRGTGIAMTAG--VSLFGLAALVLPGDFASYLELVKSL 104

Query: 67  SVFEVCL----FLYTWAVIHHMLGGIRYLIWDVSLCLD 100
           S+    +    F   + + +H+  GIR+L WD+   L 
Sbjct: 105 SLGPALIYSAKFALAFPLTYHVWNGIRHLTWDLGKGLK 142


>gi|290474115|ref|YP_003466992.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Xenorhabdus bovienii SS-2004]
 gi|289173425|emb|CBJ80202.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Xenorhabdus bovienii SS-2004]
          Length = 129

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L+      +   SI+HRI+G + ++   +++ W   +     +LSS   +
Sbjct: 5   VKKQRPVNLDLRTINQPVSAITSILHRISGVITFIAVGILL-WLLGM-----SLSSQEGF 58

Query: 64  MDGSVFEVCLF--LYTWAVI----HHMLGGIRYLIWDVSLCLDKKIATQMAK------IN 111
           +  S      F     W ++    +H+ GGIR+++ D    L++ +AT  A       I 
Sbjct: 59  LQASEIMTGFFAKFILWGILTALAYHICGGIRHVLMDFGF-LEENLATGSASAKVAIVIA 117

Query: 112 IIASILTVLIVW 123
           +I SIL  +++W
Sbjct: 118 VILSILAGVLLW 129


>gi|206581019|ref|YP_002239654.1| succinate dehydrogenase, cytochrome b556 subunit [Klebsiella
           pneumoniae 342]
 gi|238893759|ref|YP_002918493.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Klebsiella pneumoniae NTUH-K2044]
 gi|262041216|ref|ZP_06014428.1| succinate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936496|ref|YP_003440555.1| succinate dehydrogenase, cytochrome b556 subunit [Klebsiella
           variicola At-22]
 gi|329998780|ref|ZP_08303215.1| succinate dehydrogenase, cytochrome b556 subunit [Klebsiella sp. MS
           92-3]
 gi|206570077|gb|ACI11853.1| succinate dehydrogenase, cytochrome b556 subunit [Klebsiella
           pneumoniae 342]
 gi|238546075|dbj|BAH62426.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259041445|gb|EEW42504.1| succinate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891205|gb|ADC59523.1| succinate dehydrogenase, cytochrome b556 subunit [Klebsiella
           variicola At-22]
 gi|328538566|gb|EGF64671.1| succinate dehydrogenase, cytochrome b556 subunit [Klebsiella sp. MS
           92-3]
          Length = 134

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +      +   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFLTAAS 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASIL 117
            MD    +  ++    A+ +H++ GIR+L+ D      +L   K+ A     I ++ S+L
Sbjct: 69  IMDSFFVKFIMWGILTALAYHVVVGIRHLMMDFGYLDETLEAGKRSAKISFVITVVLSLL 128

Query: 118 TVLIVW 123
             ++VW
Sbjct: 129 AGVLVW 134


>gi|71019831|ref|XP_760146.1| hypothetical protein UM03999.1 [Ustilago maydis 521]
 gi|46099776|gb|EAK85009.1| hypothetical protein UM03999.1 [Ustilago maydis 521]
          Length = 193

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 43/112 (38%), Gaps = 28/112 (25%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITG---SVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           +  RP SPH  IY+   T  +SI++RITG   SV Y G P+                S  
Sbjct: 73  RAQRPSSPHFTIYQPQITWLLSIINRITGTGLSVSYAGYPL--------------FGSAE 118

Query: 62  CYMDGSVFEVCLFLYTW-----------AVIHHMLGGIRYLIWDVSLCLDKK 102
                S+ +    L  W           A   H L G+R+L WD    L  K
Sbjct: 119 ALSSASLTDFVATLPAWFKTAVKAPLALAFSFHSLNGLRHLAWDWGFALTIK 170


>gi|195038263|ref|XP_001990579.1| GH19425 [Drosophila grimshawi]
 gi|193894775|gb|EDV93641.1| GH19425 [Drosophila grimshawi]
          Length = 170

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 7/123 (5%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGT-PVVVFWFFCIANGEHTLSSLR 61
           ++K  R LSPHL IY++  T  +SI+ RI+G V+ +G   + +   FC  +     + + 
Sbjct: 14  NMKLGRELSPHLTIYKIQLTSAMSILLRISGFVLGMGFWAIGLMGLFCNMDINELATKIE 73

Query: 62  CY-MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK--IATQMAKIN---IIAS 115
            + +  +      F+      +HM+ G R+LI+ +++ L KK   AT  A +    I+A+
Sbjct: 74  EFELSKNFLSFLKFIIILPFAYHMVVGTRHLIFYLNVFLSKKGIYATGYAALAMTLIVAA 133

Query: 116 ILT 118
            LT
Sbjct: 134 ALT 136


>gi|66820248|ref|XP_643757.1| succinate dehydrogenase [Dictyostelium discoideum AX4]
 gi|74843770|sp|Q8T2T5|C560_DICDI RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; Flags: Precursor
 gi|60471884|gb|EAL69838.1| succinate dehydrogenase [Dictyostelium discoideum AX4]
          Length = 192

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG-TPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +P SPHL IY+      +SI+HR TG  + LG T +     F   +  H +  L      
Sbjct: 71  QPTSPHLTIYKFPLPAVMSIMHRATGICLALGITGLAGVTLFAPHDAIHYIQLLHTQYPA 130

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
            V+    F     + +H   G+R++IWD
Sbjct: 131 LVYP-AKFAVALPLTYHFCTGVRHIIWD 157


>gi|300722382|ref|YP_003711668.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Xenorhabdus nematophila ATCC 19061]
 gi|297628885|emb|CBJ89468.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Xenorhabdus nematophila ATCC 19061]
          Length = 129

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L+      +   SI+HRI+G + ++   +++ W   +     +LSS   +
Sbjct: 5   VKKQRPVNLDLRTINQPVSAIASILHRISGVITFIAVGILL-WLLGM-----SLSSQEGF 58

Query: 64  MDGSVFEVCLF--LYTWAVI----HHMLGGIRYLIWDVSLCLDKKIATQMAK------IN 111
           +  S      F     W ++    +H+ GGIR+++ D    L++ +AT  A       I 
Sbjct: 59  LQSSEIMTGFFAKFILWGILTALAYHICGGIRHVLMDFGF-LEENLATGSASAKVAIVIA 117

Query: 112 IIASILTVLIVW 123
           +I SIL  +++W
Sbjct: 118 VILSILAGVLLW 129


>gi|326468741|gb|EGD92750.1| succinate dehydrogenase C subunit [Trichophyton tonsurans CBS
           112818]
 gi|326481350|gb|EGE05360.1| succinate dehydrogenase cytochrome b560 subunit [Trichophyton
           equinum CBS 127.97]
          Length = 191

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 19/111 (17%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSV----------VYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T ++S ++RITG++           YL +P++ +     +     
Sbjct: 68  NRPISPHLSIYRPQITWYLSSLNRITGAILSGGLYIFASAYLVSPLLGWHLESASLAAAF 127

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
            +       G  F + L         H   G+R+L+WD    L K++  Q 
Sbjct: 128 AALPIAAKVGMKFTMAL-----PFTFHCFNGVRHLVWD----LGKQLTNQQ 169


>gi|289616414|emb|CBI56941.1| unnamed protein product [Sordaria macrospora]
          Length = 180

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 24/110 (21%)

Query: 7   NRPLSPHLQIYRLIPTMFV-SIVHRITGS----------VVYLGTPVVVFWFFCIANGEH 55
           +RP+SPHL+IY    T F  S   RITG+          V YL  P+V         G H
Sbjct: 55  SRPVSPHLEIYDPKQTWFGGSAWQRITGASFSGALYASAVAYLAAPLV---------GWH 105

Query: 56  TLSS----LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
             SS        +  +V     FL  W  + H + G+R+L +DV +   +
Sbjct: 106 LESSSLIAAAAALPVAVKGGLKFLVAWPFVFHAINGVRHLAFDVGVGFGR 155


>gi|219112939|ref|XP_002186053.1| succinate dehydrogenase cytochrome b subunit [Phaeodactylum
           tricornutum CCAP 1055/1]
 gi|209582903|gb|ACI65523.1| succinate dehydrogenase cytochrome b subunit [Phaeodactylum
           tricornutum CCAP 1055/1]
          Length = 167

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 2   SSIKNN-RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------E 54
           S +KN+ RP+SPH+ +Y        SI +R+TG V+  G   +        +G      +
Sbjct: 41  SRMKNSGRPVSPHVTVYNFPIAAVASITNRVTGCVLSFGALGLGAAELLGGSGSALYIMQ 100

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
              S       GS F +     ++ +++H  GG+R+L+WD
Sbjct: 101 FVGSQGMLISAGSKFAI-----SFPIVYHYGGGLRHLMWD 135


>gi|14861484|gb|AAK73692.1|AF362739_1 succinate dehydrogenase subunit 3 [Gossypium hirsutum]
          Length = 201

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE--HTLSSLRCY 63
           N RPLSPHL IY+   +  +SI +RI+G  V+L T ++  +   +  G    T S+   +
Sbjct: 105 NLRPLSPHLPIYKPQLSATLSITNRISG--VFLTTALLFSYLLSLKMGSICFTYSNFYQF 162

Query: 64  M--DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
                 +  V + +   AV +H+  G+R+L+ D S
Sbjct: 163 FFYSAKLAPVTVSIAALAVSYHLCYGVRHLLADFS 197


>gi|253990452|ref|YP_003041808.1| succinate dehydrogenase cytochrome b-556 subunit [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211638981|emb|CAR67596.1| succinate dehydrogenase cytochrome b-556 subunit [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781902|emb|CAQ85066.1| succinate dehydrogenase cytochrome b-556 subunit [Photorhabdus
           asymbiotica]
          Length = 129

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 17/131 (12%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ      +   SI+HR++G + ++   +++ W   +     +LSS   +
Sbjct: 5   VKKQRPVNLDLQTIHFPVSAVASILHRVSGVITFIAVGILL-WLLGM-----SLSSQEGF 58

Query: 64  MDGSVFEVCLF--LYTWAVI----HHMLGGIRYLIWDVS-LCLDKKIATQMAKINI---- 112
              +      F     W ++    +H+ GGIR+L+ D   L  +  + +  AK+ I    
Sbjct: 59  QQAADIMTSFFAKFIVWGILTALAYHICGGIRHLLMDFGYLEENLAVGSASAKVAIVLAV 118

Query: 113 IASILTVLIVW 123
           I SIL  ++VW
Sbjct: 119 ILSILAGVLVW 129


>gi|268572383|ref|XP_002641307.1| C. briggsae CBR-MEV-1 protein [Caenorhabditis briggsae]
 gi|1169193|sp|P41955|C560_CAEBR RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; Flags: Precursor
 gi|450581|gb|AAA20078.1| CDS structure deduced from alignment with C. elegans cyt-1 gene
           [Caenorhabditis briggsae]
 gi|187039998|emb|CAP21181.1| CBR-MEV-1 protein [Caenorhabditis briggsae AF16]
          Length = 184

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 8/100 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP++PHL IY+   T  +S  HRI+G V+  GT +V    F +   + T  +   Y+ G
Sbjct: 51  KRPIAPHLTIYQPQLTWMLSGFHRISGCVM-AGTLLVGGLGFAVLPLDFT--TFVEYIRG 107

Query: 67  -----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
                +V  V  ++  + +I H L GIR+L +D++  +D 
Sbjct: 108 WNLPCAVTAVFKYIIAFPIIFHTLNGIRFLGFDLAKGVDN 147


>gi|264679525|ref|YP_003279432.1| succinate dehydrogenase, cytochrome b subunit [Comamonas
           testosteroni CNB-2]
 gi|299530384|ref|ZP_07043807.1| succinate dehydrogenase, cytochrome b556 subunit [Comamonas
           testosteroni S44]
 gi|262210038|gb|ACY34136.1| succinate dehydrogenase, cytochrome b subunit [Comamonas
           testosteroni CNB-2]
 gi|298721609|gb|EFI62543.1| succinate dehydrogenase, cytochrome b556 subunit [Comamonas
           testosteroni S44]
          Length = 141

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 7/114 (6%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS----VF 69
           L  YRL     VSI+HR++G ++ +  P +++ F    + E +  S      G       
Sbjct: 21  LPTYRLPLAGIVSILHRVSGLLMAILLPFIIWMFDNSISSEISFDSFTSVFAGPFGWFAK 80

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASI-LTVLI 121
            VCL L  WA +HH   G+R+L+ DV+   ++K+     A + +  S+ LTV++
Sbjct: 81  LVCLAL-IWAYLHHFCAGVRHLVMDVNHHAVNKQTGKSTAAVVLCISVALTVVL 133


>gi|312375419|gb|EFR22798.1| hypothetical protein AND_14194 [Anopheles darlingi]
          Length = 192

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 10/95 (10%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHR-----ITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            RP SPHL IY    T  +SI HR     +TG +  LG   +V       +  H L+ L 
Sbjct: 60  KRPQSPHLTIYSFQLTSTLSITHRFTGLALTGYITALGLGALVMPH----DATHYLTMLE 115

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
             +         F+  +   +H + G+R+L WD+ 
Sbjct: 116 G-LSAPTLIALKFMLAYPFAYHTVNGVRHLFWDMG 149


>gi|283833993|ref|ZP_06353734.1| succinate dehydrogenase, cytochrome b556 subunit [Citrobacter
           youngae ATCC 29220]
 gi|291070127|gb|EFE08236.1| succinate dehydrogenase, cytochrome b556 subunit [Citrobacter
           youngae ATCC 29220]
          Length = 134

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 62/126 (49%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +      +   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFLAASS 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-KIATQMAKIN----IIASIL 117
            M+    E+ ++    A+ +H + GIR+L+ D     +  +  T+ AKI     ++ S+L
Sbjct: 69  IMNNFFVELIMWGILIALAYHAVMGIRHLLMDFGYIEETLEAGTRSAKICFVIIVVLSLL 128

Query: 118 TVLIVW 123
             ++VW
Sbjct: 129 AGVLVW 134


>gi|226951562|ref|ZP_03822026.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter sp.
           ATCC 27244]
 gi|294651219|ref|ZP_06728547.1| succinate dehydrogenasesuccinate dehydrogenase cytochrome b556
           subunit [Acinetobacter haemolyticus ATCC 19194]
 gi|226837704|gb|EEH70087.1| succinate dehydrogenase cytochrome b556 subunit [Acinetobacter sp.
           ATCC 27244]
 gi|292822872|gb|EFF81747.1| succinate dehydrogenasesuccinate dehydrogenase cytochrome b556
           subunit [Acinetobacter haemolyticus ATCC 19194]
          Length = 133

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 69/132 (52%), Gaps = 7/132 (5%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L   V+++      +    
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLVAVLLWILDKSLSSPEG 60

Query: 57  LSSLRCYMDGSVF-EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
              ++  + G++F    ++++   ++ H + GI++L+ D+    + +     A +++I S
Sbjct: 61  FDYVKNVVFGNIFVRFIVWVFVAGLLFHFIAGIKHLLADLGFAEELQSGRIAATVSLILS 120

Query: 116 ILTVL--IVWII 125
           +++++   VWI+
Sbjct: 121 VISIVAAFVWIM 132


>gi|70729104|ref|YP_258840.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          fluorescens Pf-5]
 gi|68343403|gb|AAY91009.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
          fluorescens Pf-5]
          Length = 128

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/96 (19%), Positives = 52/96 (54%)

Query: 2  SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++ + RP++  L+  +L  T   S +HR++G +++LG  ++++        E   + ++
Sbjct: 3  KAVNSQRPVNLDLRTIKLPITGVTSFLHRVSGIILFLGIGIMLYALSKSLGSEEGYAEVK 62

Query: 62 CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
            +   + +   +    A+++H++ G+R+LI D+ +
Sbjct: 63 ACLTSPLAKFVAWGLLSALLYHLVAGVRHLIMDMGI 98


>gi|225683516|gb|EEH21800.1| succinate dehydrogenase [Paracoccidioides brasiliensis Pb03]
          Length = 188

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSLRCYM 64
           NRP+SPHL IY+   T  +S ++RITG V   G+  +   F+ ++   G H  S +    
Sbjct: 64  NRPVSPHLSIYQPQVTWVLSSLNRITG-VALAGSLYIFSSFYLVSPLLGWHLESHVIAAA 122

Query: 65  DGSV---FEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G++    +V L F      + H L G R+LIWD+      K
Sbjct: 123 FGALPLAAKVGLKFTAAVPFMFHALNGCRHLIWDLGKQFSNK 164


>gi|119945916|ref|YP_943596.1| succinate dehydrogenase, cytochrome b subunit [Psychromonas
           ingrahamii 37]
 gi|119864520|gb|ABM03997.1| succinate dehydrogenase subunit C [Psychromonas ingrahamii 37]
          Length = 144

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++ +RP +  L   +   T   SI+HRI+G +V++   + +         E   +++  Y
Sbjct: 21  VRRDRPKNLDLTTVQFPITATASILHRISGIIVFIALAIFLTLLNQSLTSETDFNNVMGY 80

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASILTV 119
           +D       ++     + +H++ G+R++I D+    + + A   AK    I  I S+LT 
Sbjct: 81  IDNFFIGFIIWAALTGLTYHIVFGVRHMIQDLGYWEELESAALSAKVGFIITAILSVLTG 140

Query: 120 LIVW 123
           ++VW
Sbjct: 141 VLVW 144


>gi|1345639|sp|P48935|C560_CYACA RecName: Full=Succinate dehydrogenase cytochrome b560 subunit;
           AltName: Full=Succinate dehydrogenase, subunit III
 gi|758171|emb|CAA88765.1| succinate dehydrogenase (cytochrome b560 subunit) [Cyanidium
           caldarium]
          Length = 132

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 9/111 (8%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFW-----FFCIANGEHTLSSL 60
            NRPLSP++ IY    T   SI HR++G  +YL   + V +      FC +        +
Sbjct: 4   KNRPLSPYVTIYSSQWTSISSIFHRLSG--LYLVFFLFVLFCSIKFLFCFSTFWFVYKFV 61

Query: 61  R-CYMD-GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
           + C+    S F V +    +++ +H   G+R+L+WD  + ++    T   K
Sbjct: 62  KTCFFFILSFFIVFIVFSMYSLFYHFFIGLRHLVWDEVILMEDNFVTMSTK 112


>gi|258571015|ref|XP_002544311.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237904581|gb|EEP78982.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 204

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPV-VVFWFFCIANGEHTLSSLRCYMD 65
           NRP++PHL IY+   + ++S ++RITG  V  G  +    +    A G H  S       
Sbjct: 81  NRPVAPHLSIYKPQISWYLSALNRITGCTVSGGLYLFATAYLVAPAVGWHLESMSLAAAF 140

Query: 66  GSVFEVCLFLYTWAV----IHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           G++     F   + V      H + G+R+L+WD           +M   ++IA+  TV+
Sbjct: 141 GALPLAAKFAIKFGVAMPFTFHCMNGVRHLVWD--------FGKKMTNKDVIATGWTVV 191


>gi|221065942|ref|ZP_03542047.1| succinate dehydrogenase, cytochrome b556 subunit [Comamonas
           testosteroni KF-1]
 gi|220710965|gb|EED66333.1| succinate dehydrogenase, cytochrome b556 subunit [Comamonas
           testosteroni KF-1]
          Length = 141

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 7/114 (6%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS----VF 69
           L  YRL     VSI+HR++G ++ +  P +++ F    + E +  S      G       
Sbjct: 21  LPTYRLPLAGIVSILHRVSGLLMAILLPFIIWMFDHSISSEISFDSFTSVFAGPFGWFAK 80

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASI-LTVLI 121
            VCL L  WA +HH   G+R+L+ DV+   ++K+     A + +  S+ LTV++
Sbjct: 81  LVCLAL-IWAYLHHFCAGVRHLVMDVNHHAVNKQTGKSTAAVVLCISVALTVVL 133


>gi|188576491|ref|YP_001913420.1| succinate dehydrogenase, cytochrome b556 subunit [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|188520943|gb|ACD58888.1| succinate dehydrogenase, cytochrome b556 subunit [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 118

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%)

Query: 16  IYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFL 75
           +YR    M  SI++R TG V+ +G  V+      +  G    +  R +      +V LF 
Sbjct: 1   MYRWQIQMVTSILNRATGIVLTVGALVIAAALLTLMLGPDHWNCFRDHAASWYGQVFLFG 60

Query: 76  YTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +TW+   H+ GG+R+++ D       +    M  ++++ S +    VW
Sbjct: 61  WTWSFAFHLFGGLRHMLQDFGQGYAVRSFVGMGWLSVLLSFVLTGAVW 108


>gi|119476702|ref|ZP_01617012.1| succinate dehydrogenase (C subunit) [marine gamma proteobacterium
           HTCC2143]
 gi|119449958|gb|EAW31194.1| succinate dehydrogenase (C subunit) [marine gamma proteobacterium
           HTCC2143]
          Length = 137

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++ + RP++  L   +       SI HRI+G ++  GT V+++        E   +SLR 
Sbjct: 12  TVADKRPVNLDLGAMKWPLPAITSITHRISGVILVAGTAVLLWLLDESLTSEEAFNSLRS 71

Query: 63  YMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
            +  S +F++ ++    A+I+H + G+++L  D+ 
Sbjct: 72  VLASSLIFKLIVWGVMSALIYHSVAGVKHLCMDLG 106


>gi|295666820|ref|XP_002793960.1| succinate dehydrogenase cytochrome B subunit [Paracoccidioides
           brasiliensis Pb01]
 gi|226277613|gb|EEH33179.1| succinate dehydrogenase cytochrome B subunit [Paracoccidioides
           brasiliensis Pb01]
          Length = 188

 Score = 40.4 bits (93), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSLRCYM 64
           NRP+SPHL IY+   T  +S ++RITG +   G+  +   F+ ++   G H  S +    
Sbjct: 64  NRPVSPHLSIYQPQVTWVLSSLNRITG-LALAGSLYIFSSFYLVSPLLGWHLESPVIAAA 122

Query: 65  DGSV---FEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G++    +V L F      + H L G R+LIWD+      K
Sbjct: 123 FGALPLAAKVGLKFTAALPFMFHALNGCRHLIWDLGKQFSNK 164


>gi|307188808|gb|EFN73391.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           [Camponotus floridanus]
          Length = 152

 Score = 40.4 bits (93), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 22/100 (22%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTL---SSLRCY 63
            RP+SPHL IY +  T  +S+ HR TG         ++   + +  G  TL     + C+
Sbjct: 32  KRPMSPHLTIYEIQLTSVLSVTHRTTG---------IMLASYAMFLGLGTLLIPGGIPCF 82

Query: 64  MDGSVFEVCL---------FLYTWAVIHHMLGGIRYLIWD 94
           ++ +V  +CL          L      +H   G+R+L WD
Sbjct: 83  IE-TVDNLCLPLPVLYIGKLLLALPATYHTFNGMRHLAWD 121


>gi|229589333|ref|YP_002871452.1| succinate dehydrogenase cytochrome b556 subunit [Pseudomonas
           fluorescens SBW25]
 gi|229361199|emb|CAY48063.1| succinate dehydrogenase cytochrome b556 subunit [Pseudomonas
           fluorescens SBW25]
          Length = 124

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T   S +HR++G +++LG  ++++        E   + ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPITGVTSFLHRVSGIILFLGLGIMLYALSKSLGSEEGYAEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + +   +    ++++H++ G+R+LI D+ +    +     +KI I  S++ +++  
Sbjct: 61  LTSPLAKFVAWGLLSSLLYHLVAGVRHLIMDMGIGETLEGGRLGSKIIIAISVVLIVLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|226941338|ref|YP_002796412.1| SdhC [Laribacter hongkongensis HLHK9]
 gi|226716265|gb|ACO75403.1| SdhC [Laribacter hongkongensis HLHK9]
          Length = 124

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 67/125 (53%), Gaps = 5/125 (4%)

Query: 4   IKNNRPLSPHLQIYRL-IPTMF-VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++  RP   HL + ++ +P M  VSI+HRI+G  ++L  P++++      + E    + R
Sbjct: 1   MQKKRP--KHLDLGKISLPIMAKVSILHRISGVALFLALPLLIYLLQGSLSSEADFEAYR 58

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI-LTVL 120
             +   + ++ L    WA +HH   GIR+L++D+      + A   AK  ++ SI LTV+
Sbjct: 59  AVVAFPLMKLILLGLLWAFLHHFCAGIRFLMFDMHKGQSLEAARASAKAVLVVSIALTVV 118

Query: 121 IVWII 125
           I  I+
Sbjct: 119 IGGIL 123


>gi|330804873|ref|XP_003290414.1| hypothetical protein DICPUDRAFT_98679 [Dictyostelium purpureum]
 gi|325079465|gb|EGC33064.1| hypothetical protein DICPUDRAFT_98679 [Dictyostelium purpureum]
          Length = 193

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 15/109 (13%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            +P SPH+ IYR      +SI+HR+TG  + LG       F   +        +  Y+D 
Sbjct: 71  KQPTSPHVLIYRFPLPAVMSILHRVTGVFLGLG------LFGVCSTALFAPQDVTVYIDM 124

Query: 67  SVFEVCLFLY------TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
                 L +Y       + + +H   GIR+L WD +    K I T +A+
Sbjct: 125 LKTNYPLLVYPAKFCIAFPLAYHTSTGIRHLFWDET---QKGITTPLAE 170


>gi|291616724|ref|YP_003519466.1| SdhC [Pantoea ananatis LMG 20103]
 gi|291151754|gb|ADD76338.1| SdhC [Pantoea ananatis LMG 20103]
 gi|327393149|dbj|BAK10571.1| succinate dehydrogenase cytochrome b556 subunit SdhC [Pantoea
           ananatis AJ13355]
          Length = 140

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L   R   T   SI+HR++G +  +   ++++      +          
Sbjct: 15  TVKKQRPVNLDLSTIRFPVTAISSILHRVSGVITLVALGILLWLLGLSLSSPEGFQHAAS 74

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASIL 117
            M+G   +  ++    A+ +H +GGIR+++ D      +L   K+ A     I ++ SIL
Sbjct: 75  VMNGFFAKFIMWGILTALAYHAVGGIRHMLMDFGYLAETLEAGKRSAQVTFGITVVLSIL 134

Query: 118 TVLIVW 123
             ++VW
Sbjct: 135 AGVLVW 140


>gi|296414660|ref|XP_002837016.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295632864|emb|CAZ81207.1| unnamed protein product [Tuber melanosporum]
          Length = 182

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 9/102 (8%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVF---WFFCIANGEHTLSSLRCYM 64
           RP+SPHL IY+   T  +S  +RITG++  L T    F   +      G H  S      
Sbjct: 60  RPISPHLTIYQPQITSLMSGANRITGAI--LSTSAYAFAIGYLVAPTLGLHLESQTIAEA 117

Query: 65  DGSVFEVCLF----LYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G++ +        +      +H   G+R+LIWD    LD K
Sbjct: 118 FGAMPDATKIGIKGVLALPFTYHAWNGVRHLIWDTGKLLDIK 159


>gi|327300971|ref|XP_003235178.1| succinate dehydrogenase C subunit [Trichophyton rubrum CBS 118892]
 gi|326462530|gb|EGD87983.1| succinate dehydrogenase C subunit [Trichophyton rubrum CBS 118892]
          Length = 191

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 21/112 (18%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSV----------VYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T ++S ++RITG++           YL +P++  W       E  
Sbjct: 68  NRPVSPHLSIYRPQITWYLSSLNRITGAILSGGLYIFASAYLVSPLLG-WHL-----ESA 121

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
             +          +V + F        H   G+R+L+WD    L K++  Q 
Sbjct: 122 SLAAAFAALPIAAKVAMKFTMALPFTFHCFNGVRHLVWD----LGKQLTNQQ 169


>gi|302505419|ref|XP_003014416.1| hypothetical protein ARB_06978 [Arthroderma benhamiae CBS 112371]
 gi|291178237|gb|EFE34027.1| hypothetical protein ARB_06978 [Arthroderma benhamiae CBS 112371]
          Length = 197

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 21/112 (18%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVV----------YLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T ++S ++RITG+++          YL +P++  W       E  
Sbjct: 74  NRPVSPHLSIYRPQITWYLSSLNRITGAILSGGLYIFASAYLVSPLLG-WHL-----ESA 127

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
             +          +V + F        H   G+R+L+WD    L K++  Q 
Sbjct: 128 SLAAAFAALPIAAKVAMKFTMALPFTFHCFNGVRHLVWD----LGKQLTNQQ 175


>gi|217039529|gb|ACJ76893.1| mitochondrial succinate dehydrogenase cytochrome b560 subunit C
           [Alternaria alternata]
          Length = 177

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 15/112 (13%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCI 50
           ++  + NRP+SPHL IY+   T + S ++RITG           + YL  P    W    
Sbjct: 47  LAKQRVNRPVSPHLAIYKPQITWYASSLNRITGITLSGSLYLFGIAYLIAPYTG-WHLET 105

Query: 51  ANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            +   T+++    +   +       Y +    H   G+R+L WDV +    +
Sbjct: 106 QSMVATVAAWPAAVKAGLKA----FYAFPFFFHSFNGLRHLAWDVGIGFKNQ 153


>gi|17554318|ref|NP_499283.1| abnormal MEthyl Viologen sensitivity family member (mev-1)
           [Caenorhabditis elegans]
 gi|1169194|sp|P41956|C560_CAEEL RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; Flags: Precursor
 gi|433177|gb|AAA20081.1| CYT-1 [Caenorhabditis elegans]
 gi|3879510|emb|CAA82572.1| C. elegans protein T07C4.7, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 182

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 65/123 (52%), Gaps = 6/123 (4%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT--LSSLRCY 63
            NRP++PHL +Y+   T  +S  HRI+G V+  GT +V    F +   + T  +  +R +
Sbjct: 50  KNRPIAPHLTVYQPQLTWMLSGFHRISGCVM-AGTLLVGGIGFAVLPFDFTAFVDFIRSW 108

Query: 64  -MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +  +V  V  ++  + +I H L GIR+L +D++  ++     Q+ K   + S L+ ++ 
Sbjct: 109 NLPCAVTAVFKYIIAFPIIFHTLNGIRFLGFDLAKGVNN--VGQIYKSGYLVSGLSAILA 166

Query: 123 WII 125
             I
Sbjct: 167 LAI 169


>gi|197284462|ref|YP_002150334.1| succinate dehydrogenase cytochrome b-556 subunit [Proteus mirabilis
           HI4320]
 gi|227356640|ref|ZP_03841026.1| succinate dehydrogenase cytochrome b-556 subunit [Proteus mirabilis
           ATCC 29906]
 gi|194681949|emb|CAR41360.1| succinate dehydrogenase cytochrome b-556 subunit [Proteus mirabilis
           HI4320]
 gi|227163148|gb|EEI48079.1| succinate dehydrogenase cytochrome b-556 subunit [Proteus mirabilis
           ATCC 29906]
          Length = 125

 Score = 40.4 bits (93), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 59/125 (47%), Gaps = 5/125 (4%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  +       SI+HR++G ++ +   ++++      +           
Sbjct: 1   MKKQRPVNLDLQTIQFPLPAIASILHRVSGVIMLVAVGILLWLLGTSLSSPEGFQQAADI 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASILT 118
           M G   +  L+    A+ +H+ GGIR+++ D      +L + ++ A     I +I SIL 
Sbjct: 61  MTGFFAKFILWGILTALAYHICGGIRHMLMDFGFIDETLVVGRRSAAISMIITVILSILA 120

Query: 119 VLIVW 123
            ++VW
Sbjct: 121 GVLVW 125


>gi|226330952|ref|ZP_03806470.1| hypothetical protein PROPEN_04875 [Proteus penneri ATCC 35198]
 gi|225201747|gb|EEG84101.1| hypothetical protein PROPEN_04875 [Proteus penneri ATCC 35198]
          Length = 130

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 5/124 (4%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           K  RP++  LQ  +       SI+HR++G ++ +   ++++      +           M
Sbjct: 7   KKQRPVNLDLQTIQFPLPAIASILHRVSGVIMLVAVGILLWLLGTSLSSPEGFQQAAEIM 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASILTV 119
            G   +  L+    A+ +H+ GGIR+++ D      +L + +  A     I +I SIL  
Sbjct: 67  TGFFAKFILWGILTALAYHICGGIRHMLMDFGFIDETLIVGRNSAAASMVITVILSILAG 126

Query: 120 LIVW 123
           ++VW
Sbjct: 127 VLVW 130


>gi|225023987|ref|ZP_03713179.1| hypothetical protein EIKCOROL_00854 [Eikenella corrodens ATCC
           23834]
 gi|224943012|gb|EEG24221.1| hypothetical protein EIKCOROL_00854 [Eikenella corrodens ATCC
           23834]
          Length = 125

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            NRP+   +   RL     VSI+HRI+G ++++  P++++      +      S R ++ 
Sbjct: 4   TNRPIFLDIISIRLPIPGIVSILHRISGVLLFISLPLLLWLLAGTLDNAAAFESYRAFVA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
             + ++ L    WA +HH   GIR+L  D    L    A   AK
Sbjct: 64  HPLVKIGLIGLLWAYLHHFFAGIRFLFLDAHKGLALNTARTTAK 107


>gi|145588943|ref|YP_001155540.1| succinate dehydrogenase, cytochrome b subunit [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047349|gb|ABP33976.1| succinate dehydrogenase subunit C [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 139

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 19/120 (15%)

Query: 1   MSSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
             ++K +RP+  ++ +     YRL     VSI+HRI+G+V++L  P +++        + 
Sbjct: 5   QQNVKKDRPVYRNIGLAQLVKYRLPWAGKVSILHRISGAVLFLMLPFLLYLL------DQ 58

Query: 56  TLSSLRCYMDGSVFE-------VCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
           +L+S   Y              VCL L  W  +HH   GIRYL+ D+ + ++K  A + A
Sbjct: 59  SLASEVSYQKFQAITGHVLVKIVCLGL-IWCFLHHFCAGIRYLLLDLEIGVEKSEANRSA 117


>gi|254514197|ref|ZP_05126258.1| succinate dehydrogenase, cytochrome b556 subunit [gamma
           proteobacterium NOR5-3]
 gi|219676440|gb|EED32805.1| succinate dehydrogenase, cytochrome b556 subunit [gamma
           proteobacterium NOR5-3]
          Length = 124

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 56/107 (52%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K+NRP++  +   RL  T + SI+HR++G ++ + + ++++            +SL   
Sbjct: 1   MKDNRPVNLDIGTIRLPITAYASILHRVSGVIMVVASFLLLWALEQSLASPEGFASLGEL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
           +   + +  ++    A+I+H L G+++LI D  +    +  T  A++
Sbjct: 61  LANPLVKFVVWGIATALIYHSLAGVKHLIMDFGIGETMEGGTLGARL 107


>gi|88703466|ref|ZP_01101182.1| Succinate dehydrogenase cytochrome b-556 subunit [Congregibacter
           litoralis KT71]
 gi|88702180|gb|EAQ99283.1| Succinate dehydrogenase cytochrome b-556 subunit [Congregibacter
           litoralis KT71]
          Length = 124

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K+NRP++  +   RL  T + SI+HR++G ++ + + ++++       G  + + L   
Sbjct: 1   MKDNRPVNLDIGTIRLPITAYASILHRVSGVIMVVASFLLLWALDLSLAGPESYARLGEL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD--VSLCLDKKI--ATQMAKINIIASILTV 119
               + +  ++    A+++H   G+++LI D  V   +D  +  A  +  +  I+++L  
Sbjct: 61  FGSPLLKFVIWGIATALLYHSFAGVKHLIMDFGVGESMDGGVLGARLVFALTAISAVLIG 120

Query: 120 LIVW 123
           +++W
Sbjct: 121 VVLW 124


>gi|90580050|ref|ZP_01235858.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio angustum S14]
 gi|90438935|gb|EAS64118.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio angustum S14]
          Length = 133

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +S    
Sbjct: 10  VKKPRPVNLDLQTIRFPLTAIASILHRVSGVITFVSIAILLWLLNLSLSSPEGFTSAASI 69

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            D    +  L+    A+ +H++ GIR+L+ D  L   +++ T +A   I  +I+ VL V+
Sbjct: 70  TDSFFVKFILWGVLTALFYHIVLGIRHLLMD--LGYFEEMDTGIASTKISFAIVAVLAVF 127


>gi|3273343|dbj|BAA31213.1| fumarate reductase cytochrome b large subunit [Rhodoferax
           fermentans]
          Length = 147

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 12  PHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEV 71
           P L  YR       S +HR++G++++   P V++ F    + E + +  +   +  +  +
Sbjct: 21  PSLITYRWPLASLASGMHRVSGAIMFFLMPFVIWMFDASISSEVSFARFKAAFNIGMLGI 80

Query: 72  CLFLYT-------WAVIHHMLGGIRYLIWDV-SLCLDKKIATQMAKI 110
             FL+        WA++HH + GIR+L  D     + K    Q A +
Sbjct: 81  PGFLWKLVALGLIWAMLHHFIAGIRHLWMDTHHHHVSKDFGRQTAAV 127


>gi|329897269|ref|ZP_08272007.1| Succinate dehydrogenase cytochrome b-556 subunit [gamma
          proteobacterium IMCC3088]
 gi|328921265|gb|EGG28661.1| Succinate dehydrogenase cytochrome b-556 subunit [gamma
          proteobacterium IMCC3088]
          Length = 124

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 50/93 (53%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
          +K+ RP++  +   +L  T + SI+HRI+G  +++   V+++      +     +S+   
Sbjct: 1  MKDTRPVNLDIATIKLPITAYASILHRISGVFLFVAIGVMIYALDLSLSSAEGFASVGAA 60

Query: 64 MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
          +D    ++ ++     +I+H + G+++LI D+ 
Sbjct: 61 LDSLFAKLVVWAVLSGLIYHSVAGVKHLIMDMG 93


>gi|134293105|ref|YP_001116841.1| succinate dehydrogenase subunit C [Burkholderia vietnamiensis G4]
 gi|134136262|gb|ABO57376.1| succinate dehydrogenase subunit C [Burkholderia vietnamiensis G4]
          Length = 138

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 46/80 (57%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YR+     +SI+HRI+G++++L  P ++F F      E +    + ++   V ++ +   
Sbjct: 24  YRMPAAAILSILHRISGALLFLFLPFLLFLFDQSLTSELSFEVFKSFLSNIVVKLIVLAL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA +HH   GIR+L+ DV+
Sbjct: 84  SWAFLHHFCAGIRHLLMDVN 103


>gi|153838604|ref|ZP_01991271.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus AQ3810]
 gi|149748022|gb|EDM58881.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus AQ3810]
          Length = 126

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +           +
Sbjct: 4   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSHMGFMEAADIV 63

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GGIR+L+ D+    +       AK+   A    S+L  +
Sbjct: 64  DGFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELDSGAMSAKVAFGATAVLSLLAGI 123

Query: 121 IVW 123
           +VW
Sbjct: 124 LVW 126


>gi|157961608|ref|YP_001501642.1| succinate dehydrogenase cytochrome b556 subunit [Shewanella
           pealeana ATCC 700345]
 gi|157846608|gb|ABV87107.1| Succinate dehydrogenase cytochrome b556 subunit [Shewanella
           pealeana ATCC 700345]
          Length = 124

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 53/114 (46%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP+   LQ  R   T   SI+HR++G ++     ++++          + + ++  
Sbjct: 1   MKKQRPVHLDLQTIRFPATAIASILHRVSGVIMLFAVGILIWLLNESLASADSFAGVQSL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
            D  + +  ++    A+ +H++ GIR+L+ D     +       AK+ I  S++
Sbjct: 61  FDSFIVKFIVWGILTALGYHLIVGIRHLVMDAGYWEELSSGITSAKVAIALSVV 114


>gi|28897617|ref|NP_797222.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|260878228|ref|ZP_05890583.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus AN-5034]
 gi|260895665|ref|ZP_05904161.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus Peru-466]
 gi|260901293|ref|ZP_05909688.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus AQ4037]
 gi|28805829|dbj|BAC59106.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308088169|gb|EFO37864.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus Peru-466]
 gi|308090145|gb|EFO39840.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus AN-5034]
 gi|308109821|gb|EFO47361.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio
           parahaemolyticus AQ4037]
          Length = 130

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSHMGFMEAADIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GGIR+L+ D+    +       AK+   A    S+L  +
Sbjct: 68  DGFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELDSGAMSAKVAFGATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|323498611|ref|ZP_08103603.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio sinaloensis DSM 21326]
 gi|323316309|gb|EGA69328.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio sinaloensis DSM 21326]
          Length = 130

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +     +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPVGYAQAVDIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GGIR+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DGFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELESGAMSAKVAFAATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 MVW 130


>gi|157120010|ref|XP_001653486.1| succinate dehydrogenase [Aedes aegypti]
 gi|94468558|gb|ABF18128.1| mitochondrial succinate dehydrogenase cytochrome b subunit [Aedes
           aegypti]
 gi|108875100|gb|EAT39325.1| succinate dehydrogenase [Aedes aegypti]
          Length = 171

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 2/91 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            RP SPHL IY    T  +SI HR+TG ++    T + +       +  H L+ L   + 
Sbjct: 53  QRPQSPHLTIYAPQLTSMLSITHRMTGMALAGYATMMGLGALALPHDATHYLTMLEG-LS 111

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
                   F   +    H + G+R+L WD+ 
Sbjct: 112 APTLMALKFTLAYPFAFHSVNGVRHLFWDMG 142


>gi|169780850|ref|XP_001824889.1| cytochrome B-560 subunit of succinate dehydrogenase [Aspergillus
           oryzae RIB40]
 gi|238504946|ref|XP_002383702.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus flavus
           NRRL3357]
 gi|83773629|dbj|BAE63756.1| unnamed protein product [Aspergillus oryzae]
 gi|220689816|gb|EED46166.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus flavus
           NRRL3357]
          Length = 188

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 23/110 (20%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T   S  HRITG          +  YL +P ++ W    A+    
Sbjct: 65  NRPVSPHLSIYRPQITWIGSSFHRITGFALSGSLYLYATAYLASP-LLGWHLESASVAAA 123

Query: 57  LSSL----RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            ++L    +  + G  F    F Y      H   G+R+L+WD+   +  +
Sbjct: 124 FAALPIVAKVLLKG--FMALPFTY------HCFNGVRHLVWDLGRGITNQ 165


>gi|148652073|ref|YP_001279166.1| succinate dehydrogenase, cytochrome b556 subunit [Psychrobacter sp.
           PRwf-1]
 gi|148571157|gb|ABQ93216.1| succinate dehydrogenase subunit C [Psychrobacter sp. PRwf-1]
          Length = 125

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 4   IKNNRPLS-PHLQIYRL--IPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           +K+NRP++ P  Q+  +   PT   SI+HRI+G +++L  PV++   + +    ++    
Sbjct: 1   MKSNRPINLPLSQVISVNSSPTARASILHRISGIILFLLIPVML---WLLQTSLYSPQDF 57

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTV 119
               D  +     +++  A  +H + GI++L  D+    + +     + ++ +IA+IL V
Sbjct: 58  LAVFDNVLVRFVAWIFVAATAYHFVMGIKHLFADMGFNEELQSGRTASIVSFVIAAILIV 117

Query: 120 L-IVWII 125
           L  VW++
Sbjct: 118 LSFVWVM 124


>gi|194743916|ref|XP_001954444.1| GF18264 [Drosophila ananassae]
 gi|190627481|gb|EDV43005.1| GF18264 [Drosophila ananassae]
          Length = 281

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 11/97 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVV-----YLGTPVVVFWFFCIANGEHTLSSLR 61
            R LSPHL IY+L  T  +SI  RI+G V+      LG    +    C  N E  L+ ++
Sbjct: 104 GRELSPHLSIYKLQLTSGLSICLRISGFVLGVFVWALG----ISGLICQGNMEEFLTKVQ 159

Query: 62  -CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
            C  D ++  +   +      +HM+ G R+LIW ++L
Sbjct: 160 DCDCD-TLRTLTKVMVAIPFAYHMVAGTRHLIWYLNL 195


>gi|312796841|ref|YP_004029763.1| succinate dehydrogenase cytochrome b556 subunit [Burkholderia
           rhizoxinica HKI 454]
 gi|312168616|emb|CBW75619.1| Succinate dehydrogenase cytochrome b556 subunit (EC 1.3.99.1)
           [Burkholderia rhizoxinica HKI 454]
          Length = 185

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 56/110 (50%), Gaps = 5/110 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            ++K  RP   ++ I     YRL     VSI+HR++G++++L  P  ++        E +
Sbjct: 52  EAVKKPRPEYRNISIGQILRYRLPLAGRVSILHRVSGALLFLLLPFSLYLLEQSLTSELS 111

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQ 106
            +SL+ +    + ++ + + +WA + H   G+R+L+ D    + K+   Q
Sbjct: 112 FASLKAFFSYPLVKLIVLVLSWAYLFHFCAGLRHLLLDTHRAVTKQGGKQ 161


>gi|110225706|ref|YP_665711.1| succinate:cytochrome c oxidoreductase subunit 3 [Mesostigma
          viride]
 gi|17222577|gb|AAL36750.1|AF353999_30 succinate:cytochrome c oxidoreductase subunit 3 [Mesostigma
          viride]
          Length = 131

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 8  RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY---- 63
          RPLSPH+ +Y+       S+ HRI+GSV+ +   +  F+ F I    H   S   +    
Sbjct: 7  RPLSPHVSVYQPQWNSMFSLFHRISGSVLVIS--LFTFFLFSIIYSFHATRSYELFSFFL 64

Query: 64 --MDGSVFEVCLFLYTWAVIHHMLGGIRYLI 92
             D  +F        +A+ +H++ GI +++
Sbjct: 65 TLEDSKLFSFVELTILFALSYHIINGIHHIM 95


>gi|328473399|gb|EGF44247.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio parahaemolyticus 10329]
          Length = 130

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPMGFMEAADIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GGIR+L+ D+    +       AK+   A    S+L  +
Sbjct: 68  DGFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELDSGAMSAKVAFGATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|183598172|ref|ZP_02959665.1| hypothetical protein PROSTU_01551 [Providencia stuartii ATCC 25827]
 gi|188020339|gb|EDU58379.1| hypothetical protein PROSTU_01551 [Providencia stuartii ATCC 25827]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 60/126 (47%), Gaps = 7/126 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ      T   SI+HR++G + ++   ++++      +       +   
Sbjct: 5   VKKQRPVNLDLQTIHFPITAISSILHRVSGVITFIAVGILLWLLGTSLSSPEGFQYVSEI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK------INIIASIL 117
           M G   +  L+    A+ +H+ GGIR+++ D    +D+ +A   +       I ++ +IL
Sbjct: 65  MTGFFAKFILWGILTALAYHICGGIRHMLMDFG-WVDETLAAGNSSAKITFVITVVLAIL 123

Query: 118 TVLIVW 123
             ++VW
Sbjct: 124 AGILVW 129


>gi|121611268|ref|YP_999075.1| succinate dehydrogenase, cytochrome b subunit [Verminephrobacter
           eiseniae EF01-2]
 gi|121555908|gb|ABM60057.1| succinate dehydrogenase subunit C [Verminephrobacter eiseniae
           EF01-2]
          Length = 144

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 1   MSSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           M+     RP      L   L+ YRL    +VSI+HR++G  ++L  P +V+ F    + E
Sbjct: 1   MTKTAPERPEFRNLHLLQDLRTYRLPAAGWVSILHRVSGLAMFLLLPFIVWMFDTSLSSE 60

Query: 55  HTLSSLRCYMD-------GSVFEVCLFLYTWAVIHHMLGGIRYLIWDV 95
            + +              G  F++      W+ +HH   G+R+L  D+
Sbjct: 61  ISFARFTAIFKAGAGVVPGWCFKLLALALIWSFLHHFCAGLRHLWLDI 108


>gi|302667796|ref|XP_003025478.1| hypothetical protein TRV_00347 [Trichophyton verrucosum HKI 0517]
 gi|291189589|gb|EFE44867.1| hypothetical protein TRV_00347 [Trichophyton verrucosum HKI 0517]
          Length = 191

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 21/112 (18%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSV----------VYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T ++S ++RITG++           YL +P++  W       E  
Sbjct: 68  NRPVSPHLSIYRPQITWYLSSLNRITGAILSGGLYIFASAYLVSPLLG-WHL-----ESA 121

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
             +          +V + F        H   G+R+L+WD    L K++  Q 
Sbjct: 122 SLAAAFAALPIAAKVVMKFTMALPFTFHCFNGVRHLVWD----LGKQLTNQQ 169


>gi|261252260|ref|ZP_05944833.1| succinate dehydrogenase cytochrome b-556 subunit [Vibrio orientalis
           CIP 102891]
 gi|260935651|gb|EEX91640.1| succinate dehydrogenase cytochrome b-556 subunit [Vibrio orientalis
           CIP 102891]
          Length = 130

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +     +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPVGYAQAVDIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG      L+    A+ +H++GGIR+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DGFFVTFILWGILTALAYHIVGGIRHLLMDLGHFEELESGAMSAKVAFAATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 MVW 130


>gi|292490834|ref|YP_003526273.1| succinate dehydrogenase, cytochrome b556 subunit [Nitrosococcus
           halophilus Nc4]
 gi|291579429|gb|ADE13886.1| succinate dehydrogenase, cytochrome b556 subunit [Nitrosococcus
           halophilus Nc4]
          Length = 125

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 64/122 (52%), Gaps = 1/122 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
            ++RP   +L + R      VS +HRI+G ++ L  PV+V+            + +  + 
Sbjct: 3   NHHRPTFLNLALIRFPANAIVSALHRISGVILSLLVPVLVYLLDLSLQDSEGFAQVIGFF 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI-NIIASILTVLIVW 123
           +    ++   +  WA++HH+  GIR+L++D+ + +     +  A+I N+ A ++T+LI  
Sbjct: 63  NSLGVKLVGMVVLWALLHHIFAGIRFLLFDIHVGVKDYRPSWSARIANVSALVVTLLIAG 122

Query: 124 II 125
           ++
Sbjct: 123 VL 124


>gi|210076240|ref|XP_504562.2| YALI0E29667p [Yarrowia lipolytica]
 gi|199426970|emb|CAG80166.2| YALI0E29667p [Yarrowia lipolytica]
          Length = 171

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 21/108 (19%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCI-ANGE------------ 54
           RP SPHL IY+   T ++S +HR+TG  V LG    ++   C  A G             
Sbjct: 49  RPTSPHLDIYQPQLTWYLSGLHRVTG--VALGG--ALYALLCAYAAGPALGIHIDSTTLA 104

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           HT +++       +  +  F +T+    H   G+R+L+WD +  L  K
Sbjct: 105 HTFAAVPLVAKLPLKALVAFPFTF----HAFNGVRHLVWDFTKELTVK 148


>gi|262371930|ref|ZP_06065209.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           junii SH205]
 gi|262311955|gb|EEY93040.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           junii SH205]
          Length = 133

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 68/138 (49%), Gaps = 19/138 (13%)

Query: 1   MSSIKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
           M ++K+NRP    +   L +    P    SI+HR++G +V+L    V+ W       + +
Sbjct: 1   MPAVKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFL-LVAVLLWIL-----DKS 54

Query: 57  LSSLRC--YMDGSVF-----EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAK 109
           LSS     Y+   VF        ++++   +I H + GI++L+ D+    + +     A 
Sbjct: 55  LSSPEGFDYVKNVVFGNILVRFIVWVFVAGLIFHFIAGIKHLLADLGFAEELQSGRIAAT 114

Query: 110 INIIASILTVL--IVWII 125
           +++I S++ ++   VWI+
Sbjct: 115 VSLILSVIGIVAAFVWIM 132


>gi|314908366|gb|ADT62130.1| succinate dehydrogenase subunit 3 [Isoetes engelmannii]
          Length = 98

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVV-FWFFCIANGEHTLSSLRC 62
          +K NRPLSPHL IY+   T   SI HRI+G+  +L   V+    F+ I +   T      
Sbjct: 1  MKINRPLSPHLTIYKPQLTSTFSIFHRISGA--FLAAKVLFSLLFWKIGDLSLTFYYSYS 58

Query: 63 YMDGSVFEVCLFLYT---WAVIHHMLGGIRYLIWD 94
          +         + L      A  +HM  G+R+L WD
Sbjct: 59 FFFFVFHWFIILLVNLTFLAFCYHMSNGVRHLWWD 93


>gi|302896466|ref|XP_003047113.1| hypothetical protein NECHADRAFT_70858 [Nectria haematococca mpVI
           77-13-4]
 gi|256728041|gb|EEU41400.1| hypothetical protein NECHADRAFT_70858 [Nectria haematococca mpVI
           77-13-4]
          Length = 189

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 16/125 (12%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIV-HRITGSV----------VYLGTPVVVFWFFCIANGEH 55
           NRP+SPHL IY++  T F S   +RITG             YL  PVV       A+   
Sbjct: 64  NRPVSPHLGIYKMEQTWFGSSAWNRITGCTLSATMYAFMGAYLVAPVVGL-HLETASVAA 122

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
               L   + G V     F +    ++H++ G ++L++D+     K    +   I   AS
Sbjct: 123 AFGGLPLVVKGGVKLALGFPF----VYHLINGFKHLLYDMGKGFAKPTIKKTDNILWAAS 178

Query: 116 ILTVL 120
           IL  +
Sbjct: 179 ILGAI 183


>gi|315048699|ref|XP_003173724.1| succinate dehydrogenase cytochrome B subunit [Arthroderma gypseum
           CBS 118893]
 gi|311341691|gb|EFR00894.1| succinate dehydrogenase cytochrome B subunit [Arthroderma gypseum
           CBS 118893]
          Length = 221

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 17/129 (13%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVV----------YLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IY+   T ++S ++RITG+++          YL +P++ +     +     
Sbjct: 98  NRPVSPHLTIYQPQITWYLSSLNRITGAMLSGSLYLFASAYLISPLLGWHLESASLAAAF 157

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK--IATQMAKINIIA 114
            +       G  F + L         H   G+R+L+WD+   L  K  I T    + +  
Sbjct: 158 AALPIAAKIGMKFTMAL-----PFTFHCFNGVRHLVWDLGKQLTNKQVITTGWTVVGLTL 212

Query: 115 SILTVLIVW 123
           S    L +W
Sbjct: 213 SSALALAMW 221


>gi|332977198|gb|EGK13995.1| succinate dehydrogenase cytochrome b558 subunit [Psychrobacter sp.
           1501(2011)]
          Length = 125

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 68/129 (52%), Gaps = 12/129 (9%)

Query: 4   IKNNRPLS-PHLQIYRL--IPTMFVSIVHRITGSVVYLGTPVVVFWFF--CIANGEHTLS 58
           +K+NRP++ P  Q+  +   PT   SI+HRI+G ++++  PV++ W     I + +H   
Sbjct: 1   MKSNRPINLPLSQVISVNSSPTARASILHRISGIILFILIPVML-WLLQTSIYSPQH--- 56

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASIL 117
                 D  V     +++  A  +H + GI++L  D+    + +     + ++ +IA+IL
Sbjct: 57  -FDAIFDNMVLRFIAWIFVAATAYHFVMGIKHLFADMGFNEELQSGRTASIVSLVIAAIL 115

Query: 118 TVL-IVWII 125
            VL  +W++
Sbjct: 116 IVLSFIWVM 124


>gi|225717282|gb|ACO14487.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Esox lucius]
          Length = 173

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 14/98 (14%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           K NRP+SPH+ +Y+    M +SI HR TG  +  G          +        S   Y+
Sbjct: 47  KLNRPMSPHVTVYKWSVPMMMSISHRGTGLGLSAGVSAFALLALVLPG------SYPYYL 100

Query: 65  D--------GSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
           D         ++  +  F   + + +H   GIR+L WD
Sbjct: 101 DLIHSQSFGPALIGLAKFGIAFPLSYHTFNGIRHLCWD 138


>gi|256021205|ref|ZP_05435070.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella sp. D9]
 gi|307314814|ref|ZP_07594408.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           W]
 gi|332282431|ref|ZP_08394844.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella sp. D9]
 gi|306905712|gb|EFN36240.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           W]
 gi|315059964|gb|ADT74291.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli W]
 gi|323379476|gb|ADX51744.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           KO11]
 gi|332104783|gb|EGJ08129.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella sp. D9]
          Length = 134

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 62/132 (46%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLD-----KKIATQMAKIN 111
           +   S      F+    W ++    +H++ GIR+++ D     +     K+ A     I 
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKTSFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|89073516|ref|ZP_01160039.1| putative succinate dehydrogenase; fumaratereductase, cytochrome
           bsubunit [Photobacterium sp. SKA34]
 gi|89050780|gb|EAR56261.1| putative succinate dehydrogenase; fumaratereductase, cytochrome
           bsubunit [Photobacterium sp. SKA34]
          Length = 133

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +S    
Sbjct: 10  VKKPRPVNLDLQTIRFPLTAIASILHRVSGVITFVSLAILLWLLNLSLSSPEGFTSAASV 69

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            D    +  L+    A+ +H++ GIR+L+ D  L   +++ T +A   I  +I+ VL V+
Sbjct: 70  TDSFFVKFILWGVLTALFYHIVLGIRHLLMD--LGYFEEMDTGIASTKISFAIVAVLAVF 127


>gi|107026777|ref|YP_624288.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia AU 1054]
 gi|116692031|ref|YP_837564.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia HI2424]
 gi|170735976|ref|YP_001777236.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           cenocepacia MC0-3]
 gi|254248724|ref|ZP_04942044.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia PC184]
 gi|105896151|gb|ABF79315.1| succinate dehydrogenase subunit C [Burkholderia cenocepacia AU
           1054]
 gi|116650031|gb|ABK10671.1| succinate dehydrogenase subunit C [Burkholderia cenocepacia HI2424]
 gi|124875225|gb|EAY65215.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia PC184]
 gi|169818164|gb|ACA92746.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           cenocepacia MC0-3]
          Length = 138

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 53/101 (52%), Gaps = 6/101 (5%)

Query: 2   SSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            +++  RP   ++ I      YR+     +SI+HRI+G++++L  P ++F F      E 
Sbjct: 3   DAVRKPRPEYRNIGIGDITLKYRMPLAAILSILHRISGALLFLFLPFLLFLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           +    + ++   V ++ +   +WA  HH   GIR+L+ DV+
Sbjct: 63  SFEVFKAFLSNIVVKLVVLALSWAFFHHFCAGIRHLLMDVN 103


>gi|323495090|ref|ZP_08100177.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio brasiliensis LMG 20546]
 gi|323310641|gb|EGA63818.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio brasiliensis LMG 20546]
          Length = 130

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 60/123 (48%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +     +     +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPVGYAEAVDIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GG+R+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DGFFVKFILWGILTALAYHIAGGVRHLLMDMGHFEELESGAMSAKVAFAATAVLSLLAGV 127

Query: 121 IVW 123
           +VW
Sbjct: 128 MVW 130


>gi|160872194|ref|ZP_02062326.1| succinate dehydrogenase, cytochrome b556 subunit [Rickettsiella
           grylli]
 gi|159120993|gb|EDP46331.1| succinate dehydrogenase, cytochrome b556 subunit [Rickettsiella
           grylli]
          Length = 123

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 53/111 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           + RP++ +L   R   T  VSI+HR++G +++L  PV +              ++    +
Sbjct: 2   SKRPINLNLLTIRFPMTAIVSILHRLSGFLLFLAIPVFLMLMTLTLQSPEAFFTVHVCFE 61

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
             + ++ L  +  A+ +H+  GIR+L  D  +    K A   A   ++A++
Sbjct: 62  HPLMKLFLLGFLAALFYHLFAGIRHLFMDAGVADTLKSAQWTAGFVMVATL 112


>gi|308186067|ref|YP_003930198.1| succinate dehydrogenase cytochrome b-556 subunit [Pantoea vagans
           C9-1]
 gi|308056577|gb|ADO08749.1| succinate dehydrogenase cytochrome b-556 subunit [Pantoea vagans
           C9-1]
          Length = 146

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  L   R   T   SI+HR++G +  +   ++++      +         
Sbjct: 20  KTVKKQRPVNLDLSTIRFPVTAISSILHRVSGVITLVAIGILLWLLGLSLSSPEGFQHAA 79

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASI 116
             MDG   +  ++    A+ +H + GIR+++ D      +L + K+ A     I ++ +I
Sbjct: 80  SIMDGFFAKFIMWGILTALAYHAVSGIRHMLMDFGYLAETLEVGKRSAHMTFVITVVLAI 139

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 140 LAGVLVW 146


>gi|225717882|gb|ACO14787.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Caligus clemensi]
          Length = 173

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 15/96 (15%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----SVVYLGTPVVVFWFFCIANGEHTLSSLR- 61
           NRP+SPHL IY+   T  +SI HRI+G    +++Y G       F   +N    + S+  
Sbjct: 56  NRPMSPHLTIYKPQLTSMLSISHRISGMYLTAILYSGG---FLPFVLPSNFPTFIQSIEI 112

Query: 62  --CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV 95
               +    F +    + +A+  H   G+R+L+WD+
Sbjct: 113 APLLVTAGKFAIA---FPFAI--HTYNGLRHLLWDM 143


>gi|154285510|ref|XP_001543550.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150407191|gb|EDN02732.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 187

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 44/107 (41%), Gaps = 17/107 (15%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSV----------VYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T  +S  +RITG V           YL  P ++ W    A+    
Sbjct: 64  NRPVSPHLSIYRPQITWILSSTNRITGVVLSGGLYIFASAYLVAP-LLGWHLESASIAAA 122

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            + L         + CL F        H   G R+L+WD+      K
Sbjct: 123 FAGLPL-----AAKFCLKFAAALPFTFHSFNGCRHLVWDMGKQFTNK 164


>gi|167624415|ref|YP_001674709.1| succinate dehydrogenase cytochrome b556 subunit [Shewanella
           halifaxensis HAW-EB4]
 gi|167354437|gb|ABZ77050.1| Succinate dehydrogenase cytochrome b556 subunit [Shewanella
           halifaxensis HAW-EB4]
          Length = 124

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF--CIANGEHTLSSLR 61
           +K  RP+  +LQ  R   T   SI+HR++G ++     +++ W     +A+ E + + ++
Sbjct: 1   MKKQRPVHLNLQTIRFPATAIASILHRVSGVIMLFAVGILI-WLLNESLASAE-SFAGVQ 58

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
              D  + +  ++    A+ +H++ G+R+L+ D     +       AK+ I  S++
Sbjct: 59  SLFDNFIVKFIVWGILTALGYHLIVGLRHLVMDAGYWEELSSGLTSAKVAIGLSVV 114


>gi|172062859|ref|YP_001810510.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           ambifaria MC40-6]
 gi|171995376|gb|ACB66294.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           ambifaria MC40-6]
          Length = 138

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 2   SSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            +++  RP   ++ I      YR+     +SI+HR++G++++L  P ++F F      E 
Sbjct: 3   DAVRKPRPEYRNIGIGDITLKYRMPLAAILSILHRVSGALLFLFLPFLLFLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           +    + ++   V ++ +   +WA +HH   GIR+L+ DV+
Sbjct: 63  SFEVFKAFLSNIVVKLIVLALSWAFLHHFCAGIRHLLMDVN 103


>gi|115358062|ref|YP_775200.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia
           ambifaria AMMD]
 gi|115283350|gb|ABI88866.1| succinate dehydrogenase subunit C [Burkholderia ambifaria AMMD]
          Length = 138

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 2   SSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            +++  RP   ++ I      YR+     +SI+HR++G++++L  P V+F F      E 
Sbjct: 3   DAVRKPRPEYRNIGIGDITLKYRMPLAAILSILHRVSGALLFLFLPFVLFLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           +    + ++   V ++ +   +WA +HH   GIR+L+ DV+
Sbjct: 63  SFEVFKAFLSNIVVKLIVLALSWAFLHHFCAGIRHLLMDVN 103


>gi|294141510|ref|YP_003557488.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           violacea DSS12]
 gi|293327979|dbj|BAJ02710.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella
           violacea DSS12]
          Length = 124

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 58/124 (46%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP+   LQ  R   T   SI+HR++G ++     ++++          + + ++  
Sbjct: 1   MKKQRPVHLDLQTIRFPATAIASILHRVSGVIMLFAVGILIWLLSESLASPESFAGVQSL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC---LDKKIATQMAKINIIASILTVL 120
            D  + +  ++    A+ +H++ GIR+LI D   C   L   IA+  A   +  +   ++
Sbjct: 61  FDNLLVKFVIWGILTALGYHLIVGIRHLIMDAG-CWEELPAGIASAKAAFALSFAFSIIV 119

Query: 121 IVWI 124
            VW+
Sbjct: 120 GVWV 123


>gi|161486280|ref|NP_752728.2| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli CFT073]
 gi|218549714|ref|YP_002383505.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia fergusonii ATCC 35469]
 gi|218688515|ref|YP_002396727.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli ED1a]
 gi|218699076|ref|YP_002406705.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli IAI39]
 gi|331656738|ref|ZP_08357700.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA206]
 gi|218357255|emb|CAQ89890.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia fergusonii ATCC 35469]
 gi|218369062|emb|CAR16816.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli IAI39]
 gi|218426079|emb|CAR06897.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli ED1a]
 gi|222032458|emb|CAP75197.1| Succinate dehydrogenase cytochrome b556 subunit [Escherichia coli
           LF82]
 gi|281177864|dbj|BAI54194.1| succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           SE15]
 gi|284920499|emb|CBG33561.1| succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           042]
 gi|331054986|gb|EGI26995.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA206]
          Length = 129

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 4   NVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 57

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 58  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 117

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 118 VVLSLLAGVLVW 129


>gi|238024241|ref|YP_002908473.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia glumae
           BGR1]
 gi|237878906|gb|ACR31238.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia glumae
           BGR1]
          Length = 138

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 66/130 (50%), Gaps = 7/130 (5%)

Query: 2   SSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            +++  RP   ++ I      YRL     +SI HR++G++++L  P +++ F      E 
Sbjct: 3   EAVRKPRPEYRNIGIGDITLKYRLPLAGQLSIFHRVSGALLFLSLPFLLYLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIA 114
           +    + +    V ++ + + +WA +HH   GIR+L+ DV+   + K+   + A +  + 
Sbjct: 63  SFDVFKAFFSNIVVKLIVLVLSWAFLHHFCAGIRHLLMDVNHDAVTKEGGKRTAAVVFVV 122

Query: 115 SILTVLIVWI 124
           S+   L+V +
Sbjct: 123 SLALTLVVAL 132


>gi|212635740|ref|YP_002312265.1| succinate dehydrogenase, cytochrome b subunit [Shewanella
           piezotolerans WP3]
 gi|212557224|gb|ACJ29678.1| Succinate dehydrogenase, cytochrome b subunit [Shewanella
           piezotolerans WP3]
          Length = 146

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 58/118 (49%), Gaps = 4/118 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF--CIANGEHTLSS 59
            ++K  RP+   LQ  +   T   SI+HR++G ++     +++ W     +A+ E + + 
Sbjct: 21  QNVKKQRPVHLDLQTVKFPATAIASILHRVSGVIMLFAVGILI-WLLNESLASAE-SFAG 78

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
           ++   D  + +  ++    A+ +H++ G+R+L+ D     +       AK+ I  S++
Sbjct: 79  VQSLFDSFIVKFIVWGILTALGYHLIVGLRHLVMDAGYWEELSSGLASAKVAIALSVV 136


>gi|195452088|ref|XP_002073207.1| GK13274 [Drosophila willistoni]
 gi|194169292|gb|EDW84193.1| GK13274 [Drosophila willistoni]
          Length = 174

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 12/103 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSLRCYM 64
            R +SPHL IY+   T  +SI HR TG  + +G      W   +      H +S     +
Sbjct: 54  GRKVSPHLTIYQPQLTSILSITHRGTGMALGVGV-----WALGLGALISSHDISHYVTIV 108

Query: 65  DG-----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +G     +      F+  +    H   GIR+L+WD    L  K
Sbjct: 109 EGLQLSDAQLTAIKFIIAYPAGFHTANGIRHLLWDTGRFLKIK 151


>gi|297537886|ref|YP_003673655.1| succinate dehydrogenase, cytochrome b556 subunit [Methylotenera sp.
           301]
 gi|297257233|gb|ADI29078.1| succinate dehydrogenase, cytochrome b556 subunit [Methylotenera sp.
           301]
          Length = 141

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF-FCIANGEHTLSSLRCYMD 65
           +RP + +L   RL     VSI+HR TG V++L  PV++    F + + EH   ++   + 
Sbjct: 20  SRPKNLNLFTIRLPINALVSILHRATGCVLFLILPVILLLLQFSLNSAEH-YEAVIAILH 78

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDV 95
             + ++ L    WA  HH   GIR+L  DV
Sbjct: 79  SPLIKIMLLGLAWAFFHHFFAGIRHLAMDV 108


>gi|209917972|ref|YP_002292056.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli SE11]
 gi|218553248|ref|YP_002386161.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli IAI1]
 gi|260842928|ref|YP_003220706.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O103:H2 str. 12009]
 gi|260853956|ref|YP_003227847.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O26:H11 str. 11368]
 gi|260866852|ref|YP_003233254.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O111:H- str. 11128]
 gi|209911231|dbj|BAG76305.1| succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           SE11]
 gi|218360016|emb|CAQ97563.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli IAI1]
 gi|257752605|dbj|BAI24107.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O26:H11 str. 11368]
 gi|257758075|dbj|BAI29572.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O103:H2 str. 12009]
 gi|257763208|dbj|BAI34703.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O111:H- str. 11128]
 gi|323153766|gb|EFZ40013.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           EPECa14]
          Length = 129

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 4   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILL-WLLGT-----SLSSPEG 57

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 58  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 117

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 118 VVLSLLAGVLVW 129


>gi|171316069|ref|ZP_02905295.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           ambifaria MEX-5]
 gi|171098771|gb|EDT43564.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           ambifaria MEX-5]
          Length = 138

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 2   SSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            +++  RP   ++ I      YR+     +SI+HR++G++++L  P ++F F      E 
Sbjct: 3   DAVRKPRPEYRNIGIGDITLKYRMPLAAILSILHRVSGALLFLFLPFLLFLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           +    + ++   V ++ +   +WA +HH   GIR+L+ DV+
Sbjct: 63  SFEVFKAFLSNIVVKLVVLALSWAFLHHFCAGIRHLLMDVN 103


>gi|193065547|ref|ZP_03046615.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           E22]
 gi|194429052|ref|ZP_03061583.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           B171]
 gi|192926836|gb|EDV81462.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           E22]
 gi|194412883|gb|EDX29174.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           B171]
 gi|324020372|gb|EGB89591.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 117-3]
          Length = 134

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|157375953|ref|YP_001474553.1| succinate dehydrogenase, cytochrome b subunit [Shewanella sediminis
           HAW-EB3]
 gi|157318327|gb|ABV37425.1| succinate dehydrogenase, cytochrome b subunit [Shewanella sediminis
           HAW-EB3]
          Length = 124

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP+   LQ  R   T   SI+HR++G ++     ++++          + ++ +  
Sbjct: 1   MKKQRPVHLDLQTIRFPATAIASILHRVSGVIMLFAVGILIWLLNESLASPESFAATQSL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC--LDKKIATQMA--KINIIASILTV 119
            D  + +  ++    A+ +H++ G+R+LI D      L   IA+  A   ++I+ SI+  
Sbjct: 61  FDNLLVKFVIWGILTALGYHLIVGVRHLIMDTGRWEELASGIASAKAAFALSIVFSIIVG 120

Query: 120 LIVW 123
           + VW
Sbjct: 121 IWVW 124


>gi|15800425|ref|NP_286437.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H7 EDL933]
 gi|15830000|ref|NP_308773.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H7 str. Sakai]
 gi|16128696|ref|NP_415249.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. MG1655]
 gi|74311245|ref|YP_309664.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella sonnei Ss046]
 gi|82543148|ref|YP_407095.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella boydii Sb227]
 gi|82775989|ref|YP_402336.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella dysenteriae Sd197]
 gi|89107579|ref|AP_001359.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. W3110]
 gi|170080388|ref|YP_001729708.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. DH10B]
 gi|218694145|ref|YP_002401812.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli 55989]
 gi|218704038|ref|YP_002411557.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli UMN026]
 gi|238899986|ref|YP_002925782.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli BW2952]
 gi|254160791|ref|YP_003043899.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli B str. REL606]
 gi|254791867|ref|YP_003076704.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H7 str. TW14359]
 gi|291281653|ref|YP_003498471.1| Succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403965|ref|ZP_06647959.1| sdhC [Escherichia coli FVEC1412]
 gi|293409095|ref|ZP_06652671.1| succinate dehydrogenase [Escherichia coli B354]
 gi|297521386|ref|ZP_06939772.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli OP50]
 gi|298379741|ref|ZP_06989346.1| sdhC [Escherichia coli FVEC1302]
 gi|60392191|sp|P69054|DHSC_ECOLI RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|60392192|sp|P69055|DHSC_ECO57 RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|28948820|pdb|1NEK|C Chain C, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Ubiquinone Bound
 gi|28948824|pdb|1NEN|C Chain C, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Dinitrophenol-17 Inhibitor Co-Crystallized At The
           Ubiquinone Binding Site
 gi|85544086|pdb|2ACZ|C Chain C, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Atpenin A5 Inhibitor Co-Crystallized At The Ubiquinone
           Binding Site
 gi|256599502|pdb|2WDQ|C Chain C, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599506|pdb|2WDQ|G Chain G, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599510|pdb|2WDQ|K Chain K, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599514|pdb|2WDV|C Chain C, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|256599518|pdb|2WDV|G Chain G, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|256599522|pdb|2WDV|K Chain K, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|259045635|pdb|2WDR|C Chain C, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|259045639|pdb|2WDR|G Chain G, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|259045643|pdb|2WDR|K Chain K, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|304445590|pdb|2WP9|C Chain C, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445594|pdb|2WP9|G Chain G, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445598|pdb|2WP9|K Chain K, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445614|pdb|2WS3|C Chain C, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
 gi|304445618|pdb|2WS3|G Chain G, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
 gi|304445622|pdb|2WS3|K Chain K, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
 gi|304445642|pdb|2WU5|C Chain C, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
 gi|304445646|pdb|2WU5|G Chain G, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
 gi|304445650|pdb|2WU5|K Chain K, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
 gi|12513636|gb|AAG55045.1|AE005250_4 succinate dehydrogenase, cytochrome b556 [Escherichia coli O157:H7
           str. EDL933]
 gi|42923|emb|CAA25485.1| unnamed protein product [Escherichia coli]
 gi|146197|gb|AAA23893.1| succinate dehydrogenase [Escherichia coli K-12]
 gi|495784|gb|AAA24616.1| succinate dehydrogenase [Escherichia coli]
 gi|1651317|dbj|BAA35388.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K12 substr. W3110]
 gi|1786940|gb|AAC73815.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. MG1655]
 gi|13360204|dbj|BAB34169.1| succinate dehydrogenase [Escherichia coli O157:H7 str. Sakai]
 gi|73854722|gb|AAZ87429.1| succinate dehydrogenase, cytochrome b556 [Shigella sonnei Ss046]
 gi|81240137|gb|ABB60847.1| succinate dehydrogenase [Shigella dysenteriae Sd197]
 gi|81244559|gb|ABB65267.1| succinate dehydrogenase [Shigella boydii Sb227]
 gi|169888223|gb|ACB01930.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. DH10B]
 gi|209776538|gb|ACI86581.1| succinate dehydrogenase [Escherichia coli]
 gi|209776540|gb|ACI86582.1| succinate dehydrogenase [Escherichia coli]
 gi|209776542|gb|ACI86583.1| succinate dehydrogenase [Escherichia coli]
 gi|209776544|gb|ACI86584.1| succinate dehydrogenase [Escherichia coli]
 gi|209776546|gb|ACI86585.1| succinate dehydrogenase [Escherichia coli]
 gi|218350877|emb|CAU96575.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli 55989]
 gi|218431135|emb|CAR12011.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli UMN026]
 gi|238863588|gb|ACR65586.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli BW2952]
 gi|242376483|emb|CAQ31187.1| succinate dehydrogenase membrane protein, subunit of succinate
           dehydrogenase [Escherichia coli BL21(DE3)]
 gi|253972692|gb|ACT38363.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli B str. REL606]
 gi|253976886|gb|ACT42556.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli BL21(DE3)]
 gi|254591267|gb|ACT70628.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O157:H7 str. TW14359]
 gi|290761526|gb|ADD55487.1| Succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           O55:H7 str. CB9615]
 gi|291428551|gb|EFF01576.1| sdhC [Escherichia coli FVEC1412]
 gi|291469563|gb|EFF12047.1| succinate dehydrogenase [Escherichia coli B354]
 gi|298279439|gb|EFI20947.1| sdhC [Escherichia coli FVEC1302]
 gi|309700943|emb|CBJ00240.1| succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           ETEC H10407]
 gi|324116262|gb|EGC10183.1| succinate dehydrogenase [Escherichia coli E1167]
 gi|332342056|gb|AEE55390.1| succinate dehydrogenase, cytochrome b556 subunit, SdhC [Escherichia
           coli UMNK88]
          Length = 129

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 4   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 57

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 58  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 117

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 118 VVLSLLAGVLVW 129


>gi|215485740|ref|YP_002328171.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218557637|ref|YP_002390550.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli S88]
 gi|312965151|ref|ZP_07779388.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           2362-75]
 gi|215263812|emb|CAS08149.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218364406|emb|CAR02086.2| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli S88]
 gi|312290242|gb|EFR18125.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           2362-75]
          Length = 129

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 4   NVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 57

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 58  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 117

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 118 VVFSLLAGVLVW 129


>gi|110640930|ref|YP_668658.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli 536]
 gi|170679876|ref|YP_001742822.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli SMS-3-5]
 gi|227884312|ref|ZP_04002117.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli 83972]
 gi|300937822|ref|ZP_07152618.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 21-1]
 gi|300989869|ref|ZP_07178998.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 45-1]
 gi|301020818|ref|ZP_07184882.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 69-1]
 gi|301046045|ref|ZP_07193225.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 185-1]
 gi|306812870|ref|ZP_07447063.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli NC101]
 gi|331645870|ref|ZP_08346973.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           M605]
 gi|26107087|gb|AAN79271.1|AE016757_175 Succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           CFT073]
 gi|110342522|gb|ABG68759.1| succinate dehydrogenase cytochrome subunit [Escherichia coli 536]
 gi|170517594|gb|ACB15772.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           SMS-3-5]
 gi|227838398|gb|EEJ48864.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli 83972]
 gi|300301962|gb|EFJ58347.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 185-1]
 gi|300398464|gb|EFJ82002.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 69-1]
 gi|300407272|gb|EFJ90810.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 45-1]
 gi|300457187|gb|EFK20680.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 21-1]
 gi|305853633|gb|EFM54072.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli NC101]
 gi|307552573|gb|ADN45348.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           ABU 83972]
 gi|312945246|gb|ADR26073.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|315292034|gb|EFU51386.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 153-1]
 gi|315299240|gb|EFU58494.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 16-3]
 gi|323967428|gb|EGB62848.1| succinate dehydrogenase [Escherichia coli M863]
 gi|323976308|gb|EGB71398.1| succinate dehydrogenase [Escherichia coli TW10509]
 gi|324006245|gb|EGB75464.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 57-2]
 gi|324114831|gb|EGC08799.1| succinate dehydrogenase [Escherichia fergusonii B253]
 gi|331044622|gb|EGI16749.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           M605]
          Length = 134

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|209916098|gb|ACI95893.1| succinate dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|217331572|gb|ACK38298.1| succinate dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|217331586|gb|ACK38312.1| succinate dehydrogenase subunit 3 [Isoetes engelmannii]
          Length = 98

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
          +K NRPLSPHL IY+   T   SI HRI+G+++     +    F+ I +   T      +
Sbjct: 1  MKINRPLSPHLTIYKPQLTSTFSIFHRISGALLAAKV-LFSLPFWKIGDLSLTFYHSYSF 59

Query: 64 MDGSVFEVCLFLYT---WAVIHHMLGGIRYLIWD 94
                   + L      A  +HM  G+R+L WD
Sbjct: 60 FFFVFHWFIILLVNLTFLAFCYHMSNGVRHLWWD 93


>gi|330813447|ref|YP_004357686.1| succinate dehydrogenase cytochrome b-556 subunit [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486542|gb|AEA80947.1| succinate dehydrogenase cytochrome b-556 subunit [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 65

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%)

Query: 76  YTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           +TW+  +H+L G+R+L WD+    + K A       + +S L  +I+W++ 
Sbjct: 15  FTWSFCYHLLNGLRHLFWDMGYGYEIKTANFSGIFVLTSSFLLTIILWVVS 65


>gi|115721219|ref|XP_001188484.1| PREDICTED: similar to LOC496650 protein, partial
           [Strongylocentrotus purpuratus]
 gi|115803641|ref|XP_782812.2| PREDICTED: similar to LOC496650 protein, partial
           [Strongylocentrotus purpuratus]
          Length = 116

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-EHTLSSLRCYMD 65
           NRP+SPHL IY    T  +SI HR TG  + +G   +      + +   H L  ++    
Sbjct: 30  NRPMSPHLTIYSPQVTSMLSITHRGTGVGLTVGIYALGLSMSVLPHDFAHYLEMIKALSF 89

Query: 66  G-SVFEVCLFLYTWAVIHHMLGGIRYL 91
           G S+  +      W V  H L G+R+L
Sbjct: 90  GPSLLFLTKMAIVWPVAFHSLNGVRHL 116


>gi|295841399|dbj|BAJ07113.1| succinate dehydrogenase subunit C [Corynespora cassiicola]
          Length = 177

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEH----TLSS 59
            RP+SPHL IYR   T + S  +RITG  V L   + +F F  +A    G H    ++ +
Sbjct: 53  QRPVSPHLSIYRPQITWYASSFNRITG--VALSGGLYLFGFAYLAAPTLGWHLETQSMVA 110

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQ 106
                  +               H L G+R+L WD+ L    K   Q
Sbjct: 111 AVAAWPVAAKVAAKISIAMPFFFHSLNGLRHLSWDIGLGFKNKAVIQ 157


>gi|296808871|ref|XP_002844774.1| succinate dehydrogenase cytochrome b560 subunit [Arthroderma otae
           CBS 113480]
 gi|238844257|gb|EEQ33919.1| succinate dehydrogenase cytochrome b560 subunit [Arthroderma otae
           CBS 113480]
          Length = 225

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 17/107 (15%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVV----------YLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T ++S ++RITG+++          YL +P++  W       E  
Sbjct: 102 NRPVSPHLSIYRPQITWYLSSLNRITGAILSGSLYIFASAYLVSPLLG-WHL-----ESA 155

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
             +          +V + F        H   G+R+L+WD+   L  +
Sbjct: 156 SLAAAFAALPIAAKVAMKFTMALPFTFHCYNGVRHLVWDMGKQLTNQ 202


>gi|332535002|ref|ZP_08410818.1| succinate dehydrogenase cytochrome b-556 subunit [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035569|gb|EGI72062.1| succinate dehydrogenase cytochrome b-556 subunit [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 137

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 62/125 (49%), Gaps = 4/125 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVF-WFFCIANGEHTLSSLR 61
           ++K  RP++  L    +  T   SI HR+TG  ++     V++ W   +++ E     ++
Sbjct: 12  TVKKQRPVNLDLTTISMPATAKASIFHRVTGVALFFALTFVIWAWSESLSSAE-GFEFVK 70

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
              +G + +   +     + +H++GGIR++I D+    + +     AK+++   ++  ++
Sbjct: 71  GLFNGFIAKFIAWGTVSVLGYHLIGGIRHMIMDMGHWEELESGNLSAKVSMALGVVFAVL 130

Query: 122 --VWI 124
             VWI
Sbjct: 131 AGVWI 135


>gi|295841401|dbj|BAJ07114.1| succinate dehydrogenase subunit C [Corynespora cassiicola]
          Length = 177

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEH----TLSS 59
            RP+SPHL IYR   T + S  +RITG  V L   + +F F  +A    G H    ++ +
Sbjct: 53  QRPVSPHLSIYRPQITWYASPFNRITG--VALSGGLYLFGFAYLAAPTLGWHLETQSMVA 110

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQ 106
                  +               H L G+R+L WD+ L    K   Q
Sbjct: 111 AVAAWPVAAKVAAKISIAMPFFFHSLNGLRHLSWDIGLGFKNKAVIQ 157


>gi|323398684|ref|YP_004222759.1| succinate dehydrogenase subunit 3 [Glaucocystis nostochinearum]
 gi|321401377|gb|ADW83131.1| succinate dehydrogenase subunit 3 [Glaucocystis nostochinearum]
          Length = 142

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 12/104 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           NRP+SPHL IY++     +SI +RI+  V  L + +   W+  I       ++L   +  
Sbjct: 4   NRPISPHLSIYKIQINSLLSITNRISSLV--LSSIIFSIWYNHILYNIFYTNNLYYLLIK 61

Query: 67  SVFEVCLF----------LYTWAVIHHMLGGIRYLIWDVSLCLD 100
           ++F   L+                 +H+  GIR+L WD+   L 
Sbjct: 62  NIFITLLYNDIFIKSFIFFIFLNFYYHIFSGIRHLYWDIGQGLK 105


>gi|254253640|ref|ZP_04946957.1| Succinate dehydrogenase cytochrome b subunit [Burkholderia dolosa
           AUO158]
 gi|124898285|gb|EAY70128.1| Succinate dehydrogenase cytochrome b subunit [Burkholderia dolosa
           AUO158]
          Length = 138

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 46/80 (57%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     +SI+HR++G++++L  P ++F F      E +    + ++   V ++ + + 
Sbjct: 24  YRLPLAAKLSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEVFKAFLSNIVVKLIVLVL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA  HH   GIR+L+ DV+
Sbjct: 84  SWAFFHHFCAGIRHLLMDVN 103


>gi|332184747|gb|AEE27001.1| Succinate dehydrogenase cytochrome b-556 subunit [Francisella cf.
           novicida 3523]
          Length = 126

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 2/121 (1%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M  I N   +S  ++ Y    T   SI+HRI+G V+ +  P+ V        G       
Sbjct: 1   MKKITNIDLMS--IKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQT 58

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  S F V  +L+  ++ +H+  GIR++I D+      K+A   + + I+  +L+ +
Sbjct: 59  VAVLTKSWFSVFFWLFLSSITYHVYAGIRHMIMDMGFGESMKVAKLTSLLVIVLGVLSAV 118

Query: 121 I 121
           +
Sbjct: 119 L 119


>gi|221203641|ref|ZP_03576659.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
          multivorans CGD2]
 gi|221175807|gb|EEE08236.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
          multivorans CGD2]
          Length = 117

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 46/80 (57%)

Query: 17 YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
          YRL     +SI+HR++G++++L  P ++F F      E +    + ++   V ++ + + 
Sbjct: 3  YRLPLAAKLSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEVFKAFLSNIVVKLIVLVL 62

Query: 77 TWAVIHHMLGGIRYLIWDVS 96
          +WA  HH   GIR+L+ DV+
Sbjct: 63 SWAFFHHFCAGIRHLLMDVN 82


>gi|161521191|ref|YP_001584618.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189352633|ref|YP_001948260.1| succinate dehydrogenase cytochrome b-556 subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221196968|ref|ZP_03570015.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans CGD2M]
 gi|221212430|ref|ZP_03585407.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans CGD1]
 gi|160345241|gb|ABX18326.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189336655|dbj|BAG45724.1| succinate dehydrogenase cytochrome b-556 subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221167529|gb|EED99998.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans CGD1]
 gi|221183522|gb|EEE15922.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans CGD2M]
          Length = 138

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 46/80 (57%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     +SI+HR++G++++L  P ++F F      E +    + ++   V ++ + + 
Sbjct: 24  YRLPLAAKLSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEVFKAFLSNIVVKLIVLVL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA  HH   GIR+L+ DV+
Sbjct: 84  SWAFFHHFCAGIRHLLMDVN 103


>gi|304395703|ref|ZP_07377586.1| succinate dehydrogenase, cytochrome b556 subunit [Pantoea sp. aB]
 gi|304356997|gb|EFM21361.1| succinate dehydrogenase, cytochrome b556 subunit [Pantoea sp. aB]
          Length = 146

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 58/127 (45%), Gaps = 5/127 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  L   R   T   SI+HR++G +  +   ++++      +         
Sbjct: 20  KTVKKQRPVNLDLSTIRFPVTAITSILHRVSGVITLVAIGILLWLLGLSLSSPEGFQHAA 79

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASI 116
             MDG   +  ++    A+ +H + GIR+++ D      +L   K+ A     I ++ +I
Sbjct: 80  SIMDGFFAKFIMWGILTALAYHAVSGIRHMLMDFGYLAETLESGKRSAHMTFVITVVLAI 139

Query: 117 LTVLIVW 123
           L  ++VW
Sbjct: 140 LAGVLVW 146


>gi|91209755|ref|YP_539741.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli UTI89]
 gi|117622915|ref|YP_851828.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli APEC O1]
 gi|237707317|ref|ZP_04537798.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia sp. 3_2_53FAA]
 gi|91071329|gb|ABE06210.1| succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           UTI89]
 gi|115512039|gb|ABJ00114.1| succinate dehydrogenase cytochrome b-556 subunit [Escherichia coli
           APEC O1]
 gi|226898527|gb|EEH84786.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia sp. 3_2_53FAA]
 gi|294490296|gb|ADE89052.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           IHE3034]
 gi|307627864|gb|ADN72168.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli UM146]
 gi|315287165|gb|EFU46577.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 110-3]
 gi|323952720|gb|EGB48588.1| succinate dehydrogenase [Escherichia coli H252]
 gi|323958465|gb|EGB54171.1| succinate dehydrogenase [Escherichia coli H263]
          Length = 134

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVFSLLAGVLVW 134


>gi|157154902|ref|YP_001461881.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli E24377A]
 gi|157160201|ref|YP_001457519.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli HS]
 gi|168750652|ref|ZP_02775674.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4113]
 gi|168757174|ref|ZP_02782181.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4401]
 gi|168764002|ref|ZP_02789009.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4501]
 gi|168767161|ref|ZP_02792168.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4486]
 gi|168779204|ref|ZP_02804211.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786874|ref|ZP_02811881.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC869]
 gi|168801370|ref|ZP_02826377.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC508]
 gi|170020934|ref|YP_001725888.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli ATCC 8739]
 gi|187730828|ref|YP_001879375.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella boydii CDC 3083-94]
 gi|188495042|ref|ZP_03002312.1| succinate dehydrogenase cytochrome b556 subunit [Escherichia coli
           53638]
 gi|191167211|ref|ZP_03029030.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           B7A]
 gi|193070632|ref|ZP_03051569.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           E110019]
 gi|194433973|ref|ZP_03066244.1| succinate dehydrogenase, cytochrome b556 subunit [Shigella
           dysenteriae 1012]
 gi|194439251|ref|ZP_03071331.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           101-1]
 gi|195939062|ref|ZP_03084444.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H7 str. EC4024]
 gi|208809581|ref|ZP_03251918.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4206]
 gi|208815578|ref|ZP_03256757.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4045]
 gi|208823149|ref|ZP_03263467.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4042]
 gi|209397702|ref|YP_002269343.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4115]
 gi|217326122|ref|ZP_03442206.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. TW14588]
 gi|253774308|ref|YP_003037139.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|256023677|ref|ZP_05437542.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia sp. 4_1_40B]
 gi|261224422|ref|ZP_05938703.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261254587|ref|ZP_05947120.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. FRIK966]
 gi|293413998|ref|ZP_06656647.1| succinate dehydrogenase [Escherichia coli B185]
 gi|300816369|ref|ZP_07096591.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 107-1]
 gi|300822991|ref|ZP_07103126.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 119-7]
 gi|300900716|ref|ZP_07118865.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 198-1]
 gi|300906978|ref|ZP_07124647.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 84-1]
 gi|300918380|ref|ZP_07134980.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 115-1]
 gi|300929475|ref|ZP_07144943.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 187-1]
 gi|300947200|ref|ZP_07161410.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 116-1]
 gi|300957667|ref|ZP_07169857.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 175-1]
 gi|301027099|ref|ZP_07190471.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 196-1]
 gi|301305207|ref|ZP_07211305.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 124-1]
 gi|301648024|ref|ZP_07247791.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 146-1]
 gi|307137332|ref|ZP_07496688.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli H736]
 gi|309797434|ref|ZP_07691826.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 145-7]
 gi|331641222|ref|ZP_08342357.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           H736]
 gi|331651719|ref|ZP_08352738.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           M718]
 gi|331662074|ref|ZP_08362997.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA143]
 gi|331667087|ref|ZP_08367952.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA271]
 gi|331672237|ref|ZP_08373028.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA280]
 gi|331676403|ref|ZP_08377100.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           H591]
 gi|331682152|ref|ZP_08382774.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           H299]
 gi|157065881|gb|ABV05136.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           HS]
 gi|157076932|gb|ABV16640.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           E24377A]
 gi|169755862|gb|ACA78561.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           ATCC 8739]
 gi|187427820|gb|ACD07094.1| succinate dehydrogenase, cytochrome b556 subunit [Shigella boydii
           CDC 3083-94]
 gi|188015176|gb|EDU53298.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4113]
 gi|188490241|gb|EDU65344.1| succinate dehydrogenase cytochrome b556 subunit [Escherichia coli
           53638]
 gi|189003141|gb|EDU72127.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4076]
 gi|189355778|gb|EDU74197.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4401]
 gi|189363510|gb|EDU81929.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4486]
 gi|189365913|gb|EDU84329.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4501]
 gi|189372990|gb|EDU91406.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC869]
 gi|189376480|gb|EDU94896.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC508]
 gi|190902759|gb|EDV62489.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           B7A]
 gi|192956020|gb|EDV86486.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           E110019]
 gi|194417738|gb|EDX33836.1| succinate dehydrogenase, cytochrome b556 subunit [Shigella
           dysenteriae 1012]
 gi|194421836|gb|EDX37843.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           101-1]
 gi|208729382|gb|EDZ78983.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4206]
 gi|208732226|gb|EDZ80914.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4045]
 gi|208737342|gb|EDZ85026.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4042]
 gi|209159102|gb|ACI36535.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. EC4115]
 gi|217322343|gb|EEC30767.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           O157:H7 str. TW14588]
 gi|253325352|gb|ACT29954.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260450125|gb|ACX40547.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           DH1]
 gi|291434056|gb|EFF07029.1| succinate dehydrogenase [Escherichia coli B185]
 gi|299879433|gb|EFI87644.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 196-1]
 gi|300315612|gb|EFJ65396.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 175-1]
 gi|300355775|gb|EFJ71645.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 198-1]
 gi|300401199|gb|EFJ84737.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 84-1]
 gi|300414443|gb|EFJ97753.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 115-1]
 gi|300453186|gb|EFK16806.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 116-1]
 gi|300462584|gb|EFK26077.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 187-1]
 gi|300524532|gb|EFK45601.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 119-7]
 gi|300531059|gb|EFK52121.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 107-1]
 gi|300839519|gb|EFK67279.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 124-1]
 gi|301073850|gb|EFK88656.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 146-1]
 gi|308118958|gb|EFO56220.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 145-7]
 gi|315135377|dbj|BAJ42536.1| succinate dehydrogenase [Escherichia coli DH1]
 gi|315257638|gb|EFU37606.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 85-1]
 gi|320637968|gb|EFX07737.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H7 str. G5101]
 gi|320643363|gb|EFX12543.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H- str. 493-89]
 gi|320648712|gb|EFX17345.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H- str. H 2687]
 gi|320654296|gb|EFX22349.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320659929|gb|EFX27471.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664753|gb|EFX31891.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Escherichia coli O157:H7 str. LSU-61]
 gi|323938299|gb|EGB34556.1| succinate dehydrogenase [Escherichia coli E1520]
 gi|323942943|gb|EGB39107.1| succinate dehydrogenase [Escherichia coli E482]
 gi|323947014|gb|EGB43028.1| succinate dehydrogenase [Escherichia coli H120]
 gi|323963102|gb|EGB58672.1| succinate dehydrogenase [Escherichia coli H489]
 gi|323972006|gb|EGB67226.1| succinate dehydrogenase [Escherichia coli TA007]
 gi|331038020|gb|EGI10240.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           H736]
 gi|331049997|gb|EGI22055.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           M718]
 gi|331060496|gb|EGI32460.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA143]
 gi|331065443|gb|EGI37336.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA271]
 gi|331070432|gb|EGI41796.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           TA280]
 gi|331075896|gb|EGI47193.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           H591]
 gi|331080576|gb|EGI51752.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           H299]
          Length = 134

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|221129025|ref|XP_002164804.1| PREDICTED: similar to succinate dehydrogenase complex, subunit C
           [Hydra magnipapillata]
          Length = 186

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 53/125 (42%), Gaps = 11/125 (8%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-----NGEHTLSS 59
           +  RPLSPH+ IY+      +S  HR TG    L    +VF     A       E  +  
Sbjct: 60  RMQRPLSPHITIYKFELPGLLSGTHRFTG----LAMSGIVFTVGSAALLLPGGAESYIDM 115

Query: 60  LRCY-MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI-L 117
           +R   +   V      L  + + +H + G+R+LIWD     + K   +     +  SI L
Sbjct: 116 IRALNLPIWVLAPAKCLIAFPLCYHTVNGVRHLIWDTGRGFEMKTLYKTGYFAVATSIAL 175

Query: 118 TVLIV 122
           T+ IV
Sbjct: 176 TIGIV 180


>gi|296103350|ref|YP_003613496.1| succinate dehydrogenase cytochrome b-556 subunit [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295057809|gb|ADF62547.1| succinate dehydrogenase cytochrome b-556 subunit [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 159

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L+  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 34  NVKKQRPVNLDLKTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 87

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLD-----KKIATQMAKIN 111
           ++  S      F+    W ++    +H++ GIR+++ D     +     K+ A     I 
Sbjct: 88  FLQASAIMNSFFVKFIMWGILTALAYHVVVGIRHMLMDFGYLEETFEAGKRSANISFVIT 147

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 148 VVLSLLAGVLVW 159


>gi|170702918|ref|ZP_02893759.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170132177|gb|EDT00664.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 138

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 53/101 (52%), Gaps = 6/101 (5%)

Query: 2   SSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            +++  RP   ++ I      YR+     +SI+HR++G++++L  P V+F F      E 
Sbjct: 3   DAVRKPRPEYRNIGIGDITLKYRMPLAAILSILHRVSGALLFLFLPFVLFLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           +    + ++   V ++ +   +WA  HH   GIR+L+ DV+
Sbjct: 63  SFEVFKAFLSNIVVKLIVLALSWAFFHHFCAGIRHLLMDVN 103


>gi|119472931|ref|ZP_01614804.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhD [Alteromonadales bacterium TW-7]
 gi|119444649|gb|EAW25958.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhD [Alteromonadales bacterium TW-7]
          Length = 153

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 62/125 (49%), Gaps = 4/125 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVF-WFFCIANGEHTLSSLR 61
           ++K  RP++  L    +  T   SI HR+TG  ++     V++ W   +++ E +   ++
Sbjct: 28  TVKKQRPVNLDLTTISMPATAKASIFHRVTGVALFFALTFVIWAWSESLSSAE-SFEFVK 86

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
              +G + +   +     + +H++GGIR+++ D+    + +     AKI +   ++  ++
Sbjct: 87  GLFNGFIAKFIAWGTISVLGYHLIGGIRHMVMDMGHWEELESGNLSAKIAMALGVVFAVL 146

Query: 122 --VWI 124
             VWI
Sbjct: 147 AGVWI 151


>gi|254434682|ref|ZP_05048190.1| succinate dehydrogenase, cytochrome b556 subunit [Nitrosococcus
           oceani AFC27]
 gi|207091015|gb|EDZ68286.1| succinate dehydrogenase, cytochrome b556 subunit [Nitrosococcus
           oceani AFC27]
          Length = 102

 Score = 38.1 bits (87), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 17/104 (16%)

Query: 29  HRITGSVVYLGTPVVVFWF-FCIANGE------HTLSSLRCYMDGSVFEVCLFLYTWAVI 81
           HRI+G ++    PVVV+   F + + E         SSL   + G V         WA++
Sbjct: 2   HRISGVILLFFIPVVVYLLDFSLRDKESFVWVTEFFSSLPVRLVGIV-------ALWALL 54

Query: 82  HHMLGGIRYLIWDV---SLCLDKKIATQMAKINIIASILTVLIV 122
           HH+  GIR+L++D+    +  D + +      +I+A ++T+LIV
Sbjct: 55  HHIFAGIRFLLFDIHMGKIVKDYRPSWSARITSILALVVTLLIV 98


>gi|191174045|ref|ZP_03035561.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           F11]
 gi|300996468|ref|ZP_07181442.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 200-1]
 gi|190905653|gb|EDV65276.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           F11]
 gi|300304522|gb|EFJ59042.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 200-1]
 gi|324010442|gb|EGB79661.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 60-1]
          Length = 134

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NLKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|332970371|gb|EGK09363.1| succinate dehydrogenase cytochrome b558 subunit [Kingella kingae
           ATCC 23330]
          Length = 127

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 20  IPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWA 79
           IP + VSI+HR +G  ++L  P+++       +        + + D +  ++ L+   W 
Sbjct: 21  IPAI-VSILHRASGVAIFLFLPILLALLAGSLSSGEVFLQYKSWADNAFIKLILWGILWL 79

Query: 80  VIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
            IHH+  GIR+L+ D  + ++ + A + A+I +  +  T  
Sbjct: 80  FIHHLFAGIRFLLIDAHIGVELQAARKSARIVLFGAAATAF 120


>gi|134301286|ref|YP_001121254.1| succinate dehydrogenase, cytochrome b subunit [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|167009437|ref|ZP_02274368.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. holarctica FSC200]
 gi|194324383|ref|ZP_03058156.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. novicida FTE]
 gi|208780227|ref|ZP_03247569.1| succinate dehydrogenase, cytochrome b556 [Francisella novicida FTG]
 gi|134049063|gb|ABO46134.1| succinate dehydrogenase, cytochrome b subunit [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|194321448|gb|EDX18933.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. novicida FTE]
 gi|208743876|gb|EDZ90178.1| succinate dehydrogenase, cytochrome b556 [Francisella novicida FTG]
 gi|282158360|gb|ADA77751.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. tularensis NE061598]
          Length = 126

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 2/121 (1%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M  I N   +S  ++ Y    T   SI+HRI+G V+ +  P+ V        G       
Sbjct: 1   MKKITNIDLMS--IKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQT 58

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  S F V  +L+  ++ +H+  GIR++I D+      K+A   + + I+  +L+ +
Sbjct: 59  VTVLTKSWFSVFFWLFLSSITYHVYAGIRHMIMDMGFGESMKVAKITSLLVIVLGVLSAI 118

Query: 121 I 121
           +
Sbjct: 119 L 119


>gi|302878557|ref|YP_003847121.1| succinate dehydrogenase, cytochrome b556 subunit [Gallionella
           capsiferriformans ES-2]
 gi|302581346|gb|ADL55357.1| succinate dehydrogenase, cytochrome b556 subunit [Gallionella
           capsiferriformans ES-2]
          Length = 124

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 57/117 (48%), Gaps = 1/117 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP    L + +L    FVSI+HRI+G  ++L  P+ +           T +SL   + 
Sbjct: 3   KKRPKHLALHLIKLPLPGFVSILHRISGLALFLALPLFLLMLQYSLRSVETYTSLMDVLS 62

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS-ILTVLI 121
             + ++ L    W+ +HH   GIRYL  D+    +   A   +KI ++ S +LTVLI
Sbjct: 63  HPLAKLVLLGLLWSFLHHFCAGIRYLAIDLHYISNLAEARSSSKIVMVVSLLLTVLI 119


>gi|195571827|ref|XP_002103902.1| GD20679 [Drosophila simulans]
 gi|194199829|gb|EDX13405.1| GD20679 [Drosophila simulans]
          Length = 152

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRC-YM 64
            R LSPHL IY+   T  +SI HR TG ++      + +       +  H ++ +    +
Sbjct: 32  GRELSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQL 91

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  +   +H   GIR+L+WD    L  K
Sbjct: 92  SGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIK 129


>gi|313814|emb|CAA52088.1| succinate dehydrogenase cytochrome b subunit [Saccharomyces
           cerevisiae]
          Length = 198

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S +HRI  S+V +G   + F+ F I  G       
Sbjct: 68  LNKQRAKRPISPHLTIYQPQLTWYLSSLHRI--SLVLMG---LGFYLFTILFGVSGLLGL 122

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 123 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 180

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 181 GYALIGFTAVLGTYLLT 197


>gi|325182722|emb|CCA17177.1| transmembrane protein putative [Albugo laibachii Nc14]
          Length = 170

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE--HTLSSLRCYMD 65
           RP+SPH+QIY +  T   SI +R+TG  + +G   V    + +  G+    + S +  + 
Sbjct: 43  RPVSPHVQIYAMPITAVSSITNRVTGVGLSVG--FVAASSYALVGGDVPSLIHSAQVSIP 100

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
                  LF+  + + +H L  IR++ WD
Sbjct: 101 AFTPLSKLFV-AFPLSYHTLAAIRHMAWD 128


>gi|195389540|ref|XP_002053434.1| GJ23876 [Drosophila virilis]
 gi|194151520|gb|EDW66954.1| GJ23876 [Drosophila virilis]
          Length = 269

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGT-PVVVFWFFCIANGEHTLSSL-RCYMD 65
           R +SPHL IY+   T  +SI  RI+G ++ +G   + +    C  +       + +C   
Sbjct: 100 RAMSPHLSIYKKQLTSVMSIFLRISGFILGIGIWTIGLTGLLCDIDVNAMAEKIEKCDCS 159

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            +VF +          +H++ G R+LIW +++ L K+
Sbjct: 160 RTVFNMLKLFIIIPFAYHIVAGTRHLIWHLNVFLSKR 196


>gi|114775456|ref|ZP_01451024.1| hypothetical protein SPV1_03988 [Mariprofundus ferrooxydans PV-1]
 gi|114553567|gb|EAU55948.1| hypothetical protein SPV1_03988 [Mariprofundus ferrooxydans PV-1]
          Length = 104

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 50/103 (48%)

Query: 23  MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIH 82
           M  S+VHR +G V+ L  P+ ++    +          + ++   + ++ L+L   A+  
Sbjct: 1   MLASVVHRASGLVLVLFVPLYLWLLHGMTGSPEDFVQAQSWLHSELGKLSLWLAGIALFF 60

Query: 83  HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
           H   G+R+L  D   C  +++    A+I I  +++  LI+ I+
Sbjct: 61  HFCNGLRFLSIDAGWCESRQMMRLSARIVIALTLVIALILGIL 103


>gi|194902122|ref|XP_001980598.1| GG17240 [Drosophila erecta]
 gi|190652301|gb|EDV49556.1| GG17240 [Drosophila erecta]
          Length = 152

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRC-YM 64
            R LSPHL IY+   T  +SI HR TG ++      + +       +  H ++ +    +
Sbjct: 32  GRKLSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQL 91

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  +   +H   GIR+L+WD    L  K
Sbjct: 92  SGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIK 129


>gi|38048273|gb|AAR10039.1| similar to Drosophila melanogaster CG6666 [Drosophila yakuba]
          Length = 152

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRC-YM 64
            R LSPHL IY+   T  +SI HR TG ++      + +       +  H ++ +    +
Sbjct: 32  GRKLSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQL 91

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  +   +H   GIR+L+WD    L  K
Sbjct: 92  SGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIK 129


>gi|21064663|gb|AAM29561.1| RH04289p [Drosophila melanogaster]
          Length = 171

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRC-YM 64
            R LSPHL IY+   T  +SI HR TG ++      + +       +  H ++ +    +
Sbjct: 51  GRELSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQL 110

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  +   +H   GIR+L+WD    L  K
Sbjct: 111 SGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIK 148


>gi|6322708|ref|NP_012781.1| Sdh3p [Saccharomyces cerevisiae S288c]
 gi|464750|sp|P33421|SDH3_YEAST RecName: Full=Succinate dehydrogenase [ubiquinone] cytochrome b
           subunit, mitochondrial; Flags: Precursor
 gi|396438|emb|CAA80957.1| succinate dehydrogenase cytochrome b subunit [Saccharomyces
           cerevisiae]
 gi|486241|emb|CAA81982.1| SDH3 [Saccharomyces cerevisiae]
 gi|51013499|gb|AAT93043.1| YKL141W [Saccharomyces cerevisiae]
 gi|285813124|tpg|DAA09021.1| TPA: Sdh3p [Saccharomyces cerevisiae S288c]
          Length = 198

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 60/133 (45%), Gaps = 22/133 (16%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-------EHTL 57
           +  RP+SPHL IY+   T ++S +HRI  S+V +G   + F+ F I  G         T 
Sbjct: 72  RAKRPISPHLTIYQPQLTWYLSSLHRI--SLVLMG---LGFYLFTILFGVSGLLGLGLTT 126

Query: 58  SSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIATQMAK 109
             +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T  A 
Sbjct: 127 EKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRTGYAL 184

Query: 110 INIIASILTVLIV 122
           I   A + T L+ 
Sbjct: 185 IGFTAVLGTYLLT 197


>gi|89257051|ref|YP_514413.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. holarctica LVS]
 gi|89144882|emb|CAJ80227.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. holarctica LVS]
          Length = 129

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)

Query: 1   MSSIKNNRPLS-PHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           MSS+K    +    ++ Y    T   SI+HRI+G V+ +  P+ V        G      
Sbjct: 1   MSSMKKITNIDLMSIKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQ 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               +  S F V  +L+  ++ +H+  GIR++I D+      K+A   + + I+  +L+ 
Sbjct: 61  TVTVLTKSWFSVFFWLFLSSITYHVYAGIRHMIMDMGFGESMKVAKITSLLVIVLGVLSA 120

Query: 120 LI 121
           ++
Sbjct: 121 IL 122


>gi|86147665|ref|ZP_01065974.1| Succinate dehydrogenase [Vibrio sp. MED222]
 gi|85834576|gb|EAQ52725.1| Succinate dehydrogenase [Vibrio sp. MED222]
          Length = 126

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RP++  LQ      T   SI+HR++G + ++   ++++      +           +
Sbjct: 4   RKTRPVNLDLQTIHFPITAIASILHRVSGVITFVAIGILLWLLSISLSSPVGFMEASDIV 63

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GGIR+L+ D+    + +   + AK+   A    S+L  +
Sbjct: 64  DGFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELESGAKSAKVAFAATAVLSLLAGI 123

Query: 121 IVW 123
           +VW
Sbjct: 124 LVW 126


>gi|45550736|ref|NP_650047.3| succinate dehydrogenase C [Drosophila melanogaster]
 gi|195329931|ref|XP_002031662.1| GM26120 [Drosophila sechellia]
 gi|17946639|gb|AAL49350.1| RH44771p [Drosophila melanogaster]
 gi|45446453|gb|AAF54602.2| succinate dehydrogenase C [Drosophila melanogaster]
 gi|194120605|gb|EDW42648.1| GM26120 [Drosophila sechellia]
          Length = 171

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRC-YM 64
            R LSPHL IY+   T  +SI HR TG ++      + +       +  H ++ +    +
Sbjct: 51  GRELSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQL 110

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  +   +H   GIR+L+WD    L  K
Sbjct: 111 SGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIK 148


>gi|332678935|gb|AEE88064.1| Succinate dehydrogenase cytochrome b-556 subunit [Francisella cf.
           novicida Fx1]
          Length = 126

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 2/121 (1%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M  I N   +S  ++ Y    T   SI+HRI+G V+ +  P+ V        G       
Sbjct: 1   MKKITNIDLMS--IKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQT 58

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  S F V  +L+  ++ +H+  GIR++I D+      K+A   + + I+  +L+ +
Sbjct: 59  VTILTKSWFSVFFWLFLSSITYHVYAGIRHMIMDMGFGESMKVAKITSLLVIVLGVLSAI 118

Query: 121 I 121
           +
Sbjct: 119 L 119


>gi|110804651|ref|YP_688171.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella flexneri 5 str. 8401]
 gi|161485938|ref|NP_706513.2| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella flexneri 2a str. 301]
 gi|161486531|ref|NP_836287.2| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Shigella flexneri 2a str. 2457T]
 gi|110614199|gb|ABF02866.1| succinate dehydrogenase, cytochrome b556 [Shigella flexneri 5 str.
           8401]
 gi|281599964|gb|ADA72948.1| Succinate dehydrogenase cytochrome b-556 subunit [Shigella flexneri
           2002017]
          Length = 129

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++  W         +LSS   
Sbjct: 4   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILQ-WLLGT-----SLSSPEG 57

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 58  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 117

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 118 VVLSLLAGVLVW 129


>gi|218710215|ref|YP_002417836.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio splendidus LGP32]
 gi|218323234|emb|CAV19411.1| Succinate dehydrogenase cytochrome [Vibrio splendidus LGP32]
          Length = 130

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RP++  LQ      T   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKTRPVNLDLQTIHFPITAIASILHRVSGVITFVAIGILLWLLSISLSSPVGFMEASDIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GGIR+L+ D+    + +   + AK+   A    S+L  +
Sbjct: 68  DGFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELESGAKSAKVAFAATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|195499973|ref|XP_002097176.1| GE24640 [Drosophila yakuba]
 gi|194183277|gb|EDW96888.1| GE24640 [Drosophila yakuba]
          Length = 171

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG-SVVYLGTPVVVFWFFCIANGEHTLSSLRC-YM 64
            R LSPHL IY+   T  +SI HR TG ++      + +       +  H ++ +    +
Sbjct: 51  GRKLSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQL 110

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G+      F+  +   +H   GIR+L+WD    L  K
Sbjct: 111 SGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIK 148


>gi|312071011|ref|XP_003138411.1| hypothetical protein LOAG_02826 [Loa loa]
 gi|307766426|gb|EFO25660.1| hypothetical protein LOAG_02826 [Loa loa]
          Length = 187

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRCY-M 64
            RP+SPHL +Y+   T  VS  HR+TG  +     +    F  +  N    +  +R   +
Sbjct: 52  KRPISPHLTVYKPQVTWMVSGFHRVTGCAMAGALLIGGVGFALLPLNFTTFIDFIRGLGL 111

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
              V ++  F+  + ++ H L GIR++ +D++L  D
Sbjct: 112 PWVVTDMFKFVIAYPIVFHSLNGIRFIAFDLALGTD 147


>gi|330820918|ref|YP_004349780.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           gladioli BSR3]
 gi|327372913|gb|AEA64268.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           gladioli BSR3]
          Length = 138

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 65/131 (49%), Gaps = 6/131 (4%)

Query: 2   SSIKNNRPLSPHLQI------YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            +++  RP   ++ I      YRL     +SI HRI+G++++L  P ++F F      E 
Sbjct: 3   EAVRKPRPEYRNIGIGDITRHYRLPIAGQLSIFHRISGALLFLSLPFLLFLFDKSLTSEI 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
           +    + ++   + ++ + +  WA +HH   GIR+L+ DV+     K + +   I +   
Sbjct: 63  SFDVFKAFLSNIIVKLVVLVLAWAFLHHFCAGIRHLLMDVNHDAVTKESGKRTAIVVFVV 122

Query: 116 ILTVLIVWIIK 126
            L + +V+ +K
Sbjct: 123 SLALTLVFALK 133


>gi|293432990|ref|ZP_06661418.1| succinate dehydrogenase [Escherichia coli B088]
 gi|309786385|ref|ZP_07681011.1| succinate dehydrogenase, cytochrome b556 subunit [Shigella
           dysenteriae 1617]
 gi|291323809|gb|EFE63231.1| succinate dehydrogenase [Escherichia coli B088]
 gi|308925779|gb|EFP71260.1| succinate dehydrogenase, cytochrome b556 subunit [Shigella
           dysenteriae 1617]
          Length = 125

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 63/131 (48%), Gaps = 17/131 (12%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   +
Sbjct: 1   MKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEGF 54

Query: 64  MDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN----I 112
              S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    +
Sbjct: 55  EQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITV 114

Query: 113 IASILTVLIVW 123
           + S+L  ++VW
Sbjct: 115 VLSLLAGVLVW 125


>gi|323347731|gb|EGA81995.1| Sdh3p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 143

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 13  LNKQRAXRPISPHLTIYQPQLTWYLSSFHRI--SLVLMG---LGFYLFTILFGVSGLLGL 67

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 68  GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 125

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 126 GYALIGFTAVLGTYLLT 142


>gi|56707251|ref|YP_169147.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110669721|ref|YP_666278.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. tularensis FSC198]
 gi|115315406|ref|YP_764129.1| succinate dehydrogenase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|118498201|ref|YP_899251.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. novicida U112]
 gi|169656758|ref|YP_001429325.2| succinate dehydrogenase, cytochrome b subunit [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|187931028|ref|YP_001891012.1| succinate dehydrogenase, cytochrome b556 subunit [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|254369935|ref|ZP_04985943.1| succinate dehydrogenase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254373545|ref|ZP_04989032.1| succinate dehydrogenase [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254375009|ref|ZP_04990489.1| succinate dehydrogenase [Francisella novicida GA99-3548]
 gi|56603743|emb|CAG44705.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320054|emb|CAL08088.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. tularensis FSC198]
 gi|115130305|gb|ABI83492.1| succinate dehydrogenase [Francisella tularensis subsp. holarctica
           OSU18]
 gi|118424107|gb|ABK90497.1| succinate dehydrogenase, cytochrome b556 [Francisella novicida
           U112]
 gi|151568181|gb|EDN33835.1| succinate dehydrogenase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|151571270|gb|EDN36924.1| succinate dehydrogenase [Francisella novicida GA99-3549]
 gi|151572727|gb|EDN38381.1| succinate dehydrogenase [Francisella novicida GA99-3548]
 gi|164551826|gb|ABU62369.2| succinate dehydrogenase, cytochrome b subunit [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|187711937|gb|ACD30234.1| succinate dehydrogenase, cytochrome b556 subunit [Francisella
           tularensis subsp. mediasiatica FSC147]
          Length = 157

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)

Query: 1   MSSIKNNRPLS-PHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           MSS+K    +    ++ Y    T   SI+HRI+G V+ +  P+ V        G      
Sbjct: 29  MSSMKKITNIDLMSIKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQ 88

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               +  S F V  +L+  ++ +H+  GIR++I D+      K+A   + + I+  +L+ 
Sbjct: 89  TVTVLTKSWFSVFFWLFLSSITYHVYAGIRHMIMDMGFGESMKVAKITSLLVIVLGVLSA 148

Query: 120 LI 121
           ++
Sbjct: 149 IL 150


>gi|127512580|ref|YP_001093777.1| succinate dehydrogenase, cytochrome b subunit [Shewanella loihica
           PV-4]
 gi|126637875|gb|ABO23518.1| succinate dehydrogenase subunit C [Shewanella loihica PV-4]
          Length = 131

 Score = 37.7 bits (86), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 46/95 (48%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP+   LQ  R   T   SI+HR++G ++     ++++          + + ++
Sbjct: 6   QNVKKQRPVHLDLQTIRFPATAIASILHRVSGVIMLFAVGILIWLLSESLASAESFAGIQ 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
              D  + +  ++    A+ +H++ G+R+LI D  
Sbjct: 66  SLFDTFIVKFVVWGILTALGYHLIVGLRHLIMDTG 100


>gi|300926124|ref|ZP_07141937.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 182-1]
 gi|301327913|ref|ZP_07221084.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 78-1]
 gi|300417823|gb|EFK01134.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 182-1]
 gi|300845556|gb|EFK73316.1| succinate dehydrogenase, cytochrome b556 subunit [Escherichia coli
           MS 78-1]
          Length = 134

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S L  ++VW
Sbjct: 123 VVLSFLAGVLVW 134


>gi|294506383|ref|YP_003570441.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Salinibacter ruber M8]
 gi|294342711|emb|CBH23489.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Salinibacter ruber M8]
          Length = 153

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 46/107 (42%), Gaps = 16/107 (14%)

Query: 1   MSSIKNNRPLSPH-----------LQIYRLIPTMFVSIVHRITGS--VVYLGTPVVVFWF 47
           M+     RP +P             Q YR+   MF  ++HR+TG   VVYL   +V  W 
Sbjct: 1   MAVDTKERPSAPQETNATAEQESRFQSYRIRTGMFAWMMHRLTGVGLVVYL---IVHIWG 57

Query: 48  FCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
                   T ++L       +F+V  F    AV +H + G+R ++ D
Sbjct: 58  LTALTDPETFNALIAKYHSPIFKVGEFALLVAVAYHAMNGLRLVLID 104


>gi|254369888|ref|ZP_04985897.1| succinate dehydrogenase [Francisella tularensis subsp. holarctica
           FSC022]
 gi|157122858|gb|EDO66975.1| succinate dehydrogenase [Francisella tularensis subsp. holarctica
           FSC022]
          Length = 157

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 2/121 (1%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M  I N   +S  ++ Y    T   SI+HRI+G V+ +  P+ V        G       
Sbjct: 32  MKKITNIDLMS--IKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQT 89

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  S F V  +L+  ++ +H+  GIR++I D+      K+A   + + I+  +L+ +
Sbjct: 90  VTVLTKSWFSVFFWLFLSSITYHVYAGIRHMIMDMGFGESMKVAKITSLLVIVLGVLSAI 149

Query: 121 I 121
           +
Sbjct: 150 L 150


>gi|170585370|ref|XP_001897457.1| Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrialprecursor [Brugia malayi]
 gi|158595136|gb|EDP33709.1| Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrialprecursor, putative [Brugia malayi]
          Length = 188

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHL +Y+   T  VS  HR+TG  +  GT ++    F +       ++   ++ G
Sbjct: 52  KRPISPHLAVYKPQVTWMVSGFHRMTGCAM-AGTLLIGGVGFALL--PLNFTTFIDFIRG 108

Query: 67  -----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
                 + ++  F+  + +  H L GIR++ +D++L  D
Sbjct: 109 LGLPWVITDIFKFIIAYPIAFHSLNGIRFIAFDLALGTD 147


>gi|206562822|ref|YP_002233585.1| putative succinate dehydrogenase cytochrome b556 subunit
           [Burkholderia cenocepacia J2315]
 gi|198038862|emb|CAR54824.1| putative succinate dehydrogenase cytochrome b556 subunit
           [Burkholderia cenocepacia J2315]
          Length = 138

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 45/80 (56%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YR+     +SI+HR++G++++L  P ++F F      E +    + ++   V ++ +   
Sbjct: 24  YRMPLAAILSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEVFKAFLSNIVVKLIVLAL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA  HH   GIR+L+ DV+
Sbjct: 84  SWAFFHHFCAGIRHLLMDVN 103


>gi|29418059|gb|AAO39685.1| succinate dehydrogenase cytochrome b-556 subunit [Enterobacter
           cloacae]
          Length = 159

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L+  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 34  NVKKQRPVNLDLKTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 87

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLD-----KKIATQMAKIN 111
           ++  S      F+    W ++    +H++ G+R+++ D     +     K+ A     I 
Sbjct: 88  FLQASAIMNSFFVKFIMWGILTALAYHVVVGVRHMLMDFGYLEETFEAGKRSANISFVIT 147

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 148 VVLSLLAGVLVW 159


>gi|323332726|gb|EGA74131.1| Sdh3p [Saccharomyces cerevisiae AWRI796]
          Length = 194

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 64  LNKQRAKRPISPHLTIYQPQLTWYLSSFHRI--SLVLMG---LGFYLFTILFGVSGLLGL 118

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 119 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 176

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 177 GYALIGFTAVLGTYLLT 193


>gi|260946711|ref|XP_002617653.1| hypothetical protein CLUG_03097 [Clavispora lusitaniae ATCC 42720]
 gi|238849507|gb|EEQ38971.1| hypothetical protein CLUG_03097 [Clavispora lusitaniae ATCC 42720]
          Length = 180

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 15/100 (15%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGE 54
           + NRP+SPHL IY+   T  +S +HR+TG          +V Y  T ++   F   A+  
Sbjct: 55  RKNRPVSPHLDIYKPQLTWLLSGLHRLTGVGMAGAFYGLTVTYAATSLLSVPFDS-ASIV 113

Query: 55  HTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
              +SL       +       Y +A   H   GIR+L+WD
Sbjct: 114 TAFASLP--FAAKLGAKIAMAYPFAF--HFFNGIRHLVWD 149


>gi|24050819|gb|AAN42220.1| succinate dehydrogenase, cytochrome b556 [Shigella flexneri 2a str.
           301]
 gi|30040361|gb|AAP16093.1| succinate dehydrogenase, cytochrome b556 [Shigella flexneri 2a str.
           2457T]
          Length = 134

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++  W         +LSS   
Sbjct: 9   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILQ-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|304415184|ref|ZP_07395899.1| succinate dehydrogenase membrane subunit 1 that binds cytochrome
           b556 [Candidatus Regiella insecticola LSR1]
 gi|304282966|gb|EFL91414.1| succinate dehydrogenase membrane subunit 1 that binds cytochrome
           b556 [Candidatus Regiella insecticola LSR1]
          Length = 129

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 58/125 (46%), Gaps = 5/125 (4%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ  +L  +   SI+HR++G + ++   ++++      +           
Sbjct: 5   LKKQRPINLDLQTIQLPVSALASILHRVSGVITFVAVGILLWLLGLSLSSPEGFMQAATI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASILT 118
           +   V +   +    A+ +H+ GGIR+L+ D      SL    + A  +  + ++ SIL 
Sbjct: 65  LSSIVAKFIFWGILTALAYHICGGIRHLLMDFGYIPESLTAGTRSAQVVIGLTLVLSILA 124

Query: 119 VLIVW 123
            + +W
Sbjct: 125 GVFLW 129


>gi|83815294|ref|YP_444632.1| putative succinate dehydrogenase membrane subunit [Salinibacter
           ruber DSM 13855]
 gi|83756688|gb|ABC44801.1| putative succinate dehydrogenase membrane subunit [Salinibacter
           ruber DSM 13855]
          Length = 164

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 46/107 (42%), Gaps = 16/107 (14%)

Query: 1   MSSIKNNRPLSPH-----------LQIYRLIPTMFVSIVHRITGS--VVYLGTPVVVFWF 47
           M+     RP +P             Q YR+   MF  ++HR+TG   VVYL   +V  W 
Sbjct: 12  MAVDTKERPSAPQETNATAEQESRFQSYRIRTGMFAWMMHRLTGVGLVVYL---IVHIWG 68

Query: 48  FCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
                   T ++L       +F+V  F    AV +H + G+R ++ D
Sbjct: 69  LTALTDPETFNALIAKYHSPIFKVGEFALLVAVAYHAMNGLRLVLID 115


>gi|323304156|gb|EGA57933.1| Sdh3p [Saccharomyces cerevisiae FostersB]
          Length = 198

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 68  LNKQRAKRPISPHLTIYQPQLTWYLSSXHRI--SLVLMG---LGFYLFTILFGVSGLLGL 122

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 123 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 180

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 181 GYALIGFTAVLGTYLLT 197


>gi|29420823|dbj|BAC66633.1| succinate dehydrogenase cytochrome b560 subunit [Coprinopsis
           cinerea]
          Length = 179

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 46/105 (43%), Gaps = 12/105 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF---FCIANG----EHTLSS 59
            RP SPH  IY+   T   SI +R+TG+    G  V+++ F   + IA G     H +  
Sbjct: 58  KRPSSPHFTIYQPQLTWLGSIANRVTGA----GLSVLLYGFSIAYLIAPGTFDSAHVVEF 113

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA 104
           +    DG  +     L      +H   G+R+L WD    L  K A
Sbjct: 114 VAGLPDGVKYAGKAILAA-PFSYHAWNGLRHLAWDAGKFLSVKGA 157


>gi|260776543|ref|ZP_05885438.1| succinate dehydrogenase cytochrome b-556 subunit [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607766|gb|EEX34031.1| succinate dehydrogenase cytochrome b-556 subunit [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 130

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ      T   SI+HR++G + ++   ++++      +     +     +
Sbjct: 8   RKSRPVNLDLQTINFPITAIASILHRVSGVITFVAIGILLWLLSISLSSPVGYAQAVDIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           DG   +  L+    A+ +H+ GGIR+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DGFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELESGAMSAKVAFAATAVLSVLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|207343604|gb|EDZ71023.1| YKL141Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 198

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 68  LNKQRAKRPISPHLTIYQPQLTWYLSSFHRI--SLVLMG---LGFYLFTILFGVSGLLGL 122

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 123 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 180

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 181 GYALIGFTAVLGTYLLT 197


>gi|299750219|ref|XP_001836610.2| succinate dehydrogenase cytochrome b560 subunit [Coprinopsis
           cinerea okayama7#130]
 gi|298408800|gb|EAU85181.2| succinate dehydrogenase cytochrome b560 subunit [Coprinopsis
           cinerea okayama7#130]
          Length = 178

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 46/105 (43%), Gaps = 12/105 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF---FCIANG----EHTLSS 59
            RP SPH  IY+   T   SI +R+TG+    G  V+++ F   + IA G     H +  
Sbjct: 57  KRPSSPHFTIYQPQLTWLGSIANRVTGA----GLSVLLYGFSIAYLIAPGTFDSAHVVEF 112

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA 104
           +    DG  +     L      +H   G+R+L WD    L  K A
Sbjct: 113 VAGLPDGVKYAGKAILAA-PFSYHAWNGLRHLAWDAGKFLSVKGA 156


>gi|115400139|ref|XP_001215658.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114191324|gb|EAU33024.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 188

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 23/110 (20%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFF----CIAN 52
           NRP+SPHL IYR   T + S  +RITG          +  YL  P +  W        A 
Sbjct: 65  NRPVSPHLTIYRPQITWYASAFNRITGVALSGGMYVFATAYLAAP-LFGWHLESASLAAA 123

Query: 53  GEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
                 + +  + G++     F        H + G+R+L+WD+   +  +
Sbjct: 124 FAALPIAAKVLLKGTIAFPFAF--------HCMNGVRHLVWDMGRGITNQ 165


>gi|261202338|ref|XP_002628383.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239590480|gb|EEQ73061.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239612206|gb|EEQ89193.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis ER-3]
 gi|327353150|gb|EGE82007.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 187

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 15/106 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IY+   T  +S ++RITG          +  YL +P ++ W    A+    
Sbjct: 64  NRPVSPHLSIYQPQITWLLSSLNRITGVALAGGMYIFASAYLVSP-LLGWHLESASLVAA 122

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
             +L       +       +T+    H   G R+LIWD+      K
Sbjct: 123 FGALPLAAKVGLKFTAALPFTF----HSFNGCRHLIWDMGKQFSNK 164


>gi|190409697|gb|EDV12962.1| succinate dehydrogenase cytochrome b [Saccharomyces cerevisiae
           RM11-1a]
 gi|259147700|emb|CAY80950.1| Sdh3p [Saccharomyces cerevisiae EC1118]
          Length = 198

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 68  LNKQRAKRPISPHLTIYQPQLTWYLSSFHRI--SLVLMG---LGFYLFTILFGVSGLLGL 122

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 123 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 180

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 181 GYALIGFTAVLGTYLLT 197


>gi|27363644|ref|NP_759172.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio vulnificus CMCP6]
 gi|37679212|ref|NP_933821.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio vulnificus YJ016]
 gi|27359760|gb|AAO08699.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio vulnificus
           CMCP6]
 gi|37197955|dbj|BAC93792.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio vulnificus
           YJ016]
          Length = 130

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPVGFMEASDIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           D    +  L+    A+ +H+ GGIR+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DSFFVKFILWGILTALAYHIAGGIRHLMMDLGHFEELESGAMSAKVAFAATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|308050201|ref|YP_003913767.1| succinate dehydrogenase subunit C [Ferrimonas balearica DSM 9799]
 gi|307632391|gb|ADN76693.1| succinate dehydrogenase subunit C [Ferrimonas balearica DSM 9799]
          Length = 125

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 60/126 (47%), Gaps = 7/126 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE-HTLSSLRC 62
           +   RP+   LQ  +   T   SI+HR++G ++++ +  V+ W    + G     +++  
Sbjct: 1   MNKQRPVYLDLQQIQFPATAIASILHRVSGVILFV-SIAVLLWLLATSLGSAQGFATVSE 59

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV-----SLCLDKKIATQMAKINIIASIL 117
            M+  + +  ++    A+ +H  GGIR+L+ D+     S+      A     I +I S++
Sbjct: 60  IMNSLIAKFVVWGILTALAYHFCGGIRHLLMDMGHFEGSMESGNNSARAAMAITVILSVI 119

Query: 118 TVLIVW 123
             + +W
Sbjct: 120 AGIWLW 125


>gi|151941666|gb|EDN60028.1| succinate dehydrogenase cytochrome b [Saccharomyces cerevisiae
           YJM789]
          Length = 198

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 68  LNKQRAKRPISPHLTIYQPQLTWYLSSFHRI--SLVLMG---LGFYLFTILFGVSGLLGL 122

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 123 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 180

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 181 GYALIGFTAVLGTYLLT 197


>gi|325123218|gb|ADY82741.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 120

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 59/114 (51%), Gaps = 15/114 (13%)

Query: 21  PTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC--YMDGSVF-----EVCL 73
           P    SI+HR++G +V+L  PV++ W       + +LSS     Y+   VF        +
Sbjct: 12  PVAIASILHRLSGVIVFLLVPVLL-WIL-----DKSLSSPEGFDYVKNVVFGNILVRFVV 65

Query: 74  FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL--IVWII 125
           +++   +I H + G+++L+ D+    + +     A I++I S++ ++   VWI+
Sbjct: 66  WVFAAGLIFHFIAGVKHLLADLGFAEELQSGRIAATISLILSVVAIIAAFVWIM 119


>gi|261187750|ref|XP_002620293.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239593506|gb|EEQ76087.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis SLH14081]
          Length = 188

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEHTLSSLRCY 63
           NRP+SP+L IYR   T  +SI+HR TG +V  G    +F+   +A+   G H  S+    
Sbjct: 52  NRPISPNLTIYRPQVTSVLSILHRNTGLLVSGG--FYLFFAVYLASPWLGWHIDSASMAA 109

Query: 64  MDGS--VFEVCLFLYTWAV--IHHMLGGIRYLIWDVSLCLDK 101
             G+  V    L   T A+    H   G+R+LIW     LD 
Sbjct: 110 SFGALPVAAKVLLRTTVALPFTFHSFNGVRHLIWVAMNNLDS 151


>gi|195111348|ref|XP_002000241.1| GI22631 [Drosophila mojavensis]
 gi|193916835|gb|EDW15702.1| GI22631 [Drosophila mojavensis]
          Length = 229

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 26/114 (22%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  R LSPHL IYR   T  +SI  R +G+ + L       W          L++L 
Sbjct: 48  KNMKLGRALSPHLTIYRKQLTSVMSIFLRASGATLGL-----AVWII-------GLTALL 95

Query: 62  CYMD--------------GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
           C +D              G  F    F+      +H++ G R+LIW +++ L K
Sbjct: 96  CKLDINAMAEKVEALNLGGVTFTALKFILMVPFSYHVMAGTRHLIWYLNMFLTK 149


>gi|329120253|ref|ZP_08248921.1| succinate dehydrogenase cytochrome b558 subunit [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327462594|gb|EGF08917.1| succinate dehydrogenase cytochrome b558 subunit [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 127

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 25  VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHM 84
           VSI+HR +G +++L  PV++       +   + +S +      + ++ L    WA +HH+
Sbjct: 25  VSILHRASGVIMFLMVPVLLMLLDGSLSSGESFASYKAVASHPLVKLILIGVLWAFLHHL 84

Query: 85  LGGIRYLIWDVSLCLDKKIATQMAKINIIASI-LTVLI 121
             GIR+L  D    +D +   + AK+ +  S+ LTV++
Sbjct: 85  CAGIRFLFLDAHKGVDLQTCRKTAKLVLAVSLSLTVIL 122


>gi|323308340|gb|EGA61586.1| Sdh3p [Saccharomyces cerevisiae FostersO]
          Length = 194

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 20/115 (17%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 64  LNKQRAKRPISPHLTIYQPQLTWYLSSFHRI--SLVLMG---LGFYLFTILFGVSGLLGL 118

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L  K
Sbjct: 119 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLK 171


>gi|167627193|ref|YP_001677693.1| succinate dehydrogenase, cytochrome b556 [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|167597194|gb|ABZ87192.1| succinate dehydrogenase, cytochrome b556 [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 126

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 54/121 (44%), Gaps = 2/121 (1%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M  I N   +S  ++ Y+   T   SI+HRI+G V+    P+ V        G       
Sbjct: 1   MKKITNVDLMS--IKSYKFPITAISSILHRISGVVLIFAIPLAVVGMNYTLAGPDGYQQT 58

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              + G    +  +L+  ++ +H+  G+R++I D+      K A   + + II  +L+ +
Sbjct: 59  VAVLTGGWCSIFFWLFLSSITYHVFAGVRHMIMDMGFGESMKAAKITSLLVIILGVLSAI 118

Query: 121 I 121
           +
Sbjct: 119 L 119


>gi|134094984|ref|YP_001100059.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhD [Herminiimonas arsenicoxydans]
 gi|133738887|emb|CAL61934.1| Succinate dehydrogenase cytochrome b556 subunit (Cytochrome b-556)
           [Herminiimonas arsenicoxydans]
          Length = 136

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 61/127 (48%), Gaps = 6/127 (4%)

Query: 2   SSIKNNRPLSPHLQI-----YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHT 56
            S+K  +P   ++ I     YR+     VSI+HRI+G++++L  PV++         E +
Sbjct: 3   DSLKTGKPQFRNINIADLVHYRMPLAAIVSIMHRISGALIFLLLPVILLLLDKSLMSEIS 62

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
               +        ++ +    WA +HH   GIR+L  DV + +DK    + A I +  S+
Sbjct: 63  FEHFKGIASHWFVKLIILALVWAYLHHFCAGIRHLFADVHVGVDKVKGRKSAVIVLAISL 122

Query: 117 -LTVLIV 122
            LT L+ 
Sbjct: 123 PLTALVA 129


>gi|325525107|gb|EGD02998.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           TJI49]
          Length = 138

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 45/80 (56%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YR+     +SI+HR++G++++L  P ++F F      E +    + ++   V ++ +   
Sbjct: 24  YRMPLAAKLSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEVFKAFLSNIVVKLIVLAL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA  HH   GIR+L+ DV+
Sbjct: 84  SWAFFHHFCAGIRHLLMDVN 103


>gi|256269924|gb|EEU05182.1| Sdh3p [Saccharomyces cerevisiae JAY291]
          Length = 198

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG------- 53
           ++  +  RP+SPHL IY+   T ++S  HRI  S+V +G   + F+ F I  G       
Sbjct: 68  LNKQRARRPISPHLTIYQPQLTWYLSSFHRI--SLVLMG---LGFYLFTILFGVSGLLGL 122

Query: 54  EHTLSSLRCYMDGSVFEVCL------FLYTWAVIHHMLGGIRYLIWDVS--LCLDKKIAT 105
             T   +  +      ++        F Y +A+  H  G IR+LIWD +  L L     T
Sbjct: 123 GLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAI--HYGGAIRHLIWDTAKELTLKGVYRT 180

Query: 106 QMAKINIIASILTVLIV 122
             A I   A + T L+ 
Sbjct: 181 GYALIGFTAVLGTYLLT 197


>gi|77360592|ref|YP_340167.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhD [Pseudoalteromonas haloplanktis TAC125]
 gi|76875503|emb|CAI86724.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhD [Pseudoalteromonas haloplanktis TAC125]
          Length = 125

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 60/124 (48%), Gaps = 4/124 (3%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVF-WFFCIANGEHTLSSLRC 62
           +K  RP++  L    +  T   SI HR+TG  ++     V++ W   +++ E     ++ 
Sbjct: 1   MKKQRPVNLDLTTISMPATAKASIFHRVTGVALFFALTFVIWAWSESLSSAE-GFEFVKG 59

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI- 121
             +G + +   +     + +H++GGIR++I D+    + +     AKI +   ++  ++ 
Sbjct: 60  LFNGFIAKFIAWGTVSVLGYHLIGGIRHMIMDMGHWEELESGNLSAKIAMALGVVFAVLA 119

Query: 122 -VWI 124
            VWI
Sbjct: 120 GVWI 123


>gi|170726186|ref|YP_001760212.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella woodyi
           ATCC 51908]
 gi|169811533|gb|ACA86117.1| succinate dehydrogenase, cytochrome b556 subunit [Shewanella woodyi
           ATCC 51908]
          Length = 124

 Score = 37.4 bits (85), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 24/123 (19%), Positives = 57/123 (46%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP+   LQ  R   T   SI+HR++G ++     ++++          + + ++  
Sbjct: 1   MKKKRPVHLDLQTIRFPATAIASILHRVSGVIMLFAVGILIWLLNESLASPESFAGIQSL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC--LDKKIATQMAKINIIASILTVLI 121
            D  + +  ++    A+ +H++ G+R+L+ D      L   IA+      + A+   ++ 
Sbjct: 61  FDNLLVKFVIWGILTALGYHLIVGLRHLVMDTGRWEELASGIASAKVAFALSAAFSIIVG 120

Query: 122 VWI 124
           +W+
Sbjct: 121 IWV 123


>gi|118485781|gb|ABK94739.1| unknown [Populus trichocarpa]
          Length = 282

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 7/90 (7%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE-----HTLSSLRC 62
           RPLSPHL IY        SIV+RI+G+  YL   V+ F   C+  G      +       
Sbjct: 194 RPLSPHLPIYSPQVHSTFSIVNRISGA--YLSALVLFFCLICLKAGSICFTHYNFYQFLF 251

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLI 92
           Y    +  V       A+ +H+  G+R+L+
Sbjct: 252 YSSKLILPVVDVTAALALTYHLFYGVRHLL 281


>gi|126740505|ref|ZP_01756192.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseobacter sp.
           SK209-2-6]
 gi|126718306|gb|EBA15021.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseobacter sp.
           SK209-2-6]
          Length = 103

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%)

Query: 26  SIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHML 85
           SI+ RITG+ + +   +VV+W    A            +      + L L T  + +H L
Sbjct: 3   SILTRITGNALIIAVIMVVWWLLAAATSAEYFELANGLLTSWFGRIVLLLSTLGIWYHFL 62

Query: 86  GGIRYLIWDVSLCLDKKIATQMA 108
            G+R+L +D    LD + A ++ 
Sbjct: 63  AGLRHLYFDAGHGLDIETAEKLG 85


>gi|240277715|gb|EER41223.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           capsulatus H143]
          Length = 187

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 44/107 (41%), Gaps = 17/107 (15%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IY+   T  +S  +RITG          +  YL  P ++ W    A+    
Sbjct: 64  NRPVSPHLSIYQPQITWILSSTNRITGVALSGGLYIFASAYLVAP-LLGWHLESASIAAA 122

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            + L         + CL F        H   G R+L+WD+      K
Sbjct: 123 FAGLPL-----AAKFCLKFAAALPFTFHSFNGCRHLVWDMGKQFTNK 164


>gi|184159280|ref|YP_001847619.1| succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Acinetobacter baumannii ACICU]
 gi|213157653|ref|YP_002320451.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB0057]
 gi|215482489|ref|YP_002324675.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB307-0294]
 gi|239502289|ref|ZP_04661599.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB900]
 gi|301512217|ref|ZP_07237454.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB058]
 gi|301595936|ref|ZP_07240944.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB059]
 gi|183210874|gb|ACC58272.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Acinetobacter baumannii ACICU]
 gi|213056813|gb|ACJ41715.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB0057]
 gi|213987074|gb|ACJ57373.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii AB307-0294]
 gi|322509193|gb|ADX04647.1| sdhC [Acinetobacter baumannii 1656-2]
 gi|323519221|gb|ADX93602.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 120

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 59/114 (51%), Gaps = 15/114 (13%)

Query: 21  PTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC--YMDGSVF-----EVCL 73
           P    SI+HR++G +V+L  PV++ W       + +LSS     Y+   VF        +
Sbjct: 12  PVAIASILHRLSGVIVFLLVPVLL-WIL-----DKSLSSPEGFDYVKNVVFGNILVRFVV 65

Query: 74  FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL--IVWII 125
           +++   +I H + G+++L+ D+    + +     A I++I S++ ++   VWI+
Sbjct: 66  WVFVAGLIFHFIAGVKHLLADLGFAEELQSGRIAATISLILSVVAIIAAFVWIM 119


>gi|78062999|ref|YP_372907.1| succinate dehydrogenase subunit C [Burkholderia sp. 383]
 gi|77970884|gb|ABB12263.1| succinate dehydrogenase subunit C [Burkholderia sp. 383]
          Length = 138

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 45/80 (56%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YR+     +SI+HR++G++++L  P ++F F      E +    + ++   + ++ +   
Sbjct: 24  YRMPLAAILSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEGFKQFLSNIIVKLIVLAL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA  HH   GIR+L+ DV+
Sbjct: 84  SWAFFHHFCAGIRHLLMDVN 103


>gi|325093799|gb|EGC47109.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           capsulatus H88]
          Length = 187

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 44/107 (41%), Gaps = 17/107 (15%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IY+   T  +S  +RITG          +  YL  P ++ W    A+    
Sbjct: 64  NRPVSPHLSIYQPQITWILSSTNRITGVALSGSLYIFASAYLVAP-LLGWHLESASIAAA 122

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            + L         + CL F        H   G R+L+WD+      K
Sbjct: 123 FAGLPL-----AAKFCLKFAAALPFTFHSFNGCRHLVWDMGKQFTNK 164


>gi|225557168|gb|EEH05455.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           capsulatus G186AR]
          Length = 187

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 44/107 (41%), Gaps = 17/107 (15%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IY+   T  +S  +RITG          +  YL  P ++ W    A+    
Sbjct: 64  NRPVSPHLSIYQPQITWILSSTNRITGVALSGGLYIFASAYLVAP-LLGWHLESASIAAA 122

Query: 57  LSSLRCYMDGSVFEVCL-FLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            + L         + CL F        H   G R+L+WD+      K
Sbjct: 123 FAGLPL-----AAKFCLKFAAALPFTFHSFNGCRHLVWDMGKQFTNK 164


>gi|71892105|ref|YP_277837.1| succinate dehydrogenase cytochrome b-556 subunit [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
 gi|71796211|gb|AAZ40962.1| succinate dehydrogenase cytochrome b-556 subunit [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 135

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 64/127 (50%), Gaps = 9/127 (7%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY--LGTPVVVFWFFCIANGEHTLSSLRC 62
           KN RP+  +++  R   T   SI+HRI+G +++  +G  + +      +N E        
Sbjct: 4   KNQRPIYLNIRTIRFPITAITSILHRISGILLFIIIGPILWILKLSLSSNNEFCKIHRFL 63

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK-----KIATQMAKI-NIIASI 116
            M+  +F+   +  T  + +H++ GIR ++ D   CL++     KI+ ++  +  I+ SI
Sbjct: 64  LMNHYIFQFVFWTVTILLSYHIIAGIRQILMDFG-CLNQTLLIGKISAKVVFVLTILLSI 122

Query: 117 LTVLIVW 123
              +++W
Sbjct: 123 FIGILIW 129


>gi|2239247|emb|CAA74085.1| SdhC protein [Shewanella frigidimarina NCIMB 400]
          Length = 110

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 4/107 (3%)

Query: 21  PTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAV 80
            T   SI+HRI+G ++     ++++            +S++   DG V +  ++    A+
Sbjct: 4   ATRIASILHRISGVIMLFAIGILLWLLNSTLTSADGFASVQSLFDGFVMKFIIWGILTAL 63

Query: 81  IHHMLGGIRYLIWDVSLCLDKKIATQMAK----INIIASILTVLIVW 123
            +H+LGGIR+LI D     +       AK    + ++ SI+  + VW
Sbjct: 64  GYHLLGGIRHLIMDAGHWEELASGVSSAKATFVLAVVFSIIAGIWVW 110


>gi|209954769|dbj|BAG80575.1| succinate dehydrogenase C subunit [Aspergillus oryzae]
 gi|209954771|dbj|BAG80576.1| succinate dehydrogenase C subunit [Aspergillus oryzae]
          Length = 188

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 48/110 (43%), Gaps = 23/110 (20%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
           NRP+SPHL IYR   T   S  HRI G          +  YL +P ++ W    A+    
Sbjct: 65  NRPVSPHLSIYRPQITWIGSSFHRIIGFALSGSLYLYATAYLASP-LLGWHLESASVAAA 123

Query: 57  LSSL----RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            ++L    +  + G  F    F Y      H   G+R+L+WD+   +  +
Sbjct: 124 FAALPIVAKVLLKG--FMALPFTY------HCFNGVRHLVWDLGRGITNQ 165


>gi|29420825|dbj|BAC66634.1| succinate dehydrogenase cytochrome b560 subunit [Coprinopsis
           cinerea]
          Length = 179

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 45/105 (42%), Gaps = 12/105 (11%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF---FCIANG----EHTLSS 59
            RP SPH  IY+   T   SI  R+TG+    G  V+++ F   + IA G     H +  
Sbjct: 58  KRPSSPHFTIYQPQLTWLGSIAKRVTGA----GLSVLLYGFSIAYLIAPGTFDSAHVVEF 113

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA 104
           +    DG  +     L      +H   G+R+L WD    L  K A
Sbjct: 114 VAGLPDGVKYAGKAILAA-PFSYHAWNGLRHLAWDAGKFLSVKGA 157


>gi|195452048|ref|XP_002073190.1| GK13994 [Drosophila willistoni]
 gi|194169275|gb|EDW84176.1| GK13994 [Drosophila willistoni]
          Length = 230

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGT-PVVVFWFFCIAN-GEHTLSSLRCYMD 65
           R LSP L IY+   T  +SI  R+TG  + L    V +  FF   + G+       C   
Sbjct: 30  RHLSPCLSIYKRELTSVMSISLRMTGFFLALCVWAVGILGFFGTRSLGDWAAKLEECDCK 89

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            S+     F+  +   +H++ G R+L+W  ++ L K    Q+     +A  L+VL+ 
Sbjct: 90  RSIVNAAKFMLVFPFSYHLVAGARHLLWHFNIFLTKP---QIYATGYVALALSVLLT 143


>gi|163802540|ref|ZP_02196432.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio sp. AND4]
 gi|159173623|gb|EDP58442.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio sp. AND4]
          Length = 130

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSVSLSSPIGFLEAADIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           D    +  L+    A+ +H+ GG+R+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DSFFVKFILWGILSALAYHIAGGVRHLLMDLGHFEELESGAMSAKVTFGATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|239613339|gb|EEQ90326.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis ER-3]
          Length = 278

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEHTLSSLRCY 63
           NRP+SP+L IYR   T  +SI+HR TG +V  G    +F+   +A+   G H  S+    
Sbjct: 124 NRPISPNLTIYRPQVTSVLSILHRNTGLLVSGG--FYLFFAVYLASPWLGWHIDSASMAA 181

Query: 64  MDGS--VFEVCLFLYTWAV--IHHMLGGIRYLIW 93
             G+  V    L   T A+    H   G+R+LIW
Sbjct: 182 SFGALPVAAKVLLRTTVALPFTFHSFNGVRHLIW 215


>gi|319762655|ref|YP_004126592.1| succinate dehydrogenase, cytochrome b556 subunit [Alicycliphilus
           denitrificans BC]
 gi|330824796|ref|YP_004388099.1| succinate dehydrogenase, cytochrome b556 subunit [Alicycliphilus
           denitrificans K601]
 gi|317117216|gb|ADU99704.1| succinate dehydrogenase, cytochrome b556 subunit [Alicycliphilus
           denitrificans BC]
 gi|329310168|gb|AEB84583.1| succinate dehydrogenase, cytochrome b556 subunit [Alicycliphilus
           denitrificans K601]
          Length = 143

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 13/135 (9%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPT------MFVSIVHRITGSVVYLGTPVVVFWFFCIANGE 54
           M+ +   RP   ++  ++ +P+        VS +HRI+G +++L  P +++ F    + E
Sbjct: 1   MTQLAKKRPEFRNIHAFKDLPSYRWPLAALVSGMHRISGLILFLLLPFIIWLFDKSVSSE 60

Query: 55  HTLSSL-RCYMDGSVF------EVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
            +  S    +  G  F      ++ +    W+ +HH+  G+R+L+ DV+    K      
Sbjct: 61  ISFGSFTAAFTTGIGFVPAWFVKLVVLALIWSYLHHLAAGVRHLVLDVTHKTTKDFGRHS 120

Query: 108 AKINIIASILTVLIV 122
           A   ++ SI+  +I+
Sbjct: 121 AAATLVFSIMLTVIL 135


>gi|161522866|ref|YP_001585795.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189348299|ref|YP_001941495.1| succinate dehydrogenase cytochrome b-556 subunit [Burkholderia
           multivorans ATCC 17616]
 gi|160346419|gb|ABX19503.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189338437|dbj|BAG47505.1| succinate dehydrogenase cytochrome b-556 subunit [Burkholderia
           multivorans ATCC 17616]
          Length = 138

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 45/80 (56%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YR+     +SI+HR++G++++L  P ++F F      E +    + ++   V ++ +   
Sbjct: 24  YRMPLAAILSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEVFKQFLSNIVVKLIVLAL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA  HH   GIR+L+ DV+
Sbjct: 84  SWAFFHHFCAGIRHLLMDVN 103


>gi|56479264|ref|YP_160853.1| succinate dehydrogenase cytochrome b-556 subunit [Aromatoleum
           aromaticum EbN1]
 gi|56315307|emb|CAI09952.1| Succinate dehydrogenase cytochrome b-556 subunit (EC 1.3.99.1)
           [Aromatoleum aromaticum EbN1]
          Length = 129

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 62/121 (51%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++  RP    L   RL    FVSI+HR++G+ ++L  P ++F F        +  + +  
Sbjct: 6   VRKQRPKFLALHEIRLPLPGFVSILHRVSGAGLFLMLPFLLFLFDRSLGSPESFETYKSV 65

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + ++ L    WA +HH   GIR+L+ D++   D K A   ++I ++ SI   +I+ 
Sbjct: 66  VANPLAKLLLLGLLWAYLHHFCAGIRFLLLDLNKGTDLKSARNSSRIVLVVSIALTIIIG 125

Query: 124 I 124
           +
Sbjct: 126 V 126


>gi|307545706|ref|YP_003898185.1| succinate dehydrogenase, cytochrome b subunit [Halomonas elongata
           DSM 2581]
 gi|307217730|emb|CBV43000.1| succinate dehydrogenase, cytochrome b subunit [Halomonas elongata
           DSM 2581]
          Length = 125

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 57/127 (44%), Gaps = 9/127 (7%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L   +       SI HRITG ++++G   ++F F+ +     +       
Sbjct: 1   MNSKRPVNLDLSTIQFPLPALTSIAHRITGVILFIG---LIFGFWALDASLSSAEGFASV 57

Query: 64  MDGSVFEVCLFLYTW----AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                      L  W    A+  H + GI++L+ D+ + +  +   + A+I +  S + +
Sbjct: 58  QHALAHNFLAKLIAWGLLSALAFHFVAGIKHLLMDIDIGVTLEGGVKKAQITVAVSAVLI 117

Query: 120 LI--VWI 124
           ++  VW+
Sbjct: 118 ILAGVWV 124


>gi|311280404|ref|YP_003942635.1| succinate dehydrogenase, cytochrome b556 subunit [Enterobacter
           cloacae SCF1]
 gi|308749599|gb|ADO49351.1| succinate dehydrogenase, cytochrome b556 subunit [Enterobacter
           cloacae SCF1]
          Length = 134

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 65/134 (48%), Gaps = 17/134 (12%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           + ++K  RP++  L   R   T   SI+HR++G + ++   +++ W         +LSS 
Sbjct: 7   IKNVKKQRPVNLDLTTIRFPVTAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSP 60

Query: 61  RCYMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN-- 111
             ++  +      F+    W ++    +H + GIR+L+ D     +  +  T+ AKI+  
Sbjct: 61  EGFLVATSIMSSFFVKFIVWGILTALAYHAVVGIRHLLMDFGYLEETLEAGTRSAKISFV 120

Query: 112 --IIASILTVLIVW 123
             ++ S+L  ++VW
Sbjct: 121 ITVVLSLLAGVLVW 134


>gi|153835343|ref|ZP_01988010.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio harveyi
           HY01]
 gi|148868134|gb|EDL67293.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio harveyi
           HY01]
          Length = 130

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPMGFMEAADIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           D    +  L+    A+ +H+ GG+R+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DSFFVKFILWGILTALAYHIAGGVRHLLMDLGHFEELESGAMSAKVAFGATAVLSLLAGI 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|224133566|ref|XP_002321606.1| predicted protein [Populus trichocarpa]
 gi|222868602|gb|EEF05733.1| predicted protein [Populus trichocarpa]
          Length = 91

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 7/90 (7%)

Query: 8  RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANG-----EHTLSSLRC 62
          RPLSPHL IY        SIV+RI+G+  YL   V+ F   C+  G      +       
Sbjct: 4  RPLSPHLPIYSPQVHSTFSIVNRISGA--YLSALVLFFCLICLKAGSICFTHYNFYQFLF 61

Query: 63 YMDGSVFEVCLFLYTWAVIHHMLGGIRYLI 92
          Y    +  V       A+ +H+  G+R+L+
Sbjct: 62 YSSKLILPVVDVTAALALTYHLFYGVRHLL 91


>gi|114560909|ref|XP_001173993.1| PREDICTED: succinate dehydrogenase complex, subunit C isoform 2
          [Pan troglodytes]
          Length = 175

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%)

Query: 3  SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG 39
          +I +NRPLSPH+ IY     M +SI HR TG  +  G
Sbjct: 45 NIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAG 81


>gi|327351834|gb|EGE80691.1| succinate dehydrogenase cytochrome b560 subunit [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 293

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN---GEHTLSSLRCY 63
           NRP+SP+L IYR   T  +SI+HR TG +V  G    +F+   +A+   G H  S+    
Sbjct: 124 NRPISPNLTIYRPQITSVLSILHRNTGLLVSGG--FYLFFAVYLASPWLGWHIDSASMAA 181

Query: 64  MDGSVFEVCLFLYTWAV----IHHMLGGIRYLIWDVSLCLDK 101
             G++      L    V      H   G+R+LIW     LD 
Sbjct: 182 SFGALPVAAKVLLRTTVALPFTFHSFNGVRHLIWVAMNNLDS 223


>gi|325266125|ref|ZP_08132809.1| succinate dehydrogenase cytochrome b558 subunit [Kingella
           denitrificans ATCC 33394]
 gi|324982355|gb|EGC17983.1| succinate dehydrogenase cytochrome b558 subunit [Kingella
           denitrificans ATCC 33394]
          Length = 127

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 49/98 (50%)

Query: 25  VSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHM 84
           VSI+HR +G +++L  PV++       +     +  + + D    ++ L    W  IHH+
Sbjct: 25  VSILHRASGVMLFLLLPVLLSLLAGSLSSGQAFAEYKAWADNWFMKLILIGVLWLFIHHL 84

Query: 85  LGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
             GIR+L+ D  + ++ + A + AK  +  +  T  I+
Sbjct: 85  FAGIRFLLIDAHIGVELQPARKTAKWVLYGAPATAFIL 122


>gi|156849173|ref|XP_001647467.1| hypothetical protein Kpol_1018p147 [Vanderwaltozyma polyspora DSM
          70294]
 gi|156118153|gb|EDO19609.1| hypothetical protein Kpol_1018p147 [Vanderwaltozyma polyspora DSM
          70294]
          Length = 170

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 28/42 (66%), Gaps = 4/42 (9%)

Query: 1  MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRIT----GSVVYL 38
          +++ + NRP+SPHL IY+   T ++S VHR++    G+  YL
Sbjct: 42 LTAQRGNRPISPHLTIYQPQLTWYLSSVHRVSCIALGACFYL 83


>gi|50286141|ref|XP_445499.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524804|emb|CAG58410.1| unnamed protein product [Candida glabrata]
          Length = 181

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (48%), Gaps = 15/105 (14%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRIT----GSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           RP+SPHL IY+   T ++S VHRI+    G   Y+ T  ++F      +G +T S  + Y
Sbjct: 59  RPISPHLTIYQPQLTWYMSSVHRISHLILGGTFYVLT--ILFGLGYFVSGINTESVSQWY 116

Query: 64  ------MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
                 M   + +   F +T+A   H    IR+ IWD +  L  K
Sbjct: 117 HKHVSPMTEQIVKAG-FAFTFAF--HYFSTIRHYIWDFAKELTLK 158


>gi|270268651|gb|ACZ65867.1| ENSANGP00000017418-like protein [Nasonia longicornis]
 gi|270268653|gb|ACZ65868.1| ENSANGP00000017418-like protein [Nasonia longicornis]
 gi|270268655|gb|ACZ65869.1| ENSANGP00000017418-like protein [Nasonia longicornis]
 gi|270268657|gb|ACZ65870.1| ENSANGP00000017418-like protein [Nasonia longicornis]
 gi|270268659|gb|ACZ65871.1| ENSANGP00000017418-like protein [Nasonia longicornis]
 gi|270268661|gb|ACZ65872.1| ENSANGP00000017418-like protein [Nasonia longicornis]
 gi|270268663|gb|ACZ65873.1| ENSANGP00000017418-like protein [Nasonia longicornis]
 gi|270268665|gb|ACZ65874.1| ENSANGP00000017418-like protein [Nasonia giraulti]
 gi|270268667|gb|ACZ65875.1| ENSANGP00000017418-like protein [Nasonia giraulti]
 gi|270268669|gb|ACZ65876.1| ENSANGP00000017418-like protein [Nasonia giraulti]
 gi|270268671|gb|ACZ65877.1| ENSANGP00000017418-like protein [Nasonia giraulti]
 gi|270268673|gb|ACZ65878.1| ENSANGP00000017418-like protein [Nasonia giraulti]
 gi|270268675|gb|ACZ65879.1| ENSANGP00000017418-like protein [Nasonia giraulti]
          Length = 101

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 3  SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVV 36
          +++  RPLSPHL IY+L  T  +S+ HR TG V+
Sbjct: 51 NMRLKRPLSPHLTIYQLQLTSMLSVTHRGTGIVL 84


>gi|146310880|ref|YP_001175954.1| succinate dehydrogenase subunit C [Enterobacter sp. 638]
 gi|145317756|gb|ABP59903.1| succinate dehydrogenase subunit C [Enterobacter sp. 638]
          Length = 157

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 61/132 (46%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L+  R   T   SI+HR +G + ++   +++ W         +LSS   
Sbjct: 32  NVKKQRPVNLDLKTIRFPVTAIASILHRASGVITFVAVGILL-WLLGT-----SLSSPEG 85

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLD-----KKIATQMAKIN 111
           ++  S      F+    W ++     H++ G+R+++ D     +     K+ A     I 
Sbjct: 86  FLQASAIMSSFFVKFIMWGILTALAFHVVVGVRHMLMDFGYLEETFEAGKRSAYISFAIT 145

Query: 112 IIASILTVLIVW 123
           ++ SIL  ++VW
Sbjct: 146 VVFSILAGVLVW 157


>gi|74317200|ref|YP_314940.1| succinate dehydrogenase subunit C [Thiobacillus denitrificans ATCC
           25259]
 gi|74056695|gb|AAZ97135.1| succinate dehydrogenase cytochrome b-556 subunit [Thiobacillus
           denitrificans ATCC 25259]
          Length = 126

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%)

Query: 24  FVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHH 83
           +VSI+HR++G++++L  P  V+      + E     +       +      +  WA  HH
Sbjct: 22  WVSILHRVSGALLFLALPTGVWLLSVSLSDEAGYRYVSEVFAHPLARTATLVLVWAASHH 81

Query: 84  MLGGIRYLIWDVSLCLDKKIATQ 106
              G+R+L  DV    D   A +
Sbjct: 82  FFAGLRHLALDVHWGEDLASARR 104


>gi|54308237|ref|YP_129257.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Photobacterium profundum SS9]
 gi|46912665|emb|CAG19455.1| putative succinate dehydrogenase; fumaratereductase, cytochrome b
           subunit [Photobacterium profundum SS9]
          Length = 126

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 60/125 (48%), Gaps = 4/125 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
            +K  RP++  LQ  R       SI+HR++G + ++   ++++      +     +S   
Sbjct: 2   KVKKPRPVNLDLQTIRFPLPAIASILHRVSGVITFVSVAILLWLLSISLSSPEGFASAAS 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKIN-IIASILTVL- 120
             D    +  L+    A+ +H++ G+R+L+ D+    + +      K++ +I ++L+V  
Sbjct: 62  IADSFFVKFILWGVLTALFYHIVVGVRHLLMDMGYFEEMETGIASTKVSFVIVAVLSVFA 121

Query: 121 --IVW 123
             +VW
Sbjct: 122 GGLVW 126


>gi|88608119|ref|YP_505948.1| succinate dehydrogenase, cytochrome b556 subunit [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600288|gb|ABD45756.1| succinate dehydrogenase, cytochrome b556 subunit [Neorickettsia
           sennetsu str. Miyayama]
          Length = 140

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 6/100 (6%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFW----FFCIANGEHTLSSLRC 62
             PLSP L  YR      +SI HR++G+ ++  T    ++    F+  ++  HT+  L  
Sbjct: 17  RSPLSPSLFAYRFPLAAILSISHRLSGAFLFFYTGFFSWYVFACFYMPSSFLHTV--LSP 74

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +  G +    L  + +   +H+  G+R+L WD    L + 
Sbjct: 75  FFSGYLAGFLLCFFLFFFCYHLCSGVRHLFWDFCTGLSQA 114


>gi|212543951|ref|XP_002152130.1| succinate dehydrogenase, putative [Penicillium marneffei ATCC
           18224]
 gi|210067037|gb|EEA21130.1| succinate dehydrogenase, putative [Penicillium marneffei ATCC
           18224]
          Length = 200

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 11/106 (10%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
            RP+SPH+ IY+       SI+ R +G          ++ YL  P +      + + E  
Sbjct: 72  RRPVSPHITIYKWQYQSLTSILQRFSGMFLAGGIYVFAIGYLVAPTISPGLEQVFDLETI 131

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +S+ R  + G       F       +H   G+++L+WD  + L  K
Sbjct: 132 VSAAR-EVPGWAKSGGKFALALPFTYHFFNGVKHLMWDSGIGLAHK 176


>gi|212543953|ref|XP_002152131.1| succinate dehydrogenase, putative [Penicillium marneffei ATCC
           18224]
 gi|210067038|gb|EEA21131.1| succinate dehydrogenase, putative [Penicillium marneffei ATCC
           18224]
          Length = 199

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 11/106 (10%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
            RP+SPH+ IY+       SI+ R +G          ++ YL  P +      + + E  
Sbjct: 71  RRPVSPHITIYKWQYQSLTSILQRFSGMFLAGGIYVFAIGYLVAPTISPGLEQVFDLETI 130

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
           +S+ R  + G       F       +H   G+++L+WD  + L  K
Sbjct: 131 VSAAR-EVPGWAKSGGKFALALPFTYHFFNGVKHLMWDSGIGLAHK 175


>gi|270268641|gb|ACZ65862.1| ENSANGP00000017418-like protein [Nasonia vitripennis]
 gi|270268643|gb|ACZ65863.1| ENSANGP00000017418-like protein [Nasonia vitripennis]
 gi|270268645|gb|ACZ65864.1| ENSANGP00000017418-like protein [Nasonia vitripennis]
 gi|270268647|gb|ACZ65865.1| ENSANGP00000017418-like protein [Nasonia vitripennis]
 gi|270268649|gb|ACZ65866.1| ENSANGP00000017418-like protein [Nasonia vitripennis]
          Length = 101

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 3  SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVV 36
          +++  RPLSPHL IY+L  T  +S+ HR TG V+
Sbjct: 51 NMRLKRPLSPHLTIYQLQLTSMLSVTHRGTGIVL 84


>gi|157146672|ref|YP_001453991.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Citrobacter koseri ATCC BAA-895]
 gi|157083877|gb|ABV13555.1| hypothetical protein CKO_02438 [Citrobacter koseri ATCC BAA-895]
          Length = 134

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L   R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 9   NVKKQRPVNLDLTTIRFPITAIASILHRVSGVITFVAVGILL-WLLGT-----SLSSPEG 62

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    +H++ GIR+++ D     +  +   + AKI+    
Sbjct: 63  FQQASAIMGSFFIKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 122

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 123 VVLSLLAGVLVW 134


>gi|169615981|ref|XP_001801406.1| hypothetical protein SNOG_11157 [Phaeosphaeria nodorum SN15]
 gi|111060536|gb|EAT81656.1| hypothetical protein SNOG_11157 [Phaeosphaeria nodorum SN15]
          Length = 174

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 42/110 (38%), Gaps = 25/110 (22%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD- 65
           NRP+SPHL IYR   T + S ++R+T  ++   T     W F      +T   L      
Sbjct: 50  NRPVSPHLSIYRPQITWYSSGLYRLTAVII---TGSFYLWGFAYLAAPYTGWHLETQSMV 106

Query: 66  --------------GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
                          S F +  F        H   GIR+L+WD  + +  
Sbjct: 107 AAVAAWPAAVKIGVKSFFALPFFF-------HAYQGIRHLVWDFGIGMKN 149


>gi|254796445|ref|YP_003081281.1| succinate dehydrogenase, cytochrome b556 subunit [Neorickettsia
           risticii str. Illinois]
 gi|254589682|gb|ACT69044.1| succinate dehydrogenase, cytochrome b556 subunit [Neorickettsia
           risticii str. Illinois]
          Length = 156

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 9   PLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFW----FFCIANGEHTLSSLRCYM 64
           PLSP L  YR      +SI HR++G+ ++  T    ++    F+  ++  HT+  L  + 
Sbjct: 35  PLSPSLFAYRFPLAAILSISHRLSGAFLFFYTGFFSWYVFACFYMPSSFLHTV--LSPFF 92

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            G +    L  + +   +H+  G+R+L WD    L + 
Sbjct: 93  SGYLAGFLLCFFLFFFCYHLCSGVRHLFWDFCTGLSQA 130


>gi|257453555|ref|ZP_05618845.1| succinate dehydrogenase, cytochrome b556 subunit [Enhydrobacter
          aerosaccus SK60]
 gi|257449013|gb|EEV23966.1| succinate dehydrogenase, cytochrome b556 subunit [Enhydrobacter
          aerosaccus SK60]
          Length = 126

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 52/101 (51%), Gaps = 13/101 (12%)

Query: 4  IKNNRP----LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
          +K+NRP    LS  + +    P    SI HR++G V++L  PV++ W F     + +L+S
Sbjct: 1  MKSNRPIDLPLSQVINVNSKNPIALASITHRVSGVVLFLLIPVML-WIF-----QTSLAS 54

Query: 60 LRCYMD---GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
             + D     + +   +++  A+ +H + G ++L  D+ +
Sbjct: 55 AEGFADIFTNPLVKFLAWIFVAALGYHFVMGFKHLFADMGM 95


>gi|224456308|ref|ZP_03664781.1| succinate dehydrogenase, cytochrome b556 [Francisella tularensis
           subsp. tularensis MA00-2987]
          Length = 134

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCL 73
           ++ Y    T   SI+HRI+G V+ +  P+ V        G          +  S F V  
Sbjct: 12  IKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQTVTVLTKSWFSVFF 71

Query: 74  FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA 104
           +L+  ++ +H+  GIR++I D+      K+A
Sbjct: 72  WLFLSSITYHVYAGIRHMIMDMGFGESMKVA 102


>gi|254874087|ref|ZP_05246797.1| sdhC, succinate dehydrogenase, cytochrome b556 [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|254840086|gb|EET18522.1| sdhC, succinate dehydrogenase, cytochrome b556 [Francisella
           tularensis subsp. tularensis MA00-2987]
          Length = 165

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 14  LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCL 73
           ++ Y    T   SI+HRI+G V+ +  P+ V        G          +  S F V  
Sbjct: 43  IKSYNFPITAISSIMHRISGVVLIIAIPLCVVAMNYALAGPDGYQQTVTVLTKSWFSVFF 102

Query: 74  FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIA 104
           +L+  ++ +H+  GIR++I D+      K+A
Sbjct: 103 WLFLSSITYHVYAGIRHMIMDMGFGESMKVA 133


>gi|156973648|ref|YP_001444555.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio harveyi ATCC BAA-1116]
 gi|156525242|gb|ABU70328.1| hypothetical protein VIBHAR_01351 [Vibrio harveyi ATCC BAA-1116]
          Length = 130

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 57/121 (47%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ  R   T   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKSRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPMGFMEAADIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           D    +  L+    A+ +H+ GG+R+L+ D+    + +     AK+   A+ +  L+  I
Sbjct: 68  DSFFVKFILWGILTALAYHIAGGVRHLLMDLGHFEELESGAMSAKVAFGATAVLSLLAGI 127

Query: 125 I 125
           +
Sbjct: 128 L 128


>gi|91228424|ref|ZP_01262349.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio alginolyticus 12G01]
 gi|91188008|gb|EAS74315.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Vibrio alginolyticus 12G01]
          Length = 126

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ      T   SI+HR++G + ++   ++++      +           +
Sbjct: 4   RKSRPVNLDLQTIHFPITAIASILHRVSGVITFVAVGILLWLLSISLSSPMGFMEAADIV 63

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           D    +  L+    A+ +H+ GGIR+L+ D+    +    T  AK+   A    S+L  +
Sbjct: 64  DSFFVKFILWGILTALAYHIAGGIRHLLMDLGHFEELDSGTMSAKVAFGATAVLSLLAGI 123

Query: 121 IVW 123
           +VW
Sbjct: 124 LVW 126


>gi|324520630|gb|ADY47681.1| Succinate dehydrogenase cytochrome b560 subunit [Ascaris suum]
          Length = 192

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP++PHL IY+   T  VS +HR+TG  +  GT ++    F +   + T  +   ++ G
Sbjct: 57  KRPIAPHLTIYKPQMTWMVSGLHRVTGCAM-AGTLLIGGVGFSVLPLDFT--TFVEFIRG 113

Query: 67  -----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
                 + +   F+  + +  H L GIR++ +D++   D
Sbjct: 114 LGIPWVILDTFKFIIAFPIAFHTLNGIRFIGFDMAKGTD 152


>gi|324520449|gb|ADY47640.1| Succinate dehydrogenase cytochrome b560 subunit [Ascaris suum]
          Length = 142

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP++PHL IY+   T  VS +HR+TG  +  GT ++    F +   + T  +   ++ G
Sbjct: 7   KRPIAPHLTIYKPQMTWMVSGLHRVTGCAM-AGTLLIGGVGFSVLPLDFT--TFVEFIRG 63

Query: 67  -----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
                 + +   F+  + +  H L GIR++ +D++   D
Sbjct: 64  LGIPWVILDTFKFIIAFPIAFHTLNGIRFIGFDMAKGTD 102


>gi|56756809|gb|AAW26576.1| SJCHGC03139 protein [Schistosoma japonicum]
          Length = 132

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG 39
           +I   RP SPHLQIY     M  S +HR TG  + +G
Sbjct: 66  NITGGRPWSPHLQIYSAPLVMRFSFLHRATGIAMAIG 102


>gi|299768983|ref|YP_003731009.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter sp.
           DR1]
 gi|298699071|gb|ADI89636.1| succinate dehydrogenase, cytochrome b556 subunit [Acinetobacter sp.
           DR1]
          Length = 120

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 13/111 (11%)

Query: 21  PTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC--YMDGSVF-----EVCL 73
           P    SI+HR++G +V+L  PV++ W       + +LSS     Y+   VF        +
Sbjct: 12  PVAIASILHRLSGVIVFLLVPVLL-WIL-----DKSLSSPEGFDYVKNVVFGNILVRFIV 65

Query: 74  FLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           +++   ++ H + G+++L+ D+    + +     A I++I S++ ++  +I
Sbjct: 66  WVFVAGLLFHFIAGVKHLLADLGFAEELQSGRIAATISLILSVVAIIAAFI 116


>gi|170094680|ref|XP_001878561.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647015|gb|EDR11260.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 181

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF---FCIANGEHTLSSLRCYM 64
           RP SPH  IY+   T   SI +R+TGS    G  V+++ F   + +A G    + +  ++
Sbjct: 61  RPSSPHFTIYQPQLTWLGSIANRVTGS----GLSVLLYGFSIAYLVAPGTFDSAHVVEFV 116

Query: 65  DGSVFEVCLF----LYTWAVIHHMLGGIRYLIWDVS 96
            G + EV  +    +       H L G+R+L WD+ 
Sbjct: 117 AG-LPEVVKYAGKAILAAPFAFHSLNGLRHLGWDMG 151


>gi|63253076|dbj|BAA11232.2| cytochrome b-large subunit [Ascaris suum]
          Length = 188

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP++PHL IY+   T  VS +HR+TG  +  GT ++    F +   + T  +   ++ G
Sbjct: 53  KRPIAPHLTIYKPQMTWMVSGLHRVTGCAM-AGTLLIGGVGFSVLPLDFT--TFVEFIRG 109

Query: 67  -----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
                 + +   F+  + +  H L GIR++ +D++   D
Sbjct: 110 LGIPWVILDTFKFIIAFPIAFHTLNGIRFIGFDMAKGTD 148


>gi|258626217|ref|ZP_05721065.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio mimicus
           VM603]
 gi|258581572|gb|EEW06473.1| succinate dehydrogenase, cytochrome b556 subunit [Vibrio mimicus
           VM603]
          Length = 130

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RP++  LQ      +   SI+HR++G + ++   ++++      +           +
Sbjct: 8   RKSRPVNLDLQTIHFPISAIASILHRVSGVITFVAVGILLWLLSLSLSSPVGFMEASNIV 67

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA----SILTVL 120
           D  + +  L+    A+ +H+ GGIR+L+ D+    + +     AK+   A    S+L  +
Sbjct: 68  DSFLVKFVLWGILTALAYHIAGGIRHLLMDLGHFEELESGATSAKVAFAATAVLSLLAGV 127

Query: 121 IVW 123
           +VW
Sbjct: 128 LVW 130


>gi|91777242|ref|YP_552450.1| succinate dehydrogenase subunit C [Burkholderia xenovorans LB400]
 gi|91689902|gb|ABE33100.1| succinate dehydrogenase subunit C [Burkholderia xenovorans LB400]
          Length = 137

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 52/111 (46%), Gaps = 6/111 (5%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G ++++  P +++ F      E 
Sbjct: 3   EAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRLSGGLLFVFLPFLLYLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQ 106
           +    + ++   + ++   +  WA + H   GIR+L+ D    + K+   Q
Sbjct: 63  SFEVFKGFLSNIIVKLITLVLAWAFLFHFCAGIRHLVMDTHRAVTKEGGKQ 113


>gi|2864622|emb|CAA16969.1| putative protein [Arabidopsis thaliana]
 gi|7270125|emb|CAB79939.1| putative protein [Arabidopsis thaliana]
          Length = 1086

 Score = 35.0 bits (79), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 4    IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYL 38
            IK+ RPLSPHL +Y+      +SI +RI+G  VYL
Sbjct: 994  IKSFRPLSPHLSVYQPQMNSMLSIFNRISG--VYL 1026


>gi|324518019|gb|ADY46982.1| Succinate dehydrogenase cytochrome b560 subunit [Ascaris suum]
          Length = 150

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP++PHL IY+   T  VS +HR+TG  +  GT ++    F +   + T  +   ++ G
Sbjct: 15  KRPIAPHLTIYKPQMTWMVSGLHRVTGCAM-AGTLLIGGVGFSVLPLDFT--TFVEFIRG 71

Query: 67  -----SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD 100
                 + +   F+  + +  H L GIR++ +D++   D
Sbjct: 72  LGIPWVILDTFKFIIAFPIAFHTLNGIRFIGFDMAKGTD 110


>gi|330804877|ref|XP_003290416.1| hypothetical protein DICPUDRAFT_92482 [Dictyostelium purpureum]
 gi|325079467|gb|EGC33066.1| hypothetical protein DICPUDRAFT_92482 [Dictyostelium purpureum]
          Length = 116

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query: 8  RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG 39
          +P SPHL IYRL     +SI+HR TG  + LG
Sbjct: 66 KPTSPHLTIYRLPLPANISIMHRATGVSLGLG 97


>gi|254567019|ref|XP_002490620.1| Putative protein of unknown function [Pichia pastoris GS115]
 gi|238030416|emb|CAY68340.1| Putative protein of unknown function [Pichia pastoris GS115]
          Length = 177

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 13/96 (13%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG---------TPVVVFWFFCIANGEHTLS 58
           RP SPHL IY    T  +S  HRITG  +  G            ++ + F  A+     S
Sbjct: 55  RPSSPHLTIYAPQLTWILSSFHRITGVGLAGGFYALTCGYAAANLLGYDFTSADIVGLYS 114

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
            L  Y+  SV  +  + +    + H+  G+R+L+WD
Sbjct: 115 QLPEYIKYSVKAIAAYPF----VFHISNGLRHLVWD 146


>gi|195329969|ref|XP_002031681.1| GM26134 [Drosophila sechellia]
 gi|194120624|gb|EDW42667.1| GM26134 [Drosophila sechellia]
          Length = 264

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA------NGEHTLSSL 60
            R LSPHL IY++  T  +S   RI+G V+      V  WF  I+      + E  +  L
Sbjct: 83  GRQLSPHLSIYKIQLTSTLSAFLRISGFVL-----AVFVWFVGISGLCLQGDMEGYIKKL 137

Query: 61  -RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIW 93
            +C   G V  +   + T    +H + G R+LIW
Sbjct: 138 EKCDCQGMV-TMAKVMVTIPFAYHTVAGTRHLIW 170


>gi|215919176|ref|NP_820388.2| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           RSA 493]
 gi|206584060|gb|AAO90902.2| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           RSA 493]
          Length = 165

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF-CIANGEHTLSSL 60
             +   RP++  L  +   P   +SI HRI+G V++L  P++ +      A+ E      
Sbjct: 39  KGMNAKRPVNLDLTKFHFPPMAILSIGHRISGFVLFLCMPLMFYLLHRATASAESFYHLH 98

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
           +  +     ++ +++   A + H+  GIR+L  D+  
Sbjct: 99  QLLLHNGWIKLAVWIMLSATLFHLFAGIRHLAMDLGF 135


>gi|304445630|pdb|2WU2|C Chain C, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|304445634|pdb|2WU2|G Chain G, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|304445638|pdb|2WU2|K Chain K, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
          Length = 129

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 63/132 (47%), Gaps = 17/132 (12%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   +++ W         +LSS   
Sbjct: 4   NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL-WLLG-----TSLSSPEG 57

Query: 63  YMDGSVFEVCLFLY--TWAVI----HHMLGGIRYLIWDVSLCLDK-KIATQMAKIN---- 111
           +   S      F+    W ++    + ++ GIR+++ D     +  +   + AKI+    
Sbjct: 58  FEQASAIMGSFFVKFIMWGILTALAYMVVVGIRHMMMDFGYLEETFEAGKRSAKISFVIT 117

Query: 112 IIASILTVLIVW 123
           ++ S+L  ++VW
Sbjct: 118 VVLSLLAGVLVW 129


>gi|78711820|ref|NP_001030588.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial
          isoform 2 precursor [Homo sapiens]
 gi|114560907|ref|XP_001174000.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
          mitochondrial isoform 3 [Pan troglodytes]
 gi|78096641|dbj|BAE46979.1| succinate dehydrogenase complex, subunit C delta5 alternative
          splicing variant [Homo sapiens]
 gi|194376880|dbj|BAG57586.1| unnamed protein product [Homo sapiens]
          Length = 150

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 3  SIKNNRPLSPHLQIYRLIPTMFVSIVHRITG 33
          +I +NRPLSPH+ IY     M +SI HR TG
Sbjct: 45 NIGSNRPLSPHITIYSWSLPMAMSICHRGTG 75


>gi|328351008|emb|CCA37408.1| hypothetical protein PP7435_Chr1-1289 [Pichia pastoris CBS 7435]
          Length = 175

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 13/96 (13%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLG---------TPVVVFWFFCIANGEHTLS 58
           RP SPHL IY    T  +S  HRITG  +  G            ++ + F  A+     S
Sbjct: 53  RPSSPHLTIYAPQLTWILSSFHRITGVGLAGGFYALTCGYAAANLLGYDFTSADIVGLYS 112

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWD 94
            L  Y+  SV  +  + +    + H+  G+R+L+WD
Sbjct: 113 QLPEYIKYSVKAIAAYPF----VFHISNGLRHLVWD 144


>gi|21356401|ref|NP_650041.1| CG6629 [Drosophila melanogaster]
 gi|7299395|gb|AAF54585.1| CG6629 [Drosophila melanogaster]
 gi|19527967|gb|AAL90098.1| AT18465p [Drosophila melanogaster]
 gi|220949652|gb|ACL87369.1| CG6629-PA [synthetic construct]
 gi|220958876|gb|ACL91981.1| CG6629-PA [synthetic construct]
          Length = 261

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 46/98 (46%), Gaps = 21/98 (21%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            R LSPHL IY++  T  +S   RI+G V+      V  WF  I+        L+  M+G
Sbjct: 83  GRQLSPHLSIYKIQLTSTLSAFLRISGFVL-----AVFVWFVGISG-----LCLQGDMEG 132

Query: 67  SVFEV----CLFLYTWAVI-------HHMLGGIRYLIW 93
            + +V    C  + T A +       +H + G R+LIW
Sbjct: 133 FIKKVEKCDCHGMVTMAKVMVTMPFAYHTVAGTRHLIW 170


>gi|212212228|ref|YP_002303164.1| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           CbuG_Q212]
 gi|212010638|gb|ACJ18019.1| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           CbuG_Q212]
          Length = 165

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF-CIANGEHTLSSL 60
             +   RP++  L  +   P   +SI HRI+G V++L  P++ +      A+ E      
Sbjct: 39  KGMNATRPVNLDLTKFHFPPMAILSIGHRISGFVLFLCMPLMFYLLHRATASAESFYHLH 98

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
           +  +     ++ +++   A + H+  GIR+L  D+  
Sbjct: 99  QLLLHNGWIKLAVWIMLSATLFHLFAGIRHLAMDLGF 135


>gi|209363838|ref|YP_001423999.2| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           Dugway 5J108-111]
 gi|207081771|gb|ABS76846.2| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           Dugway 5J108-111]
          Length = 165

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF-CIANGEHTLSSL 60
             +   RP++  L  +   P   +SI HRI+G V++L  P++ +      A+ E      
Sbjct: 39  KGMNATRPVNLDLTKFHFPPMAILSIGHRISGFVLFLCMPLMFYLLHQATASAESFYHLH 98

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
           +  +     ++ +++   A + H+  GIR+L  D+  
Sbjct: 99  QLLLHNGWIKLAVWIMLSATLFHLFAGIRHLAMDLGF 135


>gi|85711267|ref|ZP_01042326.1| Succinate dehydrogenase/fumarate reductase cytochrome b subunit
           [Idiomarina baltica OS145]
 gi|85694768|gb|EAQ32707.1| Succinate dehydrogenase/fumarate reductase cytochrome b subunit
           [Idiomarina baltica OS145]
          Length = 156

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S +K  RP++  L   +       SI+HR++G ++ +    +++ F    +G    + + 
Sbjct: 31  SIVKKERPVNLDLSTIQFPAAAKASILHRVSGVIMLVSLAFLIWAFATSLSGPEGFAQVE 90

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC--LDKKIATQMAKINIIASILTV 119
             M   + +   +    A+  H++ GIR+LI D+     LD   A+  A I I   +  +
Sbjct: 91  SIMTSFIAKFIGWGILTALGFHLIIGIRHLIMDMGFWEELDSGRASATASIVISIIVSVL 150

Query: 120 LIVWI 124
           + VW+
Sbjct: 151 VGVWL 155


>gi|89900590|ref|YP_523061.1| succinate dehydrogenase, cytochrome b subunit [Rhodoferax
           ferrireducens T118]
 gi|89345327|gb|ABD69530.1| succinate dehydrogenase subunit C [Rhodoferax ferrireducens T118]
          Length = 147

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD-------GSVF 69
           YR      VS +HR++G++++   P V++ F    + E +        +       G ++
Sbjct: 26  YRWPLASIVSGMHRVSGAIMFFLMPFVIWMFDNSISSEISFDKFTSAFNVGMLGLPGFIW 85

Query: 70  EVCLFLYTWAVIHHMLGGIRYLIWDV 95
           ++      WA +HH L GIR+L  D 
Sbjct: 86  KLVALGLIWAYLHHFLAGIRHLWMDT 111


>gi|295700755|ref|YP_003608648.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1002]
 gi|295439968|gb|ADG19137.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia sp.
           CCGE1002]
          Length = 138

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 65/127 (51%), Gaps = 10/127 (7%)

Query: 2   SSIKNNRP------LSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEH 55
            ++K  RP      +   L  YRL     VSI+HR++G++++L  P ++F F      E 
Sbjct: 3   EAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRVSGALLFLFLPFLLFLFDQSLTSEL 62

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDV---SLCLDKKIATQMAKINI 112
           +    + ++   + ++   +  WA + H   GIR+L+ D    ++  +K  +T +  + +
Sbjct: 63  SFEVFKGFLSNIIVKLITLVLAWAFLFHFCAGIRHLLMDTNHDAVSKEKGKSTSIV-VFV 121

Query: 113 IASILTV 119
           ++S+LT+
Sbjct: 122 VSSLLTI 128


>gi|330445465|ref|ZP_08309117.1| succinate dehydrogenase, cytochrome b556 subunit [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489656|dbj|GAA03614.1| succinate dehydrogenase, cytochrome b556 subunit [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 133

 Score = 34.3 bits (77), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
            +   RP++  LQ  R   T   SI+HR++G + ++   ++++      +     ++   
Sbjct: 9   KVNKPRPVNLDLQTIRFPLTAIASILHRVSGVITFVSLAILLWLLNLSLSSPDGFAAATS 68

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
             D    +  L+    A+ +H++ G+R+L+ D  L   +++ T +A   +  +I+ VL V
Sbjct: 69  ITDSFFVKFVLWGVLIALFYHIVLGVRHLLMD--LGYFEEMDTGIASTKVSFAIVAVLAV 126

Query: 123 W 123
           +
Sbjct: 127 F 127


>gi|115399864|ref|XP_001215521.1| predicted protein [Aspergillus terreus NIH2624]
 gi|114191187|gb|EAU32887.1| predicted protein [Aspergillus terreus NIH2624]
          Length = 198

 Score = 34.3 bits (77), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCIANGEHT 56
            RP+SPHL IYR    M  S + R TG          +  YL +P++  W    A    +
Sbjct: 73  RRPVSPHLAIYRWEMNMISSAMERNTGIMLSGALYLFATAYLVSPMMG-WDLSSA----S 127

Query: 57  LSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
           L +    +  +V     F   W    H   G+R+ +   +  L+ +   QMAKI
Sbjct: 128 LVTAFGALPWAVKAAVKFAAAWPFTFHFFNGVRFTVAATARTLNNR--EQMAKI 179


>gi|167583942|ref|ZP_02376330.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           ubonensis Bu]
          Length = 138

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YRL     VSI+HR++G++++L  P ++F F      E +    + ++   + ++ +   
Sbjct: 24  YRLPLAAKVSILHRVSGALLFLFLPFLLFLFDQSLTSELSFEGFKFFLSNVIVKLIVLAL 83

Query: 77  TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA--SILTV 119
           +WA   H   GIR+L+ D++     K   +   + +IA  S+LTV
Sbjct: 84  SWAFFLHFCAGIRHLLMDINHDAVTKERGKSTSVVVIAVSSLLTV 128


>gi|212219000|ref|YP_002305787.1| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           CbuK_Q154]
 gi|212013262|gb|ACJ20642.1| succinate dehydrogenase cytochrome b556 subunit [Coxiella burnetii
           CbuK_Q154]
          Length = 165

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 47/100 (47%), Gaps = 7/100 (7%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL- 60
             +   RP++  L  +   P   +SI HRI+G V++L  P++   F+ +     ++ S  
Sbjct: 39  KGMNATRPVNLDLTKFHFPPMAILSIGHRISGFVLFLCMPLM---FYLLHRATASVESFY 95

Query: 61  ---RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
              +  +     ++ +++   A + H+  GIR+L  D+  
Sbjct: 96  HLHQLLLHNGWIKLAVWIMLSATLFHLFAGIRHLAMDLGF 135


>gi|161831114|ref|YP_001597244.1| succinate dehydrogenase, cytochrome b556 subunit [Coxiella
          burnetii RSA 331]
 gi|1706427|sp|P51055|DHSC_COXBU RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
          Short=Cytochrome b-556
 gi|495753|gb|AAA74131.1| succinate dehydrogenase [Coxiella burnetii]
 gi|161762981|gb|ABX78623.1| succinate dehydrogenase, cytochrome b556 subunit [Coxiella
          burnetii RSA 331]
          Length = 125

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFF-CIANGEHTLSSLRC 62
          +   RP++  L  +   P   +SI HRI+G V++L  P++ +      A+ E      + 
Sbjct: 1  MNAKRPVNLDLTKFHFPPMAILSIGHRISGFVLFLCMPLMFYLLHRATASAESFYHLHQL 60

Query: 63 YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
           +     ++ +++   A + H+  GIR+L  D+  
Sbjct: 61 LLHNGWIKLAVWIMLSATLFHLFAGIRHLAMDLGF 95


>gi|195571855|ref|XP_002103916.1| GD20687 [Drosophila simulans]
 gi|194199843|gb|EDX13419.1| GD20687 [Drosophila simulans]
          Length = 262

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWF-----FCI-ANGEHTLSSL 60
            R LSPHL IY++  T  +S   RI+G V+      V  WF      C+  + E  +  L
Sbjct: 80  GRQLSPHLSIYKIQLTSTLSAFLRISGFVL-----AVFVWFVGVSGLCLQGDMEGFIKKL 134

Query: 61  -RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIW 93
            +C   G V  +   + T    +H + G R+LIW
Sbjct: 135 EKCDCHGMV-TMAKVMVTMPFAYHTVAGTRHLIW 167


>gi|302675006|ref|XP_003027187.1| hypothetical protein SCHCODRAFT_86145 [Schizophyllum commune H4-8]
 gi|300100873|gb|EFI92284.1| hypothetical protein SCHCODRAFT_86145 [Schizophyllum commune H4-8]
          Length = 175

 Score = 33.9 bits (76), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 4/99 (4%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITG---SVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
            RP SPH+ IY+   T + SI +RITG   SV+  G  +   +     +  H +  +   
Sbjct: 55  RRPNSPHMTIYQPQLTWYSSIANRITGVGLSVLLYGFSLGYLFLPGTFDSAHVVDFVAGL 114

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKK 102
            D   +     L      +H   G+R+L WD+   L  K
Sbjct: 115 PDAVKYAGKTIL-ALPFAYHGWNGVRHLGWDMGKFLTLK 152


>gi|94499006|ref|ZP_01305544.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanobacter sp.
           RED65]
 gi|94428638|gb|EAT13610.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanobacter sp.
           RED65]
          Length = 125

 Score = 33.9 bits (76), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 14/129 (10%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RP +  L           SI HRI G ++++G    V +  C+ +   +L S + +
Sbjct: 1   MNQQRPKNLDLSTISFPLPALTSITHRIAGVILFVG----VIFLLCVLS--DSLQSAQGF 54

Query: 64  MDGSVFEVCLF--LYTW----AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII-ASI 116
                     F    TW    A+ +H + GI++L+ D  +   K+     A I I+ A++
Sbjct: 55  AQAKQSMTTGFGSFITWGLLSALAYHFVAGIKHLVMDFGIGETKEGGKLGAIITIVLAAL 114

Query: 117 LTVLI-VWI 124
           L VL  VW+
Sbjct: 115 LIVLAGVWV 123


>gi|254283025|ref|ZP_04957993.1| succinate dehydrogenase, cytochrome b556 subunit [gamma
          proteobacterium NOR51-B]
 gi|219679228|gb|EED35577.1| succinate dehydrogenase, cytochrome b556 subunit [gamma
          proteobacterium NOR51-B]
          Length = 111

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 18 RLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRCYMDGSVFEVCLFLY 76
          +L  T + SI HR++G V   G  +++ W    +   E + + L   +   V +  L+L 
Sbjct: 2  KLPVTAWASIAHRVSG-VALFGMSILMVWALDASLASEQSFNELAAVLSSPVAKAILWLV 60

Query: 77 TWAVIHHMLGGIRYLIWD 94
            A+ +H L G+++++ D
Sbjct: 61 AVALTYHSLAGVKHIVMD 78


>gi|15242460|ref|NP_196522.1| SDH3-1; succinate dehydrogenase [Arabidopsis thaliana]
 gi|186515438|ref|NP_194948.2| SDH3-2; succinate dehydrogenase [Arabidopsis thaliana]
 gi|7671429|emb|CAB89370.1| putative protein [Arabidopsis thaliana]
 gi|17979473|gb|AAL50073.1| AT5g09600/F17I14_210 [Arabidopsis thaliana]
 gi|18650626|gb|AAL75912.1| AT5g09600/F17I14_210 [Arabidopsis thaliana]
 gi|20142337|tpg|DAA00014.1| TPA_exp: succinate dehydrogenase subunit 3 [Arabidopsis thaliana]
 gi|20142339|tpg|DAA00015.1| TPA_exp: succinate dehydrogenase subunit 3 [Arabidopsis thaliana]
 gi|33589714|gb|AAQ22623.1| At5g09600/F17I14_210 [Arabidopsis thaliana]
 gi|332004031|gb|AED91414.1| succinate dehydrogenase 3-1 [Arabidopsis thaliana]
 gi|332004033|gb|AED91416.1| succinate dehydrogenase 3-1 [Arabidopsis thaliana]
 gi|332660620|gb|AEE86020.1| succinate dehydrogenase 3-2 [Arabidopsis thaliana]
          Length = 213

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYL 38
           IK+ RPLSPHL +Y+      +SI +RI+G  VYL
Sbjct: 121 IKSFRPLSPHLSVYQPQMNSMLSIFNRISG--VYL 153


>gi|321268751|gb|ADW79200.1| succinate dehydrogenase subunit 3 [Cyanophora paradoxa]
          Length = 144

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 14/105 (13%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIAN--GEHTLSSLRCYMD 65
           + +SPHL IY L     +SI++RI G ++     + +F+F  +     E  + +   Y+ 
Sbjct: 6   KIISPHLNIYNLELQSGLSILNRICGLIL----TLFIFYFIIMDTLLYETFIITHFSYIL 61

Query: 66  GSVFEVCLFLYTWAV--------IHHMLGGIRYLIWDVSLCLDKK 102
             +F++    Y + +        + H   GIR++IWD+++ L KK
Sbjct: 62  YYLFDLIQEEYEFTIGVTMSLIILIHFFCGIRHIIWDLNIGLTKK 106


>gi|21593777|gb|AAM65744.1| unknown [Arabidopsis thaliana]
          Length = 213

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYL 38
           IK+ RPLSPHL +Y+      +SI +RI+G  VYL
Sbjct: 121 IKSFRPLSPHLSVYQPQMNSMLSIFNRISG--VYL 153


>gi|11022654|dbj|BAB17027.1| unnamed protein product [Arabidopsis thaliana]
          Length = 240

 Score = 33.9 bits (76), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYL 38
           IK+ RPLSPHL +Y+      +SI +RI+G  VYL
Sbjct: 148 IKSFRPLSPHLSVYQPQMNSMLSIFNRISG--VYL 180


>gi|296120489|ref|YP_003628267.1| hypothetical protein Plim_0216 [Planctomyces limnophilus DSM 3776]
 gi|296012829|gb|ADG66068.1| protein of unknown function DUF420 [Planctomyces limnophilus DSM
           3776]
          Length = 444

 Score = 33.5 bits (75), Expect = 8.7,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGE---HTLSSLRC 62
           N RP+ P   + R + T+       I  ++  L T +++  + CI  G+   H    L  
Sbjct: 284 NVRPIPPEDLLPRWVKTL-----PAINAALNGLATLLLITGYICIRRGQREMHRQLMLST 338

Query: 63  YMDGSVFEVCLFLYTWAV 80
           +M   VF VC  +Y WA+
Sbjct: 339 FMTSVVFLVCYLVYHWAL 356


>gi|312221584|emb|CBY01524.1| similar to succinate dehydrogenase cytochrome b560 subunit
           [Leptosphaeria maculans]
          Length = 174

 Score = 33.5 bits (75), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 45/111 (40%), Gaps = 15/111 (13%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITG----------SVVYLGTPVVVFWFFCI 50
           ++  +  RP+SPHL IY+   T + S ++R+T            + YL  P    W    
Sbjct: 44  LAKQRTRRPVSPHLSIYKPQITWYGSALNRVTAIALSGSLYLFGIAYLAAP-YTGWHLET 102

Query: 51  ANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDK 101
           A    ++ +       +V       + +   +H L G+R+L WD  +    
Sbjct: 103 A----SMVAAVAAWPAAVKVGAKAFFAFPFFYHSLNGVRHLFWDAGIGFKN 149


>gi|167615383|ref|ZP_02384018.1| succinate dehydrogenase, cytochrome b556 subunit [Burkholderia
           thailandensis Bt4]
          Length = 138

 Score = 33.5 bits (75), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 45/80 (56%)

Query: 17  YRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLY 76
           YR+     VSI+HR++G++++L  P +++ F      E +    + ++   + ++ +   
Sbjct: 24  YRMPLAARVSILHRVSGALLFLFLPFLLYLFDQSLTSELSFEVFKAFLSNVIVKLIVLAL 83

Query: 77  TWAVIHHMLGGIRYLIWDVS 96
           +WA + H   GIR+L+ D++
Sbjct: 84  SWAFLFHFCAGIRHLMMDMN 103


>gi|164686052|ref|ZP_01946353.2| succinate dehydrogenase, cytochrome b556 subunit [Coxiella
          burnetii 'MSU Goat Q177']
 gi|165918979|ref|ZP_02219065.1| succinate dehydrogenase, cytochrome b556 subunit [Coxiella
          burnetii RSA 334]
 gi|164601608|gb|EAX33026.2| succinate dehydrogenase, cytochrome b556 subunit [Coxiella
          burnetii 'MSU Goat Q177']
 gi|165917304|gb|EDR35908.1| succinate dehydrogenase, cytochrome b556 subunit [Coxiella
          burnetii RSA 334]
          Length = 125

 Score = 33.5 bits (75), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 47/98 (47%), Gaps = 7/98 (7%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL--- 60
          +   RP++  L  +   P   +SI HRI+G V++L  P++   F+ +     ++ S    
Sbjct: 1  MNATRPVNLDLTKFHFPPMAILSIGHRISGFVLFLCMPLM---FYLLHRATASVESFYHL 57

Query: 61 -RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL 97
           +  +     ++ +++   A + H+  GIR+L  D+  
Sbjct: 58 HQLLLHNGWIKLAVWIMLSATLFHLFAGIRHLAMDLGF 95


>gi|56460613|ref|YP_155894.1| succinate dehydrogenase/fumarate reductase cytochrome b subunit
          [Idiomarina loihiensis L2TR]
 gi|56179623|gb|AAV82345.1| Succinate dehydrogenase/fumarate reductase cytochrome b subunit
          [Idiomarina loihiensis L2TR]
          Length = 124

 Score = 33.5 bits (75), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 4  IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSLRC 62
          +K  RP++  L   +L      SI+HRI+G V  L +   + W F ++ +G    + +  
Sbjct: 1  MKKERPVNLDLSTIKLPAAAKASILHRISG-VAMLFSLAFLIWAFAVSLSGPEGFAQIES 59

Query: 63 YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS 96
           M   + +   +    A+  H++ G+R+L+ D+ 
Sbjct: 60 IMTSFIAKFIGWGILTALGFHLIIGLRHLVMDMG 93


Searching..................................................done


Results from round 2




>gi|163761421|ref|ZP_02168495.1| putative succinate dehydrogenase cytochrome b556 subunit [Hoeflea
           phototrophica DFL-43]
 gi|162281416|gb|EDQ31713.1| putative succinate dehydrogenase cytochrome b556 subunit [Hoeflea
           phototrophica DFL-43]
          Length = 163

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 78/129 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  NRPLSPHL IY+ IPTM +SI+HR+TG  +Y GT +V +W    A+G      +
Sbjct: 33  MTNVTQNRPLSPHLSIYKQIPTMVMSILHRLTGMALYAGTILVAWWLIAAASGPEYFDWV 92

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+LGGIR+ IWD     D + +T+MA   I  S++  +
Sbjct: 93  NGIFGSLLGRLVLFGYTWALVHHLLGGIRHFIWDTGHGFDPQTSTKMAWATITGSVILTV 152

Query: 121 IVWIIKDIV 129
           ++WI     
Sbjct: 153 LIWIAGYAT 161


>gi|148560663|ref|YP_001259728.1| succinate dehydrogenase, cytochrome subunit B [Brucella ovis ATCC
           25840]
 gi|189024973|ref|YP_001935741.1| Succinate dehydrogenase [Brucella abortus S19]
 gi|225628104|ref|ZP_03786139.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           str. Cudo]
 gi|237816266|ref|ZP_04595259.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           str. 2308 A]
 gi|261323851|ref|ZP_05963048.1| succinate dehydrogenase cytochrome B subunit [Brucella neotomae
           5K33]
 gi|297247147|ref|ZP_06930865.1| succinate dehydrogenase cytochrome b-556 subunit [Brucella abortus
           bv. 5 str. B3196]
 gi|148371920|gb|ABQ61899.1| succinate dehydrogenase, cytochrome B subunit [Brucella ovis ATCC
           25840]
 gi|189020545|gb|ACD73267.1| Succinate dehydrogenase [Brucella abortus S19]
 gi|225616929|gb|EEH13976.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           str. Cudo]
 gi|237788333|gb|EEP62548.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           str. 2308 A]
 gi|261299831|gb|EEY03328.1| succinate dehydrogenase cytochrome B subunit [Brucella neotomae
           5K33]
 gi|297174316|gb|EFH33663.1| succinate dehydrogenase cytochrome b-556 subunit [Brucella abortus
           bv. 5 str. B3196]
          Length = 187

 Score =  164 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 78/129 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
             ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++
Sbjct: 58  QPTVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTI 117

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  +
Sbjct: 118 NALFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATI 177

Query: 121 IVWIIKDIV 129
           +VW++   V
Sbjct: 178 LVWVVAYSV 186


>gi|254781041|ref|YP_003065454.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040718|gb|ACT57514.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 129

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 129/129 (100%), Positives = 129/129 (100%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL
Sbjct: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL
Sbjct: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120

Query: 121 IVWIIKDIV 129
           IVWIIKDIV
Sbjct: 121 IVWIIKDIV 129


>gi|260464202|ref|ZP_05812395.1| succinate dehydrogenase, cytochrome b556 subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259030005|gb|EEW31288.1| succinate dehydrogenase, cytochrome b556 subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 139

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 76/127 (59%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++ +  RPLSPHL IYR   TM +SI+HRITG  +Y GT +V  W    A+ +     + 
Sbjct: 9   ANARRERPLSPHLTIYRPPITMTMSIIHRITGGALYFGTLLVAIWLMAAASSQGAFDWVN 68

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + LF YTWA++HHMLGG+R+L+WD    L+K  A+++A   +  SIL  L+
Sbjct: 69  WAFGTWLGRLILFGYTWALMHHMLGGVRHLVWDTGAGLEKDTASKIAWATLAGSILLTLL 128

Query: 122 VWIIKDI 128
           +W+   +
Sbjct: 129 IWVAGYM 135


>gi|327188889|gb|EGE56081.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium
           etli CNPAF512]
          Length = 146

 Score =  159 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 91/129 (70%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQ+Y+LIPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 16  MANVTNNRPLSPHLQVYKLIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQASYDWA 75

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+L+WD+    +K+++T++A  NII S+   +
Sbjct: 76  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHLMWDLGYGFEKEVSTKLAIANIIGSLCLTV 135

Query: 121 IVWIIKDIV 129
           +VW++  ++
Sbjct: 136 LVWVVGFLI 144


>gi|239833035|ref|ZP_04681364.1| succinate dehydrogenase, cytochrome b556 subunit [Ochrobactrum
           intermedium LMG 3301]
 gi|239825302|gb|EEQ96870.1| succinate dehydrogenase, cytochrome b556 subunit [Ochrobactrum
           intermedium LMG 3301]
          Length = 152

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 78/129 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
             ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++
Sbjct: 23  QPTVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAAVSEECFNTV 82

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+ GG+R+LIWD    L+K  A+++A   ++ S++  +
Sbjct: 83  NALFSSWIGRLILFGYTWALLHHLAGGVRHLIWDTGAGLEKHTASRIAWTTVVFSVIATI 142

Query: 121 IVWIIKDIV 129
           +VW++   V
Sbjct: 143 LVWVVAYSV 151


>gi|13473609|ref|NP_105177.1| succinate dehydrogenase membrane anchor subunit [Mesorhizobium loti
           MAFF303099]
 gi|14024359|dbj|BAB50963.1| succinate dehydrogenase membrane anchor subunit [Mesorhizobium loti
           MAFF303099]
          Length = 139

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 76/124 (61%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHL IYR   TM +SI+HRITG  +Y GT +V  W    A+ + T   +    
Sbjct: 12  RRERPLSPHLTIYRPPITMTMSIIHRITGGALYFGTLLVAIWLMAAASSQATFDWVNWAF 71

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF YTWA++HHMLGG+R+L+WD    L+K  A+++A   ++ S+L  L++WI
Sbjct: 72  GTWLGRLILFGYTWALMHHMLGGVRHLVWDTGAGLEKHTASKIAWATLVGSVLLTLLIWI 131

Query: 125 IKDI 128
              +
Sbjct: 132 AGYM 135


>gi|227823652|ref|YP_002827625.1| putative succinate dehydrogenase membrane anchor subunit
           [Sinorhizobium fredii NGR234]
 gi|227342654|gb|ACP26872.1| putative succinate dehydrogenase membrane anchor subunit
           [Sinorhizobium fredii NGR234]
          Length = 130

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 58/129 (44%), Positives = 84/129 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  +RPLSPHLQIY+ IPTM +SIVHRITG  +Y GT +V +W    A+G      +
Sbjct: 1   MTNVTRSRPLSPHLQIYKPIPTMVMSIVHRITGGALYFGTILVAWWLIAAASGAAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  + ++ LF YTWA++HHMLGGIR+ IWD+    +K  AT+MAK  +  S+   L
Sbjct: 61  NWLFGTLIGKLVLFGYTWALVHHMLGGIRHFIWDLGYGYEKHFATKMAKGTLAGSVALTL 120

Query: 121 IVWIIKDIV 129
           ++WI+  +V
Sbjct: 121 LLWIVGSLV 129


>gi|325294014|ref|YP_004279878.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium sp.
           H13-3]
 gi|325061867|gb|ADY65558.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium sp.
           H13-3]
          Length = 130

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 58/129 (44%), Positives = 85/129 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM  SIVHRITG+ +Y GT +V +W   +A+G      +
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVASIVHRITGAALYFGTLLVAWWLIALASGPAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              M   + ++ L  YTWA++HHMLGG+R+ +WD+    +K   T++AK   +ASI    
Sbjct: 61  SWAMGTIIGKLILIGYTWALVHHMLGGLRHFMWDLGHGFEKNFNTKLAKATFVASICLTA 120

Query: 121 IVWIIKDIV 129
           ++W+I  IV
Sbjct: 121 LIWVIALIV 129


>gi|261220959|ref|ZP_05935240.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           B1/94]
 gi|265996918|ref|ZP_06109475.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M490/95/1]
 gi|260919543|gb|EEX86196.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           B1/94]
 gi|262551386|gb|EEZ07376.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M490/95/1]
          Length = 142

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 78/129 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
             ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++
Sbjct: 13  QPTVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTI 72

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  +
Sbjct: 73  NALFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATI 132

Query: 121 IVWIIKDIV 129
           +VW++   V
Sbjct: 133 LVWVVAYSV 141


>gi|260546025|ref|ZP_05821765.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260562821|ref|ZP_05833307.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|260567607|ref|ZP_05838077.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|260755583|ref|ZP_05867931.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 6 str. 870]
 gi|260758809|ref|ZP_05871157.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 4 str. 292]
 gi|260760533|ref|ZP_05872876.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260884609|ref|ZP_05896223.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 9 str. C68]
 gi|261214856|ref|ZP_05929137.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|261217733|ref|ZP_05932014.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M13/05/1]
 gi|261315053|ref|ZP_05954250.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M163/99/10]
 gi|261316390|ref|ZP_05955587.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis B2/94]
 gi|261321419|ref|ZP_05960616.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M644/93/1]
 gi|261751052|ref|ZP_05994761.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           5 str. 513]
 gi|261755614|ref|ZP_05999323.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           3 str. 686]
 gi|261758847|ref|ZP_06002556.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|265982914|ref|ZP_06095649.1| succinate dehydrogenase cytochrome b556 subunit [Brucella sp.
           83/13]
 gi|265987463|ref|ZP_06100020.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M292/94/1]
 gi|265991935|ref|ZP_06104492.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993667|ref|ZP_06106224.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|265999292|ref|ZP_05465704.2| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|260096132|gb|EEW80008.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260152837|gb|EEW87929.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|260157125|gb|EEW92205.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|260669127|gb|EEX56067.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 4 str. 292]
 gi|260670965|gb|EEX57786.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260675691|gb|EEX62512.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 6 str. 870]
 gi|260874137|gb|EEX81206.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 9 str. C68]
 gi|260916463|gb|EEX83324.1| succinate dehydrogenase cytochrome b556 subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|260922822|gb|EEX89390.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M13/05/1]
 gi|261294109|gb|EEX97605.1| succinate dehydrogenase cytochrome b556 subunit [Brucella ceti
           M644/93/1]
 gi|261295613|gb|EEX99109.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis B2/94]
 gi|261304079|gb|EEY07576.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M163/99/10]
 gi|261738831|gb|EEY26827.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|261740805|gb|EEY28731.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           5 str. 513]
 gi|261745367|gb|EEY33293.1| succinate dehydrogenase cytochrome b556 subunit [Brucella suis bv.
           3 str. 686]
 gi|262764648|gb|EEZ10569.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003001|gb|EEZ15294.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093078|gb|EEZ17228.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659660|gb|EEZ29921.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           pinnipedialis M292/94/1]
 gi|264661506|gb|EEZ31767.1| succinate dehydrogenase cytochrome b556 subunit [Brucella sp.
           83/13]
          Length = 142

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 78/129 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
             ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++
Sbjct: 13  QPTVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTI 72

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  +
Sbjct: 73  NALFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATI 132

Query: 121 IVWIIKDIV 129
           +VW++   V
Sbjct: 133 LVWVVAYSV 141


>gi|15966825|ref|NP_387178.1| succinate dehydrogenase cytochrome B-556 subunit transmembrane
           protein [Sinorhizobium meliloti 1021]
 gi|307301653|ref|ZP_07581412.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti BL225C]
 gi|307316323|ref|ZP_07595767.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti AK83]
 gi|15076097|emb|CAC47651.1| Probable succinate dehydrogenase cytochrome B-556 subunit
           transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898163|gb|EFN28905.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti AK83]
 gi|306903351|gb|EFN33940.1| succinate dehydrogenase, cytochrome b556 subunit [Sinorhizobium
           meliloti BL225C]
          Length = 130

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/128 (44%), Positives = 84/128 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  +RPLSPHLQIY+ IPTM +SI+HRITG  +Y GT +V +W    A+G      +
Sbjct: 1   MTNVTRSRPLSPHLQIYKPIPTMIMSIMHRITGGALYFGTVLVAWWLIAAASGTAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  + +V LF YTWA++HH+LGGIR+L WD+    +K  AT+MAK  I+AS    L
Sbjct: 61  NWLFGTFIGKVVLFGYTWALVHHLLGGIRHLAWDLGYGYEKHFATRMAKAMIVASATLTL 120

Query: 121 IVWIIKDI 128
           ++W++  +
Sbjct: 121 VIWVVGYL 128


>gi|114328744|ref|YP_745901.1| succinate dehydrogenase cytochrome b556 subunit [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316918|gb|ABI62978.1| succinate dehydrogenase cytochrome b556 subunit [Granulibacter
           bethesdensis CGDNIH1]
          Length = 197

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 69/122 (56%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQ+YR   TM +SI+HR+TG    +GT ++ +W    A  +H    +  +M   
Sbjct: 75  RPLSPHLQVYRWPITMALSILHRVTGVAAAIGTLLLTWWLVAAATSDHAYDIVSGFMRSG 134

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKD 127
              + LF +T A+++H + GIR+L+WD     DK  A + + I +  + L  + +WI   
Sbjct: 135 FGLLLLFGWTVALVYHFINGIRHLVWDAGYGFDKHEANRSSYIVLGLTALFTVAIWIAAA 194

Query: 128 IV 129
           +V
Sbjct: 195 VV 196


>gi|304394275|ref|ZP_07376198.1| succinate dehydrogenase, cytochrome b556 subunit [Ahrensia sp.
           R2A130]
 gi|303293715|gb|EFL88092.1| succinate dehydrogenase, cytochrome b556 subunit [Ahrensia sp.
           R2A130]
          Length = 138

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 77/128 (60%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            + +  RPLSPHL+IY+ IPTM +SI+HR+TG+ +Y GT +V +W    A+G     +  
Sbjct: 8   PTTRKPRPLSPHLEIYKPIPTMVMSILHRVTGAALYFGTILVAWWLLAAASGPEAFETAS 67

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
            +       + LF YT A+IHHMLGG+++L+ D    LDK   T+MAK   + SI+  ++
Sbjct: 68  NFFGSWFGRLVLFGYTLALIHHMLGGMKHLVQDTGRGLDKDFTTKMAKAQPVLSIIITVL 127

Query: 122 VWIIKDIV 129
           +W     V
Sbjct: 128 IWFAAYAV 135


>gi|150398156|ref|YP_001328623.1| succinate dehydrogenase cytochrome b556 subunit [Sinorhizobium
           medicae WSM419]
 gi|150029671|gb|ABR61788.1| Succinate dehydrogenase cytochrome b556 subunit [Sinorhizobium
           medicae WSM419]
          Length = 130

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/128 (44%), Positives = 85/128 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  +RPLSPHLQIY+ IPTM +SI+HRITG  +Y GT +V +W    A+G      +
Sbjct: 1   MTNVTRSRPLSPHLQIYKPIPTMIMSIMHRITGGALYFGTVLVAWWLIAAASGTAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             +    + +V LF YTWA++HH+LGGIR+L WD+    +K  AT++AK  I+AS    L
Sbjct: 61  NWFFGTLIGKVVLFGYTWALMHHLLGGIRHLGWDLGYGYEKHFATRVAKAMIVASAALTL 120

Query: 121 IVWIIKDI 128
           ++WI+  +
Sbjct: 121 VIWIVGYL 128


>gi|319780753|ref|YP_004140229.1| succinate dehydrogenase cytochrome b556 subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166641|gb|ADV10179.1| succinate dehydrogenase, cytochrome b556 subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 139

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 74/124 (59%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RP+SPHL +YR   TM +SI+HRITG  +Y GT +V  W    A+ + T        
Sbjct: 12  RRERPISPHLTVYRPPITMTMSIIHRITGGALYFGTLLVALWLMAAASSQATFDWANWAF 71

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF YTWA++HHMLGG+R+LIWD    L+K  A+++A   +  SIL  L++WI
Sbjct: 72  GTWLGRIILFGYTWALMHHMLGGVRHLIWDTGAGLEKHTASKIAWATLAGSILLTLLIWI 131

Query: 125 IKDI 128
              +
Sbjct: 132 AGTM 135


>gi|222087469|ref|YP_002546006.1| succinate dehydrogenase, cytochrome b556 subunit [Agrobacterium
           radiobacter K84]
 gi|221724917|gb|ACM28073.1| succinate dehydrogenase, cytochrome b556 subunit [Agrobacterium
           radiobacter K84]
          Length = 133

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 83/129 (64%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++  NRPLSPHLQIY+ IPTM +SIVHRITG  +Y GT +V +W    A G+     +
Sbjct: 2   MANVTQNRPLSPHLQIYKPIPTMIMSIVHRITGGALYFGTVLVAWWLIAAATGQGYFELV 61

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              M   +  + LF YTWA++HHMLGG+R+ +WD+     K+ +T++AK  ++ S+    
Sbjct: 62  NWIMGTIIGRLVLFGYTWALLHHMLGGLRHFMWDLGYGFGKEFSTKLAKATLVGSLCLTA 121

Query: 121 IVWIIKDIV 129
           +VWII   +
Sbjct: 122 LVWIIGIAI 130


>gi|75676982|ref|YP_319403.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|74421852|gb|ABA06051.1| succinate dehydrogenase subunit C [Nitrobacter winogradskyi Nb-255]
          Length = 141

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 76/129 (58%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M +++  RPLSPHLQIYR   TM +SIVHR TG  +Y GT ++V+W   +++G    +++
Sbjct: 8   MMTVRIERPLSPHLQIYRWTLTMTLSIVHRATGVALYFGTLLLVWWLMAVSSGPGAYAAV 67

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           + +       +  F YTWA++HHMLGG+R+L+WD+           + +  +I  IL   
Sbjct: 68  QSFTSSWAGRLIAFGYTWALMHHMLGGVRHLVWDLGYGFQPTEREWLTRATLIGGILLTA 127

Query: 121 IVWIIKDIV 129
           ++WI    +
Sbjct: 128 LLWIAAYAI 136


>gi|86359478|ref|YP_471370.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium
           etli CFN 42]
 gi|190893746|ref|YP_001980288.1| succinate dehydrogenase, cytochrome b subunit [Rhizobium etli CIAT
           652]
 gi|218515347|ref|ZP_03512187.1| succinate dehydrogenase protein, cytochrome b subunit [Rhizobium
           etli 8C-3]
 gi|86283580|gb|ABC92643.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium
           etli CFN 42]
 gi|190699025|gb|ACE93110.1| succinate dehydrogenase protein, cytochrome b subunit [Rhizobium
           etli CIAT 652]
          Length = 131

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 57/129 (44%), Positives = 91/129 (70%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQ+Y+LIPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQVYKLIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQASYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+L+WD+    +K+++T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHLMWDLGYGFEKEVSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|153008286|ref|YP_001369501.1| succinate dehydrogenase cytochrome b556 subunit [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560174|gb|ABS13672.1| Succinate dehydrogenase cytochrome b556 subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 132

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 77/129 (59%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
             ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   + +
Sbjct: 3   QPTVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAAVSEECFNFV 62

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+ GG+R+LIWD    L+K  A+++A   ++ S++  +
Sbjct: 63  NALFSSWIGRLILFGYTWALLHHLAGGVRHLIWDTGAGLEKHTASKIAWATVVFSVIATI 122

Query: 121 IVWIIKDIV 129
           +VW++   V
Sbjct: 123 LVWVVAYSV 131


>gi|254470646|ref|ZP_05084049.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudovibrio sp.
           JE062]
 gi|211959788|gb|EEA94985.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudovibrio sp.
           JE062]
          Length = 132

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 57/128 (44%), Positives = 81/128 (63%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           + +K NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ FW  C A G  +     
Sbjct: 4   ADLKANRPLSPHLQIYKPIVTMVMSILHRITGAALYFGTILMAFWLVCAAAGPESYQFAM 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 + ++ LF +TWA++HHMLGG+R+ +WD+    D   A  MA+  II S+   +I
Sbjct: 64  DVFGSFLGQLVLFGFTWALVHHMLGGLRHFVWDMGHGFDLSAANWMARATIIGSVSLTVI 123

Query: 122 VWIIKDIV 129
           +WII  IV
Sbjct: 124 LWIIGFIV 131


>gi|159185307|ref|NP_355582.2| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           tumefaciens str. C58]
 gi|159140565|gb|AAK88367.2| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 130

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/129 (45%), Positives = 84/129 (65%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM  SIVHRITG  +Y GT +V +W   +A+G      +
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVASIVHRITGGALYFGTLLVAWWLIALASGPAYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              M   +  + L  YTWA++HHMLGG+R+ +WD+    DK   T++AK + +ASI    
Sbjct: 61  NWAMGTIIGRLILIGYTWALVHHMLGGLRHFMWDLGHGFDKHFTTKLAKASWVASICLTA 120

Query: 121 IVWIIKDIV 129
           ++W+I  IV
Sbjct: 121 LIWVIVLIV 129


>gi|209551264|ref|YP_002283181.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|241206664|ref|YP_002977760.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|209537020|gb|ACI56955.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|240860554|gb|ACS58221.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 131

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 87/129 (67%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQGSYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+ +WD+     K+ +T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHFMWDLGYGFGKEFSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|218682066|ref|ZP_03529667.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium etli
           CIAT 894]
          Length = 131

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 86/129 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQGSYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + +  L  YTWA++HHMLGG R+ +WD+     K+ +T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKFVLLGYTWALLHHMLGGFRHFMWDLGYGFGKEFSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|116254178|ref|YP_770016.1| succinate dehydrogenase cytochrome b556 subunit [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258826|emb|CAK09932.1| putative succinate dehydrogenase cytochrome b556 subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 131

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 87/129 (67%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQIY+ IPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQIYKPIPTMIMSIVHRITGGALYVGTILVAWWLIAAASGQGSYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +   + ++ L  YTWA++HHMLGG R+ +WD+     K+ +T++A  NII S+   +
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHFMWDLGYGFGKEFSTKLAIANIIGSLCLTV 120

Query: 121 IVWIIKDIV 129
           +VW+I  ++
Sbjct: 121 LVWVIGFLI 129


>gi|90421134|ref|ZP_01229036.1| succinate dehydrogenase, cytochrome b subunit [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334626|gb|EAS48406.1| succinate dehydrogenase, cytochrome b subunit [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 130

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 83/124 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K  RPLSPHL IYR  PTM +SI+HRITGS +Y+GT + V+W    A+G    S  
Sbjct: 1   MSDLKTARPLSPHLSIYRFRPTMAMSILHRITGSALYVGTLLFVWWLIAAASGPEAFSYA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             +    +  + LF YTWA++HHM GGIR+LIWD  + L K+ +T++A+  ++AS+   L
Sbjct: 61  SAFFGSIIGRIILFGYTWALLHHMFGGIRHLIWDTGIGLSKETSTKLAQATLVASLALTL 120

Query: 121 IVWI 124
           I+W+
Sbjct: 121 ILWV 124


>gi|256158405|ref|ZP_05456303.1| Succinate dehydrogenase [Brucella ceti M490/95/1]
 gi|256253825|ref|ZP_05459361.1| Succinate dehydrogenase [Brucella ceti B1/94]
          Length = 132

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 78/129 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
             ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++
Sbjct: 3   QPTVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTI 62

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  +
Sbjct: 63  NALFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATI 122

Query: 121 IVWIIKDIV 129
           +VW++   V
Sbjct: 123 LVWVVAYSV 131


>gi|17986443|ref|NP_539077.1| succinate dehydrogenase cytochrome B-556 subunit [Brucella
           melitensis bv. 1 str. 16M]
 gi|23502755|ref|NP_698882.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           1330]
 gi|62290760|ref|YP_222553.1| SdhC, succinate dehydrogenase, cytochrome b556 subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700671|ref|YP_415245.1| succinate dehydrogenase, cytochrome subunit B [Brucella melitensis
           biovar Abortus 2308]
 gi|161619821|ref|YP_001593708.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella canis
           ATCC 23365]
 gi|163843927|ref|YP_001628331.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           ATCC 23445]
 gi|225853341|ref|YP_002733574.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis ATCC 23457]
 gi|254690049|ref|ZP_05153303.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 6 str. 870]
 gi|254694537|ref|ZP_05156365.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|254696162|ref|ZP_05157990.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254700548|ref|ZP_05162376.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis bv.
           5 str. 513]
 gi|254704918|ref|ZP_05166746.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis bv.
           3 str. 686]
 gi|254707568|ref|ZP_05169396.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           pinnipedialis M163/99/10]
 gi|254708895|ref|ZP_05170706.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           pinnipedialis B2/94]
 gi|254713680|ref|ZP_05175491.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           M644/93/1]
 gi|254715969|ref|ZP_05177780.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella ceti
           M13/05/1]
 gi|254717971|ref|ZP_05179782.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp.
           83/13]
 gi|254731080|ref|ZP_05189658.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 4 str. 292]
 gi|256030421|ref|ZP_05444035.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           pinnipedialis M292/94/1]
 gi|256045512|ref|ZP_05448395.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256059880|ref|ZP_05450067.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella neotomae
           5K33]
 gi|256112239|ref|ZP_05453160.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|256258302|ref|ZP_05463838.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella abortus
           bv. 9 str. C68]
 gi|256370306|ref|YP_003107817.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella microti
           CCM 4915]
 gi|260169332|ref|ZP_05756143.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp.
           F5/99]
 gi|294851145|ref|ZP_06791818.1| succinate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|306838923|ref|ZP_07471750.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. NF
           2653]
 gi|306842942|ref|ZP_07475576.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO2]
 gi|306843359|ref|ZP_07475960.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO1]
 gi|17982039|gb|AAL51341.1| succinate dehydrogenase cytochrome b-556 subunit [Brucella
           melitensis bv. 1 str. 16M]
 gi|23348773|gb|AAN30797.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           1330]
 gi|62196892|gb|AAX75192.1| SdhC, succinate dehydrogenase, cytochrome b556 subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616772|emb|CAJ11859.1| Succinate dehydrogenase, cytochrome b subunit [Brucella melitensis
           biovar Abortus 2308]
 gi|161336632|gb|ABX62937.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella canis
           ATCC 23365]
 gi|163674650|gb|ABY38761.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella suis
           ATCC 23445]
 gi|225641706|gb|ACO01620.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis ATCC 23457]
 gi|256000469|gb|ACU48868.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella microti
           CCM 4915]
 gi|294819734|gb|EFG36733.1| succinate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|306276050|gb|EFM57750.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO1]
 gi|306286870|gb|EFM58395.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. BO2]
 gi|306405993|gb|EFM62245.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella sp. NF
           2653]
 gi|326409905|gb|ADZ66970.1| succinate dehydrogenase cytochrome b556 subunit [Brucella
           melitensis M28]
 gi|326539618|gb|ADZ87833.1| succinate dehydrogenase, cytochrome b556 subunit [Brucella
           melitensis M5-90]
          Length = 132

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 78/129 (60%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
             ++   RPLSPHL IY+ + TM +SIVHRITG  +Y GT ++  W    A  E   +++
Sbjct: 3   QPTVTRQRPLSPHLSIYKPVITMTMSIVHRITGGALYFGTLLLAAWLISAATSEECFNTI 62

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                  +  + LF YTWA++HH+ GG+R+ IWD    ++K  A+++A  +++ S++  +
Sbjct: 63  NALFSSWIGRLILFGYTWALLHHLAGGVRHFIWDTGAAMEKHTASKIAWASVVFSVVATI 122

Query: 121 IVWIIKDIV 129
           +VW++   V
Sbjct: 123 LVWVVAYSV 131


>gi|146337397|ref|YP_001202445.1| succinate dehydrogenase cytochrome b556 subunit [Bradyrhizobium sp.
           ORS278]
 gi|146190203|emb|CAL74195.1| Succinate dehydrogenase cytochrome b556 subunit [Bradyrhizobium sp.
           ORS278]
          Length = 132

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/127 (36%), Positives = 71/127 (55%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPHLQ YR   TM +SIVHR TG  +Y GT ++ +W    A+G    S ++ 
Sbjct: 2   TARIERPLSPHLQTYRWTLTMILSIVHRATGVALYFGTLLLAWWLIAAASGPSAYSYVQG 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +M   +  + +F YTWA++HH+L GIR+ +WD+           +    +I  I   ++V
Sbjct: 62  FMGSFLGRLIVFGYTWALLHHLLSGIRHFVWDLGYGFKPNERETLTWGALIGGISLTVLV 121

Query: 123 WIIKDIV 129
           WI+   V
Sbjct: 122 WIVAYAV 128


>gi|114320488|ref|YP_742171.1| succinate dehydrogenase subunit C [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226882|gb|ABI56681.1| succinate dehydrogenase subunit C [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 130

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 67/112 (59%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
             +NRPLSPHLQ+Y+   T  +SI HR +G V+ LG+ ++V+W   +A G    +++   
Sbjct: 2   QTDNRPLSPHLQVYKPQLTSVLSICHRGSGVVLALGSIILVWWLSALAAGPEAFATVNGV 61

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
           +   + +V LFL+T A+ +H+  GIR+L+WD     + +   +   + +IAS
Sbjct: 62  VGSFIGKVILFLFTLALFYHLCNGIRHLVWDTGRGFELESVYRSGYLVVIAS 113


>gi|92119075|ref|YP_578804.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           hamburgensis X14]
 gi|91801969|gb|ABE64344.1| succinate dehydrogenase subunit C [Nitrobacter hamburgensis X14]
          Length = 132

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 77/127 (60%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +++  RPLSPHLQIYR   TM +S+VHR TG  +Y GT ++V+W   +++G    ++++ 
Sbjct: 2   TVRIERPLSPHLQIYRWTLTMALSVVHRATGMALYFGTLLLVWWLIAVSSGPGAYAAVQS 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  +  F YTWA++HHML G+R+L+WD+           + +  +I  IL  +++
Sbjct: 62  FTASWIGRLIAFGYTWALMHHMLSGVRHLVWDLGYGFKPAEREWLTRAALIGGILLTVLL 121

Query: 123 WIIKDIV 129
           WI+   V
Sbjct: 122 WIVAYAV 128


>gi|118590533|ref|ZP_01547935.1| succinate dehydrogenase cytochrome B-556 subunit [Stappia aggregata
           IAM 12614]
 gi|118436996|gb|EAV43635.1| succinate dehydrogenase cytochrome B-556 subunit [Stappia aggregata
           IAM 12614]
          Length = 132

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 78/128 (60%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           + ++ NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ +W    A G      + 
Sbjct: 4   ADLRGNRPLSPHLQIYKPILTMVMSILHRITGAALYFGTVLLAWWLIAAAAGPSYFDFVN 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + LF +TWA++HHMLGG+R+ IWD+     K+    +AK  II S+   LI
Sbjct: 64  GIYGSIIGRLILFGFTWALVHHMLGGLRHFIWDMGAGFGKEAREWLAKATIIGSVSVTLI 123

Query: 122 VWIIKDIV 129
           +WII   V
Sbjct: 124 LWIIGYAV 131


>gi|85714477|ref|ZP_01045465.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698924|gb|EAQ36793.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
          Length = 133

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 75/127 (59%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +++  RPLSPHLQIYR   TM +SIVHR TG  +Y GT ++V+W   +++G    ++++ 
Sbjct: 2   TVRIERPLSPHLQIYRWTLTMALSIVHRATGVALYFGTLLLVWWLMAVSSGPGAYAAVQS 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +       +  F YTWA++HHML G+R+L+WD+           + +  +I  IL  +++
Sbjct: 62  FTSSWAGRLIAFGYTWALMHHMLSGVRHLVWDLGYGFKPTEREWLTRAALIGGILLTVLL 121

Query: 123 WIIKDIV 129
           WI    +
Sbjct: 122 WIAVYAI 128


>gi|307942783|ref|ZP_07658128.1| succinate dehydrogenase, cytochrome b556 subunit [Roseibium sp.
           TrichSKD4]
 gi|307773579|gb|EFO32795.1| succinate dehydrogenase, cytochrome b556 subunit [Roseibium sp.
           TrichSKD4]
          Length = 132

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 77/128 (60%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           +  + NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ +W    A G      + 
Sbjct: 4   ADSRGNRPLSPHLQIYKPILTMVMSILHRITGAALYFGTVLLAWWLIAAAAGPTYFEFVN 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + LF +TWA++HHMLGG+R+ IWD+     ++    +A+  II S+   ++
Sbjct: 64  EIYSSFIGRLILFGFTWALVHHMLGGLRHFIWDMGAGFGREAREWLARATIIGSVGLTIL 123

Query: 122 VWIIKDIV 129
           +WII   V
Sbjct: 124 LWIIGYAV 131


>gi|27375623|ref|NP_767152.1| succinate dehydrogenase cytochrome B-556 subunit [Bradyrhizobium
           japonicum USDA 110]
 gi|3169722|gb|AAC17940.1| succinate dehydrogenase membrane anchor subunit [Bradyrhizobium
           japonicum]
 gi|27348760|dbj|BAC45777.1| succinate dehydrogenase cytochrome B-556 subunit [Bradyrhizobium
           japonicum USDA 110]
          Length = 132

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/127 (33%), Positives = 72/127 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPH+Q+YR   TM +SIVHR TG  +Y GT ++ +W    A+G    S ++ 
Sbjct: 2   TARIERPLSPHMQVYRWTLTMALSIVHRATGIALYAGTLLLAWWLIAAASGPAAYSHVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + +F YTWA++HHML GIR+ +WD+           +    +I  I+  +++
Sbjct: 62  FTGSIIGRLIVFGYTWALMHHMLSGIRHFVWDLGYGFKANEREALTWGALIGGIVLTVLI 121

Query: 123 WIIKDIV 129
           WI+   +
Sbjct: 122 WIVAYAI 128


>gi|209967178|ref|YP_002300093.1| succinate dehydrogenase, cytochrome b556, putative [Rhodospirillum
           centenum SW]
 gi|209960644|gb|ACJ01281.1| succinate dehydrogenase, cytochrome b556, putative [Rhodospirillum
           centenum SW]
          Length = 138

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YRL      SI HR+TG  +  GT ++ +W    A G    ++++    
Sbjct: 14  RPRPLSPHLQVYRLPLPAIASITHRVTGVGLAAGTLLLAWWLIAAATGPEAFATVQAVAG 73

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
             +  +CL  + WA  +H + G+R+L+WD    L+     +   +    SI   +   I+
Sbjct: 74  SPLGLLCLLGWVWAFWYHAMNGVRHLLWDAGYGLELGPVYRGGYLVWGGSIGLTVATAIV 133

Query: 126 KDIV 129
              V
Sbjct: 134 AFSV 137


>gi|328541811|ref|YP_004301920.1| Succinate dehydrogenase, cytochrome b556 subunit [polymorphum
           gilvum SL003B-26A1]
 gi|326411563|gb|ADZ68626.1| Succinate dehydrogenase, cytochrome b556 subunit [Polymorphum
           gilvum SL003B-26A1]
          Length = 132

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 77/125 (61%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQIY+ I TM +SI+HRITG+ +Y GT ++ +W    A G      +    
Sbjct: 7   QGNRPLSPHLQIYKPILTMVMSILHRITGAALYFGTLLLAWWLIAAAAGPAYFDFVNGIY 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + LF +TWA++HHMLGGIR+ IWD+     ++    +A+  II S+   +++WI
Sbjct: 67  GSILGRLVLFGFTWALVHHMLGGIRHFIWDMGAGFGREAREWLARATIIGSVAVTILLWI 126

Query: 125 IKDIV 129
           +  +V
Sbjct: 127 VGYMV 131


>gi|159045407|ref|YP_001534201.1| putative succinate dehydrogenase cytochrome subunit B
           [Dinoroseobacter shibae DFL 12]
 gi|157913167|gb|ABV94600.1| putative succinate dehydrogenase cytochrome b subunit
           [Dinoroseobacter shibae DFL 12]
          Length = 127

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 61/118 (51%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RPLSPH+QIYR   T   SI+ RITG+ + +G  + V+W    A G    + +   +
Sbjct: 6   RGDRPLSPHIQIYRPQLTSVTSILTRITGNALLVGALLCVWWLIAAAAGPEYFAFVDGLV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
                ++      WA+ +H L G+R+LIWD     + K A  +  + I  S++  +I 
Sbjct: 66  TSWFGKLVFLGSIWALWYHTLAGVRHLIWDAGYGFELKDAYALGYMVIGGSVVLTVIT 123


>gi|114707253|ref|ZP_01440151.1| succinate dehydrogenase cytochrome B-556 subunit protein
           [Fulvimarina pelagi HTCC2506]
 gi|114537449|gb|EAU40575.1| succinate dehydrogenase cytochrome B-556 subunit protein
           [Fulvimarina pelagi HTCC2506]
          Length = 129

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 79/124 (63%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K+NRPLSPHL IY+  PTM +SIVHRITG  +Y GT ++V+W    A+GE    + 
Sbjct: 1   MSDVKSNRPLSPHLSIYKFRPTMAMSIVHRITGGALYFGTILIVWWLIAAASGEAAFETA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
             +    +  + L  Y+WA+ HH LGGIR+ IWD    L K+ +T+ A++ ++ S+    
Sbjct: 61  SWFFGSFIGILILMGYSWALFHHALGGIRHFIWDTGHGLSKETSTKFAQMTLVGSLGLTA 120

Query: 121 IVWI 124
           I+W+
Sbjct: 121 ILWL 124


>gi|217979669|ref|YP_002363816.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocella
           silvestris BL2]
 gi|217505045|gb|ACK52454.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocella
           silvestris BL2]
          Length = 131

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 72/117 (61%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR   TM +SIVHRITG+ +Y GT ++ ++    A+G    ++    +   
Sbjct: 9   RPLSPHLQIYRPTLTMMMSIVHRITGAALYGGTLLLAWFLISAASGPGAFAAASHVVSSF 68

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
             ++ LF +TWA+ HH+LGG+R+LIWD+   LD      +A   +I  I   L+VW+
Sbjct: 69  FGKLVLFGFTWALFHHLLGGVRHLIWDLGYGLDDPEREWLAWATLIGGIALTLLVWV 125


>gi|182679666|ref|YP_001833812.1| succinate dehydrogenase, cytochrome b556 subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182635549|gb|ACB96323.1| succinate dehydrogenase, cytochrome b556 subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 137

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 76/126 (60%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + N RPLSPHL IYR + TM +SIVHRITG+ +YLGT ++ ++    A+G    ++   +
Sbjct: 11  VGNQRPLSPHLLIYRPMLTMMMSIVHRITGAALYLGTLLLAWYLIAAASGPEAFATASIF 70

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            +  + ++ L  +TWA+ HH LGG+R++IWD     D      +A+  +I  IL  L VW
Sbjct: 71  FNSILGKLILLGFTWALFHHFLGGVRHMIWDAGYGFDAAGREFLAQATLIGGILLTLFVW 130

Query: 124 IIKDIV 129
           I+   +
Sbjct: 131 ILAYFI 136


>gi|254487864|ref|ZP_05101069.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           GAI101]
 gi|214044733|gb|EEB85371.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           GAI101]
          Length = 127

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 65/121 (53%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A      ++   ++
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNAMLVAALLIVWWFLAAATSPEAFAAANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ +F     + +H L GIR+LIWD    LD + A ++    ++ S+L  +I  +
Sbjct: 66  TSWFGDLIMFFSLLGLWYHTLAGIRHLIWDNGYGLDIQTAEKLGWAALVGSVLLTIITAL 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|115522538|ref|YP_779449.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisA53]
 gi|115516485|gb|ABJ04469.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris
           BisA53]
          Length = 132

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 69/125 (55%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPH+Q YR   TM +SIVHR TG  +Y GT V+ +W   +  G    ++++ + 
Sbjct: 4   RIERPLSPHMQAYRWTLTMTLSIVHRATGVALYFGTLVLAWWLIAVGAGPGAYANVQAFT 63

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ +F YTW+++HH L GIR+ +WD+           +    +I  ++  +++W+
Sbjct: 64  GSWIGKLIMFGYTWSLMHHFLSGIRHFVWDLGYGYKPADRELLTWAALIGGVVLTVLLWV 123

Query: 125 IKDIV 129
               +
Sbjct: 124 AAFAL 128


>gi|83313049|ref|YP_423313.1| succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Magnetospirillum magneticum AMB-1]
 gi|82947890|dbj|BAE52754.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 125

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 64/123 (52%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
               RPLSPH+Q+YR+  T  +SI HRITG  + +GT V+ +W    A G       +  
Sbjct: 2   TTRTRPLSPHIQVYRMPFTAILSISHRITGVALAVGTVVLAYWLASAAYGPVAYGHAQAV 61

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + ++ LF +T A+ +H+  GIR+L WD     +   A +  ++ + A+    ++ W
Sbjct: 62  LGSWLGKLVLFGWTAALFYHLCNGIRHLFWDKGRGYEIAEADKSGRMVVGAAAALTVLAW 121

Query: 124 IIK 126
           I  
Sbjct: 122 IFG 124


>gi|294085393|ref|YP_003552153.1| succinate dehydrogenase subunit C [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664968|gb|ADE40069.1| succinate dehydrogenase subunit C [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 123

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 63/122 (51%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RPLSPHLQIY+   T  +SI HR TG V+  GT +V  W   +A GE + +     
Sbjct: 1   MSKPRPLSPHLQIYKPQMTSVLSICHRATGVVLATGTGLVCLWLIALALGEDSFALATMI 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + +  LF Y+  + +H   GIR+L WD+   L+        +I + A+++   I W
Sbjct: 61  IQHPLGQFVLFGYSAVLFYHACNGIRHLAWDMGYGLEIPQVYATGRIVLAATVILTGIFW 120

Query: 124 II 125
            +
Sbjct: 121 FL 122


>gi|254510339|ref|ZP_05122406.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacteraceae
           bacterium KLH11]
 gi|221534050|gb|EEE37038.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacteraceae
           bacterium KLH11]
          Length = 184

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 1/116 (0%)

Query: 1   MSSI-KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+ + + NRPLSPHL IYR   T   SI+ RITG+ + L   ++V+WF   A      + 
Sbjct: 57  MADVNRGNRPLSPHLSIYRPQLTSVTSILTRITGNAMLLAALLIVWWFLAAATSPEAFAR 116

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
              ++   + ++ + L  W + +H L GIR+LIWD +  LD   AT++    +I S
Sbjct: 117 ANWWLTSILGDLVMALSLWGLWYHTLAGIRHLIWDNAYGLDIPTATKLGWAVVIGS 172


>gi|153868748|ref|ZP_01998495.1| Succinate dehydrogenase, cytochrome b subunit [Beggiatoa sp. PS]
 gi|152074659|gb|EDN71493.1| Succinate dehydrogenase, cytochrome b subunit [Beggiatoa sp. PS]
          Length = 130

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 65/122 (53%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             +PLSPHLQIY+   T  +SI+HRITG  + LGT V+V+W    A G  T    + ++ 
Sbjct: 2   TKQPLSPHLQIYKPQLTSIMSILHRITGVFLSLGTLVLVYWLMAAAEGPETYQQAQNFLR 61

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
                  LF ++ A+ +H+  GIR+L WD  L LD K       +  I + L  ++ W++
Sbjct: 62  SWWGLFLLFGWSLALFYHLCNGIRHLFWDAGLGLDIKTVYITGSLVWIMTFLLTILTWVL 121

Query: 126 KD 127
             
Sbjct: 122 AF 123


>gi|39933296|ref|NP_945572.1| succinate dehydrogenase cytochrome b subunit [Rhodopseudomonas
           palustris CGA009]
 gi|192288649|ref|YP_001989254.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|39652921|emb|CAE25663.1| succinate dehydrogenase membrane anchor/cytochrome b subunit
           [Rhodopseudomonas palustris CGA009]
 gi|192282398|gb|ACE98778.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 132

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 70/125 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G    ++++ 
Sbjct: 2   TARIERPLSPHMQAYRWSLTMTMSIVHRATGIALYSGTLLLAWWLIACAAGPTAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + +F YTW+++HHML G+R+ +WD+           +    +I  I+  +++
Sbjct: 62  FTGSWIGRLIVFGYTWSLMHHMLSGVRHFVWDLGYGFKTADREWLTWAALIGGIVLTVLL 121

Query: 123 WIIKD 127
           W+I  
Sbjct: 122 WVIAY 126


>gi|154245910|ref|YP_001416868.1| succinate dehydrogenase cytochrome b556 subunit [Xanthobacter
           autotrophicus Py2]
 gi|154159995|gb|ABS67211.1| Succinate dehydrogenase cytochrome b556 subunit [Xanthobacter
           autotrophicus Py2]
          Length = 133

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 72/128 (56%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S  + +RPLSPHLQIYR + TM +SIVHRITG  +Y GT ++V+W    A       S R
Sbjct: 4   SPQRIDRPLSPHLQIYRPLFTMVMSIVHRITGVGLYFGTAILVWWLLAAATSPSAFESFR 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + LF YTWA++HH LGG R+ IWD       K    +A+  +  S+   +I
Sbjct: 64  SVAGSPIGLIVLFGYTWALLHHALGGARHFIWDFIHGFGPKERMLLAQATLAGSVALTVI 123

Query: 122 VWIIKDIV 129
           +W++   V
Sbjct: 124 LWVVGLAV 131


>gi|121996856|ref|YP_001001643.1| succinate dehydrogenase, cytochrome b subunit [Halorhodospira
           halophila SL1]
 gi|121588261|gb|ABM60841.1| succinate dehydrogenase subunit C [Halorhodospira halophila SL1]
          Length = 129

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 64/123 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
             NRPLSPHL IYR   T  +S++HR TG  V +   ++V W   +A G      L   +
Sbjct: 3   NPNRPLSPHLTIYRPQLTSLLSVLHRGTGVFVTMAAVLLVAWVMALAAGPEYYELLTQVL 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ L   T+++ +H+  GIR+L+WD     + K   +   + + AS+L   +VW+
Sbjct: 63  GHWLGQLVLLGITFSLAYHLCNGIRHLVWDTVRAFELKAVYRGGYMVLAASVLLTALVWV 122

Query: 125 IKD 127
           I  
Sbjct: 123 IAY 125


>gi|149913137|ref|ZP_01901671.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           AzwK-3b]
 gi|149813543|gb|EDM73369.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           AzwK-3b]
          Length = 127

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 64/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHLQ+YR   T   SI+ RITG+ + +G  ++V+W    A G    +     +
Sbjct: 6   RGERPLSPHLQVYRPQMTSISSILTRITGNALIVGVLLIVWWLLAAATGPDYFAIADAVV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ L L  WA+ +H L G+R+L +D    L+ + + ++    I  S++  +I  +
Sbjct: 66  TSWFGDLVLTLSLWAIWYHYLAGLRHLYYDAGKGLEIETSEKLGWACIGGSVILTVITLL 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|83943849|ref|ZP_00956306.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           EE-36]
 gi|83845096|gb|EAP82976.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           EE-36]
          Length = 127

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 63/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A           ++
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNAMLVAALLIVWWFLAAATSAEYFDIANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ +FL    + +H L GIR+LIWD    LD   A ++    +I S++  +I  +
Sbjct: 66  TSWFGDLVMFLSLLGLWYHTLAGIRHLIWDNGYALDIPTAEKLGWAALIGSVVLTIITAL 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|90421600|ref|YP_529970.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB18]
 gi|90103614|gb|ABD85651.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris
           BisB18]
          Length = 132

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 72/125 (57%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPH+Q YR   TM +SIVHR+TG  +Y GT ++ +W   +A G    ++++ 
Sbjct: 2   TARIERPLSPHMQAYRWSLTMALSIVHRLTGITLYFGTLLLAWWLIAVAAGPSAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + LF YTW+++HHML G+R+ IWD+           M    +I  ++  +++
Sbjct: 62  FTGSWIGRLMLFGYTWSLMHHMLSGVRHFIWDLGYGFTAAERESMTWAALIGGVVLTVLL 121

Query: 123 WIIKD 127
           WI+  
Sbjct: 122 WIVAF 126


>gi|157825304|ref|YP_001493024.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia akari
           str. Hartford]
 gi|157799262|gb|ABV74516.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia akari
           str. Hartford]
          Length = 124

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP+SPHL IY+   +  +SI+HRITG  ++    ++V+W        + L   +
Sbjct: 6   QEIYNKRPISPHLTIYKPQISSTLSILHRITGVALFFAVSILVWWLILSKYDNNYLQFAK 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   +++  +H+  GIR+L WD+      K         ++ S+L  ++
Sbjct: 66  CC----IIKICLVAVSYSWFYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVGSLLLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|239947122|ref|ZP_04698875.1| succinate dehydrogenase, cytochrome b556 subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921398|gb|EER21422.1| succinate dehydrogenase, cytochrome b556 subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 124

 Score =  140 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++ +W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFAVSILAWWLILSKYDNNYLQLAN 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K         ++ SIL  ++
Sbjct: 66  CC----IIKICLVAASYAWFYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|298293274|ref|YP_003695213.1| succinate dehydrogenase, cytochrome b556 subunit [Starkeya novella
           DSM 506]
 gi|296929785|gb|ADH90594.1| succinate dehydrogenase, cytochrome b556 subunit [Starkeya novella
           DSM 506]
          Length = 130

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 70/123 (56%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQIYR + TM +SIVHRITG  +Y GT ++V W    A+      ++      
Sbjct: 6   ERPLSPHLQIYRPMLTMMMSIVHRITGVALYFGTLLLVIWLVAAASSPAAFDTVNGLYGS 65

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            +  + L  Y+WA+IHH LGGIR+ IWD       +    MA+  I  SI   +++WII 
Sbjct: 66  WIGLLVLVGYSWALIHHALGGIRHFIWDTGAGFGPQAREWMARATIGGSIGLTVLLWIII 125

Query: 127 DIV 129
            +V
Sbjct: 126 WLV 128


>gi|254465461|ref|ZP_05078872.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium Y4I]
 gi|206686369|gb|EDZ46851.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium Y4I]
          Length = 127

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 63/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQ+YR   T   SI+ RITG+ + +   ++ +WF   A      ++    +
Sbjct: 6   RGNRPLSPHLQVYRPQLTSVTSILTRITGNALIVSALLIAWWFLAAATSADYFATANGLL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ + L    + +H L GIR+LIWD    L+ + A ++    +I S +  ++  I
Sbjct: 66  TSWFGDLVMTLSVLGLWYHTLAGIRHLIWDNGYMLELEQAEKLGWGVVIGSAVLTVLTTI 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|163738939|ref|ZP_02146352.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis BS107]
 gi|163741817|ref|ZP_02149207.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis 2.10]
 gi|161384990|gb|EDQ09369.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis 2.10]
 gi|161387744|gb|EDQ12100.1| succinate dehydrogenase, cytochrome b556 subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 127

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 64/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQ+YR   T   SI+ RITG+ + +   ++ +WF   A  E    +    M
Sbjct: 6   RGNRPLSPHLQVYRPQITSITSILTRITGNALIVSALLIAWWFLAAATSEDYFRTANAVM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ + L    + +H L G+R+LIWD    LD + A ++    II S++  ++  +
Sbjct: 66  TSWFGDIVMSLSVLGLWYHTLAGVRHLIWDNGKMLDLEPAQKLGWFVIIGSVVLTVLTLV 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|255261406|ref|ZP_05340748.1| succinate dehydrogenase, cytochrome b556 subunit [Thalassiobium sp.
           R2A62]
 gi|255103741|gb|EET46415.1| succinate dehydrogenase, cytochrome b556 subunit [Thalassiobium sp.
           R2A62]
          Length = 127

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 69/121 (57%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI  R+TG+ + +   ++V+WF   A G    ++   ++
Sbjct: 6   RGNRPLSPHLTIYRPQMTSMTSIFVRLTGNALLIAALMIVWWFVAAATGPEAFATADGFL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++  F  TWA+ +H+LGG+R+LIWD+   LD + A  M    II S+L  ++  I
Sbjct: 66  RSWFGDLVFFASTWAIWYHLLGGLRHLIWDMGYGLDLQSAYNMGYAMIIGSLLLTVLTVI 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|222150048|ref|YP_002551005.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           vitis S4]
 gi|221737030|gb|ACM37993.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium
           vitis S4]
          Length = 130

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 76/115 (66%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++   RPLSPHLQIY+L+PTM +SIVHRITG  +Y GT +V +W    + G      +
Sbjct: 1   MANVTKQRPLSPHLQIYKLVPTMLMSIVHRITGGALYFGTALVAWWLIAASTGADYYDWV 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
             +M   + ++ LF ++WA+IHHMLGG+R+  WD+   L+K   T++AK   +AS
Sbjct: 61  SWFMGTFIGKIILFGFSWALIHHMLGGMRHFAWDLGYGLEKHFNTKLAKATAVAS 115


>gi|218507957|ref|ZP_03505835.1| succinate dehydrogenase protein, cytochrome b subunit [Rhizobium
           etli Brasil 5]
          Length = 111

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 78/110 (70%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           M+++ NNRPLSPHLQ+Y+LIPTM +SIVHRITG  +Y+GT +V +W    A+G+ +    
Sbjct: 1   MANVTNNRPLSPHLQVYKLIPTMVMSIVHRITGGALYVGTLLVAWWLIAAASGQASYDWA 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKI 110
              +   + ++ L  YTWA++HHMLGG R+L+WD+    +K+++T++A  
Sbjct: 61  NWVLGSLLGKLVLLGYTWALLHHMLGGFRHLMWDLGYGFEKEVSTKLAIA 110


>gi|126725053|ref|ZP_01740896.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium HTCC2150]
 gi|126706217|gb|EBA05307.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacterales
           bacterium HTCC2150]
          Length = 139

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 58/121 (47%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHL IYR   T   SI  RITG+ + L   ++V+W    A G       R  +
Sbjct: 18  RGKRPLSPHLTIYRPQLTSMTSIFTRITGNAMLLAALMIVWWLLAAATGPGYYDLARTVI 77

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                 + + L  WA+ +H   G+R+L WD     + K A ++  + I  S +  ++  I
Sbjct: 78  TSWFGSLIMILSLWALWYHFCAGLRHLYWDTGRGFEIKQAERLGIMVIAGSFILTVLTLI 137

Query: 125 I 125
           +
Sbjct: 138 L 138


>gi|77464554|ref|YP_354058.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides 2.4.1]
 gi|126463394|ref|YP_001044508.1| succinate dehydrogenase, cytochrome b subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221640465|ref|YP_002526727.1| Succinate dehydrogenase subunit C [Rhodobacter sphaeroides KD131]
 gi|77388972|gb|ABA80157.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides 2.4.1]
 gi|126105058|gb|ABN77736.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161246|gb|ACM02226.1| Succinate dehydrogenase subunit C [Rhodobacter sphaeroides KD131]
          Length = 127

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 1/126 (0%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR+  T   SI  R+TG+ + +GT +V +W    A       +
Sbjct: 1   MAETKRVERPLSPHLQIYRVQLTSTTSIFTRLTGNGLIVGTMLVTWWLLAAALSPEQFET 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               +     ++ L L  WA+ +H L G+R+L WD    L+ K A ++    I  S++  
Sbjct: 61  ADWVLTSWFGDIVLLLSVWALWYHYLAGLRHLYWDTGKGLEIKTAEKLGMACIGGSLVLT 120

Query: 120 LIVWII 125
           L+  II
Sbjct: 121 LLTVII 126


>gi|332559447|ref|ZP_08413769.1| succinate dehydrogenase cytochrome b556 subunit [Rhodobacter
           sphaeroides WS8N]
 gi|332277159|gb|EGJ22474.1| succinate dehydrogenase cytochrome b556 subunit [Rhodobacter
           sphaeroides WS8N]
          Length = 127

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 1/126 (0%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR+  T   SI  R+TG+ + +GT +V +W    A       +
Sbjct: 1   MAETKRVERPLSPHLQIYRVQLTSTTSIFTRLTGNGLIVGTMLVTWWLLAAALSPEQFET 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               +     ++ L L  WA+ +H L G+R+L WD    L+ K A ++    I  S++  
Sbjct: 61  ADWVLTSWFGDIVLLLSVWALWYHYLAGLRHLYWDTGKGLEIKTAEKLGMACIGGSLVPT 120

Query: 120 LIVWII 125
           L+  II
Sbjct: 121 LLTVII 126


>gi|188583472|ref|YP_001926917.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           populi BJ001]
 gi|179346970|gb|ACB82382.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           populi BJ001]
          Length = 133

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/121 (39%), Positives = 71/121 (58%)

Query: 9   PLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSV 68
           PLSPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G     ++  +    +
Sbjct: 12  PLSPHLQIYRWTWTMAMSVFHRITGTALYGGTFLVAVWLVALASGPRAYDTVAWFFGSLI 71

Query: 69  FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDI 128
               LF YTW ++HHMLGGIR+ IWD     D+     +A+  +I S+   +++W I  +
Sbjct: 72  GRAILFAYTWVLMHHMLGGIRHFIWDAGYGFDRDRRLGLARATLIGSVTLTIVIWAIALL 131

Query: 129 V 129
           V
Sbjct: 132 V 132


>gi|197103676|ref|YP_002129053.1| succinate dehydrogenase cytochrome b-556 subunit [Phenylobacterium
           zucineum HLK1]
 gi|196477096|gb|ACG76624.1| succinate dehydrogenase cytochrome b-556 subunit [Phenylobacterium
           zucineum HLK1]
          Length = 129

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 63/126 (50%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +   RP SPH  I+R   TM  SI+HRITG  +Y G  +   W   +A G  T ++ +  
Sbjct: 1   MVRERPTSPHTTIWRWHLTMATSILHRITGVALYGGALIAAAWALSLAGGPETYAAFKGV 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           M   + ++ LF  T A  +H+  G+R+L WD+    D K A   A   I  ++   L VW
Sbjct: 61  MGSFLGKLALFGLTLAGFYHLGNGVRHLTWDLGHGFDLKSANASAVGVIAFAVAATLAVW 120

Query: 124 IIKDIV 129
           +I  + 
Sbjct: 121 VIAGMT 126


>gi|110678932|ref|YP_681939.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           denitrificans OCh 114]
 gi|109455048|gb|ABG31253.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           denitrificans OCh 114]
          Length = 127

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 64/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + + + +VV+WF   A      +     +
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNALLISSLLVVWWFLAAATSPEYFAVANGVL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ + L  W + +H L G+R+LIWD  + LD + A ++    I  S +  L+  I
Sbjct: 66  TSWFGDLVMTLSLWGLWYHTLAGVRHLIWDQGIGLDIETAYKLGYAVIGGSFVLTLLTII 125

Query: 125 I 125
           +
Sbjct: 126 L 126


>gi|157964193|ref|YP_001499017.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           massiliae MTU5]
 gi|157843969|gb|ABV84470.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           massiliae MTU5]
          Length = 124

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  CC----IIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|91974961|ref|YP_567620.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB5]
 gi|91681417|gb|ABE37719.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris
           BisB5]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 69/121 (57%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G  + ++L+ +   
Sbjct: 3   DRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWWLIACAAGPASYANLQAFTGS 62

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            +  + LF YTW+++HH+L G+R+ +WD+           +    +I  ++  ++ W+I 
Sbjct: 63  WIGRLILFGYTWSLMHHLLSGVRHFVWDLGYGFKTADREWLTWAALIGGVVLTVLFWVIA 122

Query: 127 D 127
            
Sbjct: 123 F 123


>gi|51473326|ref|YP_067083.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia typhi
           str. Wilmington]
 gi|81390260|sp|Q68XP1|DHSC_RICTY RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|51459638|gb|AAU03601.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia typhi
           str. Wilmington]
          Length = 124

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++V+W        + L   R
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNYLQLAR 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL  +++A  +H+  GIR+L WD+      +         ++ SIL  ++
Sbjct: 66  CC----IIKICLVAFSYAWCYHLCNGIRHLFWDIGYGFSIRAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|23011496|ref|ZP_00051838.1| COG2009: Succinate dehydrogenase/fumarate reductase, cytochrome b
           subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 134

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 73/121 (60%)

Query: 9   PLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSV 68
           PLSPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G     ++  +    +
Sbjct: 12  PLSPHLQIYRWTWTMAMSVFHRITGTALYGGTFLVAVWLVALASGPRAYDAVAWFFGSWI 71

Query: 69  FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDI 128
             + LF YTW ++HHMLGGIR+ IWD     D+     +A+  +I S++  +++W +  +
Sbjct: 72  GRLILFAYTWVLMHHMLGGIRHFIWDAGYGFDRDRRLGLARATLIGSVVLTVVIWALALL 131

Query: 129 V 129
           +
Sbjct: 132 L 132


>gi|300024743|ref|YP_003757354.1| succinate dehydrogenase, cytochrome b556 subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526564|gb|ADJ25033.1| succinate dehydrogenase, cytochrome b556 subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 137

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 68/120 (56%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           +  RPLSPHLQIY  +  M +SIVHRITG  +Y+G+ ++  W    A+G      +   +
Sbjct: 10  RPERPLSPHLQIYSPLINMMMSIVHRITGVALYVGSLLLAVWLLAAASGPDYYDYVAGLL 69

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ L  YTWA++HH+LGG+R+ IWD     D K    ++   +  S++   ++WI
Sbjct: 70  GSWPGKIVLLGYTWALMHHLLGGLRHFIWDTGRGYDLKTVDLLSWGTLAGSLVLTALIWI 129


>gi|67459555|ref|YP_247179.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia felis
           URRWXCal2]
 gi|75536045|sp|Q4UKC1|DHSC_RICFE RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|67005088|gb|AAY62014.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia felis
           URRWXCal2]
          Length = 124

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+L  +  +SI+HR+TG  ++    ++ +W        + L    
Sbjct: 6   QEIYNKRPTSPHLSIYKLQISSTLSILHRMTGVALFFAVSILAWWLILSKYDNNYLQFAN 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K         ++ SIL  ++
Sbjct: 66  CC----IIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|163853006|ref|YP_001641049.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens PA1]
 gi|218531816|ref|YP_002422632.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254562942|ref|YP_003070037.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens DM4]
 gi|163664611|gb|ABY31978.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens PA1]
 gi|218524119|gb|ACK84704.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254270220|emb|CAX26214.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens DM4]
          Length = 133

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/121 (38%), Positives = 70/121 (57%)

Query: 9   PLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSV 68
           PLSPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G     ++  +     
Sbjct: 12  PLSPHLQIYRWTWTMAMSVFHRITGTALYGGTFLVAVWLVALASGPRAYDTVAWFFGSWA 71

Query: 69  FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDI 128
               LF YTW ++HHMLGG+R+ IWD     D+     +A+  +I S+   +++W I  +
Sbjct: 72  GRAILFAYTWVLLHHMLGGLRHFIWDAGYGFDRDRRLGLARATLIGSVTLTIVIWAIALL 131

Query: 129 V 129
           V
Sbjct: 132 V 132


>gi|170746891|ref|YP_001753151.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653413|gb|ACB22468.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 133

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/121 (41%), Positives = 75/121 (61%)

Query: 9   PLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSV 68
           P+SPHLQIYR   TM +S+ HRITG+ +Y GT +V  W   +A+G    S +  +     
Sbjct: 12  PMSPHLQIYRWTWTMAMSVFHRITGTALYGGTALVAIWLVALASGPVGYSYVAGFFGSIF 71

Query: 69  FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDI 128
             + LF+YTW ++HHMLGGIR+LIWD  +  D+     MA++ +I S+   L++W +  +
Sbjct: 72  GRLILFVYTWILMHHMLGGIRHLIWDTGVGFDRDKRLSMARLTLIGSVALTLVIWAVALL 131

Query: 129 V 129
           V
Sbjct: 132 V 132


>gi|146276143|ref|YP_001166302.1| succinate dehydrogenase, cytochrome b subunit [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554384|gb|ABP68997.1| succinate dehydrogenase subunit C [Rhodobacter sphaeroides ATCC
           17025]
          Length = 127

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 60/116 (51%), Gaps = 1/116 (0%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR+  T   SI  RITG+ + +GT +V +W    A G    ++
Sbjct: 1   MAETKRVERPLSPHLQIYRVQLTSTTSIFTRITGNGLIVGTMLVTWWLLAAALGPEQFAT 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
               +     ++ L L  WA+ +H L G+R+L WD    L+   A ++    I  S
Sbjct: 61  ADAVLTSWFGDIVLLLSVWALWYHYLAGLRHLYWDTGKGLEITTAEKLGWACIGGS 116


>gi|15604003|ref|NP_220518.1| succinate dehydrogenase cytochrome B560 subunit (sdhC) [Rickettsia
           prowazekii str. Madrid E]
 gi|729336|sp|P41085|DHSC_RICPR RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|409934|gb|AAA18325.1| putative hydrophobic subunit of succinate dehydrogenase [Rickettsia
           prowazekii]
 gi|3860694|emb|CAA14595.1| SUCCINATE DEHYDROGENASE CYTOCHROME B560 SUBUNIT (sdhC) [Rickettsia
           prowazekii]
 gi|292571719|gb|ADE29634.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           prowazekii Rp22]
          Length = 124

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNYLQLAS 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL  ++++  +H+  GIR+L WD+      K         ++ SIL  ++
Sbjct: 66  CC----IIKICLVAFSYSWCYHLCNGIRHLFWDIGYGFSIKAVNITGWCVVVCSILLTML 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|163734150|ref|ZP_02141591.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           litoralis Och 149]
 gi|161392686|gb|EDQ17014.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter
           litoralis Och 149]
          Length = 127

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 66/121 (54%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL+IYR   T   SI+ RITG+ + + + +VV+WF   A    + +     +
Sbjct: 6   RGNRPLSPHLRIYRPQLTSITSILTRITGNALLISSLLVVWWFLAAATSPESFAVANGVL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                +V + L  W + +H L G+R+LIWD  + LD + A +M    I  S +  L+  I
Sbjct: 66  TSWFGDVVMTLSLWGLWYHTLAGVRHLIWDQGIGLDIETAYKMGYAVIGGSFVLTLLTII 125

Query: 125 I 125
           +
Sbjct: 126 L 126


>gi|83953490|ref|ZP_00962212.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           NAS-14.1]
 gi|83842458|gb|EAP81626.1| succinate dehydrogenase, cytochrome b556 subunit [Sulfitobacter sp.
           NAS-14.1]
          Length = 127

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/112 (33%), Positives = 58/112 (51%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A           ++
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMTSILTRITGNAMLVAALLIVWWFLAAATSAEYFDIANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASI 116
                ++ +FL    + +H L GIR+LIWD    LD   A ++    +I S+
Sbjct: 66  TSWFGDLVMFLSLLGLWYHTLAGIRHLIWDNGYALDIPTAEKLGWAALIGSV 117


>gi|240140347|ref|YP_002964826.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens AM1]
 gi|27902656|gb|AAO24619.1| succinate dehydrogenase gamma subunit [Methylobacterium extorquens]
 gi|240010323|gb|ACS41549.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           extorquens AM1]
          Length = 133

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/121 (38%), Positives = 70/121 (57%)

Query: 9   PLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSV 68
           PLSPHLQIYR   TM +S+ HR+TG+ +Y GT +V  W   +A+G     ++  +     
Sbjct: 12  PLSPHLQIYRWTWTMAMSVFHRVTGTALYGGTFLVAVWLVALASGPRAYDTVAWFFGSWA 71

Query: 69  FEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDI 128
               LF YTW ++HHMLGG+R+ IWD     D+     +A+  +I SI   +++W I  +
Sbjct: 72  GRAILFAYTWVLLHHMLGGLRHFIWDAGYGFDRDRRLGLARATLIGSITLTIVIWAIALL 131

Query: 129 V 129
           V
Sbjct: 132 V 132


>gi|158425367|ref|YP_001526659.1| succinate dehydrogenase cytochrome b-556 subunit [Azorhizobium
           caulinodans ORS 571]
 gi|158332256|dbj|BAF89741.1| succinate dehydrogenase cytochrome b-556 subunit [Azorhizobium
           caulinodans ORS 571]
          Length = 133

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/119 (42%), Positives = 71/119 (59%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR +PTM +SIVHR TG  +Y GT ++++W    A+               
Sbjct: 10  RPLSPHLQIYRPLPTMVMSIVHRATGIALYFGTVLLIWWLLAAASTPSAYGLFTSIAGSW 69

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           +  + LF YTWA+IHH LGGIR+LIWD       +    +AK+ ++ S+   +IVW+I 
Sbjct: 70  IGRLVLFGYTWALIHHALGGIRHLIWDTIRGFGAQERVLLAKLTLVGSVTLTIIVWVIG 128


>gi|163796399|ref|ZP_02190359.1| succinate dehydrogenase, cytochrome b subunit [alpha
           proteobacterium BAL199]
 gi|159178249|gb|EDP62793.1| succinate dehydrogenase, cytochrome b subunit [alpha
           proteobacterium BAL199]
          Length = 128

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQIY+   T  +SI HR TG  +  G  ++ +W    A G  + + ++ ++  
Sbjct: 5   RRPLSPHLQIYKPQLTSVLSISHRATGVGLAAGLLLLTWWLLAAAAGPDSFAVVQDFLGS 64

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            +  + LF +++A++ H+  G+R+L WD     +     +     +IAS+   ++ W I 
Sbjct: 65  WLGYLILFGFSYALMFHLCNGVRHLFWDAGWGFELDTVYKSGWAVVIASVALTVLAWAIA 124

Query: 127 DI 128
            +
Sbjct: 125 IV 126


>gi|88812336|ref|ZP_01127586.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Nitrococcus mobilis Nb-231]
 gi|88790343|gb|EAR21460.1| Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
           [Nitrococcus mobilis Nb-231]
          Length = 126

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 70/120 (58%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
           +RPLSPHLQIYR   T+  SI HRITG+++ LGT  V +W   +A+G    ++ R +   
Sbjct: 5   DRPLSPHLQIYRFPTTVITSITHRITGALLALGTLGVTYWLIALASGPQVYAAARAFFGN 64

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
              ++ LF +T+A+ +H+  GIR+L W +    + + A + A    +A+ +  +I W+  
Sbjct: 65  GFVQLILFFWTYALFYHLCNGIRHLGWAIDYGFELERARKSAVAVFVAAGILTVITWLFA 124


>gi|56695273|ref|YP_165621.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria pomeroyi
           DSS-3]
 gi|56677010|gb|AAV93676.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria pomeroyi
           DSS-3]
          Length = 128

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 65/121 (53%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ +     ++V+WF   A      +     +
Sbjct: 6   RGNRPLSPHLSIYRPQLTSITSILTRITGNALLFAALLIVWWFLAAATSPEYFAVADGVI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ + L  W + +H L GIR+LIWD +L LD   A ++    +I S+L  ++  +
Sbjct: 66  TSLIGDLVMALSLWGLWYHTLAGIRHLIWDNALGLDLPTAEKLGWAVVIGSVLLTILTLV 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|15892091|ref|NP_359805.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           conorii str. Malish 7]
 gi|229586366|ref|YP_002844867.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           africae ESF-5]
 gi|21362479|sp|Q92J99|DHSC_RICCN RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|15619214|gb|AAL02706.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           conorii str. Malish 7]
 gi|228021416|gb|ACP53124.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           africae ESF-5]
          Length = 124

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  CC----IIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|34580878|ref|ZP_00142358.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           sibirica 246]
 gi|28262263|gb|EAA25767.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           sibirica 246]
          Length = 124

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSQYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  CC----IIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|260431521|ref|ZP_05785492.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415349|gb|EEX08608.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 128

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A      ++    +
Sbjct: 6   RGNRPLSPHLSIYRPQLTSVTSILTRITGNAMLVAALLIVWWFLAAATSPEAYATANAVI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ + L  W + +H L GIR+LIWD ++ LD   A ++    +I S++  L+  +
Sbjct: 66  TSLLGDLVMALSLWGLWYHTLAGIRHLIWDSAVGLDLPTAYKLGWAVVIGSVVLTLVTLL 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|220926986|ref|YP_002502288.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951593|gb|ACL61985.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 133

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 73/121 (60%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR   TM +S+ HR+TG  +Y GT +V  W   +A+G+     +       
Sbjct: 11  RPLSPHLQIYRWTWTMAMSVAHRLTGIALYGGTALVAIWLVALASGKAAYDPVAWLYGSI 70

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKD 127
           +  + +F+YTW ++HHMLGGIR+L+WD    ++      MAK  ++ S++  L++W +  
Sbjct: 71  LGRLVIFVYTWILMHHMLGGIRHLVWDFGYGMEPGTRIAMAKYTLVGSVVLTLVIWAVAL 130

Query: 128 I 128
           +
Sbjct: 131 L 131


>gi|254437963|ref|ZP_05051457.1| succinate dehydrogenase, cytochrome b556 subunit [Octadecabacter
           antarcticus 307]
 gi|198253409|gb|EDY77723.1| succinate dehydrogenase, cytochrome b556 subunit [Octadecabacter
           antarcticus 307]
          Length = 127

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 68/121 (56%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           ++ RPLSPHL IYR   T   SI  R+TG+ + +G  ++V+WF  +A+G    +    +M
Sbjct: 6   RDKRPLSPHLTIYRPQWTSMTSIFTRLTGNALIVGALLIVWWFAALASGPEAYARANGFM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ +F    A+ +H L G+R+LIWD    LD + + +  ++ I+ S+L  +   I
Sbjct: 66  TSWFGDLIMFGSVAALWYHSLAGVRHLIWDSGHMLDVQSSERAGQLIILVSVLLTIFTVI 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|288957014|ref|YP_003447355.1| succinate dehydrogenase cytochrome b-556 subunit [Azospirillum sp.
           B510]
 gi|288909322|dbj|BAI70811.1| succinate dehydrogenase cytochrome b-556 subunit [Azospirillum sp.
           B510]
          Length = 142

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 70/124 (56%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
           + RPLSPHLQ+Y+L  T  +SI HRITG  + +GT ++V+W    A G    +  + ++ 
Sbjct: 18  SGRPLSPHLQVYKLPLTAVMSITHRITGVGLAVGTLLLVWWLVAAAAGPEAFARAQGFIG 77

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
                + +F ++ A+ +H+  GIR+L+WD     +   A +  +I +IA+    ++ WI+
Sbjct: 78  SFFGLLLMFGWSAALYYHLCNGIRHLVWDAGKSFELTDADRNNRIVLIATAALTVLTWIV 137

Query: 126 KDIV 129
              V
Sbjct: 138 GLAV 141


>gi|163869248|ref|YP_001610504.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           tribocorum CIP 105476]
 gi|161018951|emb|CAK02509.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           tribocorum CIP 105476]
          Length = 133

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/125 (40%), Positives = 69/125 (55%), Gaps = 1/125 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP SPH+ IYR   TM +SI HRITG  +Y+GT     W   IA GE T  ++     
Sbjct: 8   KERPRSPHISIYRWTITMAMSIAHRITGMALYVGTVFFAVWLIAIACGEETFRTVHEIYS 67

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVWI 124
                  LFLYT A +HHM+GG+R+++WD+  C L K+ AT  A   +  S++    +WI
Sbjct: 68  SWFGLCILFLYTLAGVHHMVGGVRHIVWDLKPCLLAKEKATATAWATVFISLIVTFAIWI 127

Query: 125 IKDIV 129
           I   V
Sbjct: 128 IGYTV 132


>gi|157828041|ref|YP_001494283.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165932739|ref|YP_001649528.1| succinate dehydrogenase cytochrome b556 subunit [Rickettsia
           rickettsii str. Iowa]
 gi|157800522|gb|ABV75775.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165907826|gb|ABY72122.1| succinate dehydrogenase cytochrome b556 subunit [Rickettsia
           rickettsii str. Iowa]
          Length = 124

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+      K+        ++ S+L  ++
Sbjct: 66  CC----IIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVLGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|85706758|ref|ZP_01037850.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           217]
 gi|85668816|gb|EAQ23685.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           217]
          Length = 127

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 66/126 (52%), Gaps = 1/126 (0%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR   T   SI+ RITG+ + +   ++V+W    +  ++  + 
Sbjct: 1   MAETKQVERPLSPHLQIYRPQLTSITSILTRITGNALVVAAALIVWWLLAASTSDNYFAM 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               +     ++ L L  WAV +H L G+R+L +D    +D   A ++    II S++  
Sbjct: 61  ADAVLTSWFGDLVLTLSLWAVWYHYLAGLRHLYFDAGKGMDIPTAEKLGWACIIGSVVLS 120

Query: 120 LIVWII 125
           +I  ++
Sbjct: 121 VITLLL 126


>gi|170729589|ref|YP_001775022.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           M12]
 gi|167964382|gb|ACA11392.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           M12]
          Length = 151

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 58/124 (46%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           +SS    RPLSPHLQIYR    M  SI+HR TG  + LG  V+      +  G       
Sbjct: 19  LSSPPRERPLSPHLQIYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGAEPWDYF 78

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           R  ++    +  L ++TW   +H+  GIR++  D           + +  +++ SI+   
Sbjct: 79  RSCLNLWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITA 138

Query: 121 IVWI 124
            VW+
Sbjct: 139 GVWV 142


>gi|149201370|ref|ZP_01878345.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           TM1035]
 gi|149145703|gb|EDM33729.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           TM1035]
          Length = 127

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 1/126 (0%)

Query: 1   MSSIKN-NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+  K   RPLSPHLQIYR   T   SI+ RITG+ + +   ++V+W    +  +   + 
Sbjct: 1   MAETKPVERPLSPHLQIYRPQLTSITSILTRITGNALIVAALLIVWWLLAASTSDAYFAM 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               +     ++ L L  WAV +H L G+R+L +D    +D   A ++    II S++  
Sbjct: 61  ADAVLTSWFGDLVLSLSAWAVWYHYLAGLRHLYFDAGKGMDIPTAEKLGWGCIIGSVVLT 120

Query: 120 LIVWII 125
           +I  ++
Sbjct: 121 VITLLL 126


>gi|163744267|ref|ZP_02151627.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanibulbus
           indolifex HEL-45]
 gi|161381085|gb|EDQ05494.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanibulbus
           indolifex HEL-45]
          Length = 127

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 62/121 (51%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPH+ IYR   T   SI+ RITG+ + +   ++V+WF   A       ++   M
Sbjct: 6   RGNRPLSPHMTIYRPQLTSMTSILTRITGNAMLITALLIVWWFLAAATSVEYFDTVNGIM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++   L    + +H L GIR+LIWD    LD   A ++    +I S++  ++  I
Sbjct: 66  TSWFGDLVFTLSLLGLWYHTLAGIRHLIWDTGRMLDVPTAEKLGIAALIGSVVLTVLTVI 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|89053302|ref|YP_508753.1| succinate dehydrogenase subunit C [Jannaschia sp. CCS1]
 gi|88862851|gb|ABD53728.1| succinate dehydrogenase subunit C [Jannaschia sp. CCS1]
          Length = 127

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 66/120 (55%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IY+       SI+ RITG+ + +   +VV+W    A+G    +++  ++
Sbjct: 6   RGNRPLSPHLTIYKPQLNSITSILVRITGNAMLVSAVLVVWWLMAAASGPEYFATVDGWV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ + L    + +H LGG+R+LIWD    LD   + +M    +I S++  ++  I
Sbjct: 66  TSVLGDIVMSLSVLGLWYHALGGLRHLIWDAGYGLDADTSDKMGWGMLIGSVVLTVLTLI 125


>gi|114769286|ref|ZP_01446912.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HTCC2255]
 gi|114550203|gb|EAU53084.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HTCC2255]
          Length = 131

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 63/121 (52%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             +K NRPLSPHL IYR   +   SI+ RITG  + LG  +++ W    +   +    + 
Sbjct: 3   KRVKGNRPLSPHLTIYRPQMSSISSILVRITGVSLALGFILIITWLLAASTNVYYFDCIN 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             +      + L    WA+ +H LGGIR+LIWD+    D KIA ++  + II S +  + 
Sbjct: 63  SILTSWFGIIVLIGSVWALCYHSLGGIRHLIWDMGFGFDLKIADRLGWMVIIGSFVLTIF 122

Query: 122 V 122
           V
Sbjct: 123 V 123


>gi|258541135|ref|YP_003186568.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632213|dbj|BAH98188.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635270|dbj|BAI01239.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638325|dbj|BAI04287.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641379|dbj|BAI07334.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644434|dbj|BAI10382.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647489|dbj|BAI13430.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650542|dbj|BAI16476.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653533|dbj|BAI19460.1| succinate dehydrogenase cytochrome b subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 157

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ+YR   +M +SI++RITG +   G  + VFW    A G    ++ R     
Sbjct: 20  QRPMSPHLQVYRYRLSMVLSIMNRITGVIATAGATLGVFWLGAAAKGPKAFATARKVTGN 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII--ASILTVLIVWI 124
            + ++ L  +  +VI+H +GGIR+LIWD     DKK   +   + +   A + TVL   +
Sbjct: 80  PLGQLVLLGWLASVIYHTVGGIRHLIWDSGYRYDKKEVNKDGPVAVGVTAGVSTVLAAGL 139

Query: 125 IK 126
           + 
Sbjct: 140 LA 141


>gi|240851320|ref|YP_002972723.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           grahamii as4aup]
 gi|240268443|gb|ACS52031.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           grahamii as4aup]
          Length = 133

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 70/125 (56%), Gaps = 1/125 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP SPH+ IYR   TM +SI HR+TG  +Y+G   +  W   IA GE T  ++     
Sbjct: 8   KERPRSPHISIYRWTITMAMSIAHRVTGMALYVGMVFLAVWLIAIACGEETFRTVHEIYS 67

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVWI 124
                  LFLYT A +HHM+GGIR+++WD+  C L K+ AT  A   +  S++   ++WI
Sbjct: 68  SWFGLCILFLYTLAGVHHMVGGIRHIVWDMMPCLLAKEKATVTAWATVFISLIVTFVIWI 127

Query: 125 IKDIV 129
           I   V
Sbjct: 128 IGYSV 132


>gi|329114746|ref|ZP_08243503.1| Succinate dehydrogenase cytochrome b556 subunit [Acetobacter
           pomorum DM001]
 gi|326695877|gb|EGE47561.1| Succinate dehydrogenase cytochrome b556 subunit [Acetobacter
           pomorum DM001]
          Length = 157

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHLQ+YR   +M +SI++RITG +   G  + VFW    A G    ++ R     
Sbjct: 20  QRPMSPHLQVYRYRLSMVLSIMNRITGVIATAGATLGVFWLGAAAKGPKAFATARKVTGN 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII--ASILTVLIVWI 124
            + ++ L  +  +VI+H +GGIR+LIWD     DKK   +   + +   A + TVL   +
Sbjct: 80  PLGQLVLVGWLASVIYHTVGGIRHLIWDSGYRYDKKEVNKDGPVAVGVTAGVSTVLAAGL 139

Query: 125 IK 126
           + 
Sbjct: 140 LA 141


>gi|110635575|ref|YP_675783.1| succinate dehydrogenase subunit C [Mesorhizobium sp. BNC1]
 gi|110286559|gb|ABG64618.1| succinate dehydrogenase subunit C [Chelativorans sp. BNC1]
          Length = 134

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 72/122 (59%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            S    RPLSPHLQIYR  PTM +SI HRITG+ +Y G  +   W    A+       + 
Sbjct: 3   KSTTQARPLSPHLQIYRFTPTMAMSIAHRITGTALYFGILLFALWLLAAASSREQFDFVN 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
                 +  + +F Y+W +IHHMLGGIR+LIWD    L+K+ + ++A  N+I SIL  LI
Sbjct: 63  GLFGSIIGRIVIFGYSWVLIHHMLGGIRHLIWDTIHGLEKETSRRLAIANLIGSILVTLI 122

Query: 122 VW 123
           +W
Sbjct: 123 IW 124


>gi|238650698|ref|YP_002916551.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           peacockii str. Rustic]
 gi|238624796|gb|ACR47502.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           peacockii str. Rustic]
          Length = 124

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI++R+TG  ++    ++V+W        + L    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSKYDNNYLQLAE 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     + ++CL   ++A  +H+  GIR+L WD+       +        ++ S+L  ++
Sbjct: 66  CC----IIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSITLVNITCWCVVVGSVLLTVL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|315122380|ref|YP_004062869.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495782|gb|ADR52381.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 129

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 83/128 (64%), Positives = 101/128 (78%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K+NRPLSPHLQIY+LIPTM +SIVHRITGS VY GTP +V WFF +A G++TL   
Sbjct: 1   MSDLKSNRPLSPHLQIYKLIPTMLISIVHRITGSAVYFGTPALVLWFFAVAEGKYTLGLW 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           R Y D   F + LFLYTW+ IHHMLGGIRYL+WD S  L+KK++  MAKINIIASI  V 
Sbjct: 61  RSYTDCGFFSIFLFLYTWSAIHHMLGGIRYLMWDSSFLLEKKVSITMAKINIIASIFIVS 120

Query: 121 IVWIIKDI 128
           ++WI+K+I
Sbjct: 121 VIWIVKNI 128


>gi|170744094|ref|YP_001772749.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           sp. 4-46]
 gi|168198368|gb|ACA20315.1| succinate dehydrogenase, cytochrome b556 subunit [Methylobacterium
           sp. 4-46]
          Length = 133

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 71/121 (58%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR   TM +S+ HR+TG  +Y GT +V  W   +A+G+     +       
Sbjct: 11  RPLSPHLQIYRWTWTMAMSVAHRLTGIALYGGTALVAVWLVALASGKAAYDPVAWLYGSI 70

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKD 127
           +  + +F+YTW ++HHMLGGIR+LIWD    ++      MA+  ++ S +  +++W    
Sbjct: 71  LGRLVIFVYTWILMHHMLGGIRHLIWDFGHGMEPGTRIAMARYTLVGSAVLTVVIWAAAL 130

Query: 128 I 128
           +
Sbjct: 131 L 131


>gi|28198267|ref|NP_778581.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           Temecula1]
 gi|28056337|gb|AAO28230.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           Temecula1]
          Length = 142

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 54/119 (45%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI+HR TG  + LG  V+      +  G       R  +
Sbjct: 14  TRERPLSPHLQVYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGPEPWDYFRSCL 73

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +    +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW
Sbjct: 74  NLWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITAGVW 132


>gi|319899436|ref|YP_004159533.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           clarridgeiae 73]
 gi|319403404|emb|CBI76972.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           clarridgeiae 73]
          Length = 152

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++   +RP SPHL IYR   TM +SI HRITG ++Y G   +  W   IA G +    + 
Sbjct: 23  TTTTKDRPRSPHLSIYRWSITMAISIAHRITGVMLYFGMLFLALWLVSIACGANAFRMIN 82

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSL-CLDKKIATQMAKINIIASILTVL 120
              +       LF YT A +HHM+G IR+++W+++  CL K+ AT  A   +  S++  +
Sbjct: 83  QIYESLPGLCLLFFYTLAGVHHMVGCIRHIVWNMNPCCLAKEKATSTAWATVFISLIVTI 142

Query: 121 IVWIIKDIV 129
            +WII   V
Sbjct: 143 AIWIIGYGV 151


>gi|319407790|emb|CBI81441.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           sp. 1-1C]
          Length = 152

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/129 (34%), Positives = 69/129 (53%), Gaps = 1/129 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++   +RP SPHL +YR   TM +SI HRITG V+Y G   +  W   IA G      + 
Sbjct: 23  TTRTKDRPRSPHLSVYRWSITMAISIAHRITGIVLYFGMCFLALWLVSIACGPDAFKMVN 82

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVL 120
                 +    LF YT A +HHM+G +R+++W+++   L K+ AT  A   +  S++  +
Sbjct: 83  KIYGSFLGLCLLFFYTLAGVHHMVGCVRHIVWNLNPRYLAKEKATLTAWATVFISLIVTI 142

Query: 121 IVWIIKDIV 129
            +WII   V
Sbjct: 143 ALWIIGYGV 151


>gi|316931809|ref|YP_004106791.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris DX-1]
 gi|315599523|gb|ADU42058.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 132

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 70/125 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G    ++++ 
Sbjct: 2   TARIERPLSPHMQAYRWSLTMTMSIVHRATGIALYSGTLLLAWWLIACAAGPAAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + +F YTWA++HH+L G+R+ +WD+           +    +I  I+  +++
Sbjct: 62  FTGSWIGRLIVFGYTWALMHHLLSGVRHFVWDLGYGFKTADREWLTWAALIGGIVLTVLL 121

Query: 123 WIIKD 127
           W+I  
Sbjct: 122 WVIAY 126


>gi|15837672|ref|NP_298360.1| succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
 gi|9106017|gb|AAF83880.1|AE003943_11 succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
          Length = 142

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 56/120 (46%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI+HR TG  + LG  V+      +  G  T    R  +
Sbjct: 14  TRERPLSPHLQVYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGAATWDYFRSCL 73

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           +    +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW+
Sbjct: 74  NLWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFVRSSWASVLGSIVITAGVWV 133


>gi|86747453|ref|YP_483949.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris HaA2]
 gi|86570481|gb|ABD05038.1| succinate dehydrogenase subunit C [Rhodopseudomonas palustris HaA2]
          Length = 132

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 71/125 (56%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + + +RPLSPH+Q YR   TM +SIVHR TG  +Y GT ++ +W    A G    ++++ 
Sbjct: 2   TARIDRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWWLIACAAGPAAYANVQA 61

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           +    +  + LF YTWA++HH+L G+R+ +WD+           +    +I  I+  +++
Sbjct: 62  FTGSWIGRLILFGYTWALMHHLLSGVRHFVWDLGYGFKTADREWLTWAALIGGIVLTVLL 121

Query: 123 WIIKD 127
           W++  
Sbjct: 122 WVVAF 126


>gi|194365313|ref|YP_002027923.1| succinate dehydrogenase, cytochrome b556 subunit [Stenotrophomonas
           maltophilia R551-3]
 gi|194348117|gb|ACF51240.1| succinate dehydrogenase, cytochrome b556 subunit [Stenotrophomonas
           maltophilia R551-3]
          Length = 130

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 61/120 (50%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI+HR TG  + +G  ++      +  G  + +    + 
Sbjct: 3   TRQRPLSPHLQVYRWQIQMATSILHRATGVFLSVGALIIAAGLLALMMGPDSWNCFTGHA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                 V LF +TW+  +H+  GIR+++ D ++        + + +++I S++  L+VW 
Sbjct: 63  GAWYGRVFLFAWTWSFAYHLCNGIRHVVQDFAIGFSIPAFIRSSWLSVIGSLVITLLVWA 122


>gi|71899418|ref|ZP_00681577.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|71730827|gb|EAO32899.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
          Length = 142

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 55/120 (45%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQIYR    M  SI+HR TG  + LG  V+      +  G       R  +
Sbjct: 14  TRERPLSPHLQIYRWQMQMLTSILHRATGVFLSLGVLVIAAGLLALMFGAEPWDYFRSCL 73

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           +    +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW+
Sbjct: 74  NLWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITAGVWV 133


>gi|190573776|ref|YP_001971621.1| putative succinate dehydrogenase cytochrome b-556 subunit
           [Stenotrophomonas maltophilia K279a]
 gi|190011698|emb|CAQ45317.1| putative succinate dehydrogenase cytochrome b-556 subunit
           [Stenotrophomonas maltophilia K279a]
          Length = 130

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 60/120 (50%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI+HR TG  + +G  ++      +  G  + +    + 
Sbjct: 3   TRQRPLSPHLQVYRWQIQMATSILHRATGVFLSVGALIIAAGLLALMMGPESWNCFTGHA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                 V LF +TW+  +H+  GIR+++ D ++        + + +++  S++  L+VW 
Sbjct: 63  GAWYGRVFLFAWTWSFAYHLCNGIRHVVQDFAIGFSIPAFIRSSWLSVTGSLVITLLVWA 122


>gi|182680904|ref|YP_001829064.1| succinate dehydrogenase, cytochrome b556 subunit [Xylella
           fastidiosa M23]
 gi|182631014|gb|ACB91790.1| succinate dehydrogenase, cytochrome b556 subunit [Xylella
           fastidiosa M23]
          Length = 131

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 54/119 (45%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI+HR TG  + LG  V+      +  G       R  +
Sbjct: 3   TRERPLSPHLQVYRWQMQMVTSILHRATGVFLSLGVLVIAAGLLALMFGPEPWDYFRSCL 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +    +  L ++TW   +H+  GIR++  D           + +  +++ SI+    VW
Sbjct: 63  NLWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLRSSWASVLGSIVITAGVW 121


>gi|319404830|emb|CBI78431.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 152

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 1/129 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++   +RP SPHL +YR   TM +SI HRITG V+Y G   +  W   IA G  T   + 
Sbjct: 23  TTTTKDRPRSPHLSVYRWSITMAISIAHRITGIVLYFGMCFLALWLVSIACGADTFKMVN 82

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVL 120
                      LF YT A +HH++G +R+++W+++   L K+ AT  A   +  S++  +
Sbjct: 83  KIYGSFPGLCFLFFYTLAGVHHIVGCVRHIVWNLNPRYLAKEKATSTAWATVFISLIVTI 142

Query: 121 IVWIIKDIV 129
            +W+I   V
Sbjct: 143 ALWVIGYGV 151


>gi|319406315|emb|CBI79952.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           sp. AR 15-3]
          Length = 133

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 1/129 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           ++   +RP SPHL +YR   TM +SI HRITG V+Y G   +  W   IA G  T   + 
Sbjct: 4   TTTTKDRPRSPHLSVYRWSITMAISIAHRITGIVLYFGMCFLALWLVSIACGADTFKMVN 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVS-LCLDKKIATQMAKINIIASILTVL 120
                      LF YT A +HHM+G IR+++W+++  CL K+ AT  A   +  S++  +
Sbjct: 64  QIYRSFPGLCLLFFYTLAGVHHMVGCIRHIVWNMNPRCLAKEKATSTAWATVFISLIVTI 123

Query: 121 IVWIIKDIV 129
            +WII   V
Sbjct: 124 AIWIIGYGV 132


>gi|259415023|ref|ZP_05738945.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter sp.
           TrichCH4B]
 gi|259348933|gb|EEW60687.1| succinate dehydrogenase, cytochrome b556 subunit [Silicibacter sp.
           TrichCH4B]
          Length = 127

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 63/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG        +VV+W    A  E   + +   M
Sbjct: 6   RGNRPLSPHLTIYRPQLTSMSSIMVRITGIAALGVALLVVWWLLAAATSESAFAFIDGLM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ +    WA+ +HMLG +R+++WD   CL+ + + ++     I + +  ++  I
Sbjct: 66  RSWLGDLVMLGAAWAIFYHMLGRLRHVVWDFGYCLEVETSEKLGIGMFIGATVLTVLAAI 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|144898837|emb|CAM75701.1| succinate dehydrogenase cytochrome b556 subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 138

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 65/122 (53%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
             NRPLSPHL +YRL     +SI HRITG  + +G   + +W    A+G    +  +   
Sbjct: 15  TRNRPLSPHLDVYRLPLLAIMSITHRITGVGLAIGMFALAWWLCAAASGPAEFAVAQAVF 74

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              + ++ LF +T A+  H+  GIR+L+WD     +   A   AK+ + A+++  +I WI
Sbjct: 75  GSFLGKLFLFGWTVALFFHLSHGIRHLLWDSGWGFEIPQAYLSAKVALGATVVLTVIAWI 134

Query: 125 IK 126
           I 
Sbjct: 135 IG 136


>gi|319409393|emb|CBI83037.1| SdhC succinate dehydrogenase cytochrome b-556 subunit [Bartonella
           schoenbuchensis R1]
          Length = 133

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/123 (37%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP SPHL IYR   TM +SI HRITG  +Y G      W   IA G  T  ++     
Sbjct: 8   KDRPYSPHLSIYRWSITMAMSIAHRITGVALYFGMICFAIWLGAIACGSDTFKTVNGIYG 67

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVWI 124
                  LFL+T A +HHM+G IR+L+W++  C L K+ AT  A   +  +++    +W+
Sbjct: 68  SFPGLCVLFLFTLAGVHHMVGCIRHLVWNMKPCLLAKEKATATAWATVFITLIVTCAIWV 127

Query: 125 IKD 127
           I  
Sbjct: 128 IGY 130


>gi|119385745|ref|YP_916800.1| succinate dehydrogenase, cytochrome b subunit [Paracoccus
           denitrificans PD1222]
 gi|119376340|gb|ABL71104.1| succinate dehydrogenase subunit C [Paracoccus denitrificans PD1222]
          Length = 125

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 57/120 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP SP++Q YR   T  +S  HR++G    LG   +  W    A+G+    S +  
Sbjct: 1   MSHRRPKSPNMQNYRPQLTSVLSFGHRLSGVAQSLGALGLAAWLMAGASGQDAFGSAQAL 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +      + LFL T A+ +H+  G+R+L+WD     + +         +  S++  L +W
Sbjct: 61  LLSVPGRIALFLVTLALFYHLCNGVRHLVWDSGRGFELRAIYAGGWTVVGTSLILTLALW 120


>gi|304320539|ref|YP_003854182.1| succinate dehydrogenase cytochrome B-556 subunit [Parvularcula
           bermudensis HTCC2503]
 gi|303299441|gb|ADM09040.1| succinate dehydrogenase cytochrome B-556 subunit [Parvularcula
           bermudensis HTCC2503]
          Length = 142

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/125 (36%), Positives = 69/125 (55%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
             +RPLSPHLQI+R   TM  SI+HR TG  +Y G+ ++V W    A  E     +  ++
Sbjct: 16  TGDRPLSPHLQIWRWSVTMATSILHRATGIALYAGSVLLVLWLLGGALTEGFYDGVTGFL 75

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                 + L  +TWA + H+  GI+YLIWD    L +++A + A   +IAS +   +VW+
Sbjct: 76  GSPFGILILVGFTWAQMFHLSNGIKYLIWDSGRLLQREVAKKTAWGVLIASFVLTALVWL 135

Query: 125 IKDIV 129
           +   V
Sbjct: 136 VALSV 140


>gi|325920388|ref|ZP_08182319.1| succinate dehydrogenase subunit C [Xanthomonas gardneri ATCC 19865]
 gi|325549135|gb|EGD20058.1| succinate dehydrogenase subunit C [Xanthomonas gardneri ATCC 19865]
          Length = 130

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 57/119 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI+HR TG ++  G  V+      +  G+   + L   + 
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILHRATGIILSGGALVIAAALLVLMLGQDHWTCLTQQLG 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               ++ LF +TWA  +H+  GIR+++ D           +    +++ S+L    +W 
Sbjct: 64  AWYGQLFLFGWTWAFAYHLSNGIRHIVQDFGYGYSIPAFVRSGWASVVVSLLITAAIWA 122


>gi|86138977|ref|ZP_01057548.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           MED193]
 gi|85824208|gb|EAQ44412.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           MED193]
          Length = 127

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 57/111 (51%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+W    A      ++    M
Sbjct: 6   RGNRPLSPHLSIYRPQMTSLSSILTRITGNALIISVMLIVWWLLAAATSPAYFATANGVM 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
                ++ L L T  + +H L G+R+L +D    LD + A ++    +I S
Sbjct: 66  TSWFGDIVLALSTLGIWYHFLAGLRHLYFDAGHGLDIETAEKLGWGMMIGS 116


>gi|157803312|ref|YP_001491861.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           canadensis str. McKiel]
 gi|157784575|gb|ABV73076.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia
           canadensis str. McKiel]
          Length = 124

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP+SPHL IY++  +  +SI+HRITG  ++    ++ +W        + L    
Sbjct: 6   QEIYNKRPISPHLSIYKMQISSTLSILHRITGVALFFAVSILAWWLILSKYDNNYLYLAS 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           CY    + ++CL   ++A  +H+  GIRYL W +  C   K         +I S L  ++
Sbjct: 66  CY----IIKICLVAVSYAWFYHLCNGIRYLFWAIGYCFSIKAVNITGWCVVICSTLLTIL 121

Query: 122 VWI 124
           +W+
Sbjct: 122 LWV 124


>gi|89068123|ref|ZP_01155540.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           granulosus HTCC2516]
 gi|89046362|gb|EAR52419.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           granulosus HTCC2516]
          Length = 127

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 64/120 (53%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL ++R       SI+ RITG+ + +   ++V+WF  +A G    +    ++
Sbjct: 6   RGNRPLSPHLTVWRWSLPAISSILTRITGNALIVAALMIVWWFVALATGPEAYARANGFI 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ +FL   AV +H+  G+R+LIWD    LD   +   A   +IAS+L  +   I
Sbjct: 66  TSWFGDLVMFLSVLAVWYHLFAGVRHLIWDQGYMLDVSSSETYATAAMIASVLLTIFTAI 125


>gi|312112888|ref|YP_004010484.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218017|gb|ADP69385.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 148

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 67/117 (57%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            +P+SPHL IYR    M +SI+HR+TG   Y G+ ++  W    A  E   +++  Y+  
Sbjct: 15  PKPMSPHLSIYRFKINMILSIMHRVTGITNYFGSLILAIWIASAATSEQAFNTVSSYLAT 74

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            +  V L  +TW+V+HHMLGGIR+ +WDV     K+    ++  ++I SI    I+W
Sbjct: 75  PLGLVILIGFTWSVMHHMLGGIRHFVWDVGWGFSKEAVKFLSWASLIGSITLTAIIW 131


>gi|49474757|ref|YP_032799.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           quintana str. Toulouse]
 gi|49240261|emb|CAF26731.1| Succinate dehydrogenase cytochrome b560 subunit [Bartonella
           quintana str. Toulouse]
          Length = 133

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 69/126 (54%), Gaps = 1/126 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           +++   RP SPH+ IYR   TM +SI HRITG  +Y G      W   IA G+    ++ 
Sbjct: 4   TTMIKERPRSPHVSIYRWTITMAMSIAHRITGLGLYFGMIFFTIWLISIACGDEMFRTVH 63

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVL 120
                      LFLYT A +HHM+G IR+++WD++ C LDKK A   A   +  S++  L
Sbjct: 64  EIYSSLPGLCILFLYTLAGVHHMVGDIRHIVWDMNPCLLDKKKAVLTAWATVFISLIVTL 123

Query: 121 IVWIIK 126
            +WII 
Sbjct: 124 TIWIIG 129


>gi|121602258|ref|YP_988426.1| succinate dehydrogenase, cytochrome b556 subunit [Bartonella
           bacilliformis KC583]
 gi|120614435|gb|ABM45036.1| succinate dehydrogenase, cytochrome b556 subunit [Bartonella
           bacilliformis KC583]
          Length = 133

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 69/125 (55%), Gaps = 1/125 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
            +RP SPH+ IYR   TM +SI HRITG  +Y G  ++  W   IA GE    ++     
Sbjct: 8   KDRPRSPHVTIYRWSITMAMSIAHRITGIAIYFGISLLAIWLMAIACGESAFKTVNEIYG 67

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVWI 124
                  LFL T+A +HHM+G IR+LI ++  C LDKK A  +A  NI  S    +++W+
Sbjct: 68  SFFGLCVLFLCTFAGVHHMVGDIRHLIGELKPCLLDKKQANFIAWANIFISFSATVVIWV 127

Query: 125 IKDIV 129
           I   V
Sbjct: 128 IGYSV 132


>gi|148260873|ref|YP_001235000.1| succinate dehydrogenase, cytochrome b subunit [Acidiphilium cryptum
           JF-5]
 gi|146402554|gb|ABQ31081.1| succinate dehydrogenase subunit C [Acidiphilium cryptum JF-5]
          Length = 143

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 52/101 (51%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQ+YR   T  +SI+HRITG  +  G  ++  W    A      S  +  +  
Sbjct: 20  RRPLSPHLQVYRPQITSTLSILHRITGVALSAGAVLLSLWLAAAATSSGAFSVAQAIVGS 79

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
            +  + LF +T+A+ +H   GIR+L+WD  +  +     + 
Sbjct: 80  ILGMIVLFGFTFALFYHFCNGIRHLLWDAGVGFELPSVHRS 120


>gi|119383319|ref|YP_914375.1| succinate dehydrogenase, cytochrome b subunit [Paracoccus
           denitrificans PD1222]
 gi|2493412|sp|Q59659|DHSC_PARDE RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|975316|gb|AAA75175.1| succinate dehydrogenase b-type cytochrome subunit [Paracoccus
           denitrificans]
 gi|119373086|gb|ABL68679.1| succinate dehydrogenase subunit C [Paracoccus denitrificans PD1222]
          Length = 130

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 61/121 (50%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQ+YRL      SI+ RITG  +  G  ++ +W           +     +
Sbjct: 6   RGNRPLSPHLQVYRLPLAAITSIMTRITGHALVAGIVLITWWLVAAVTSPGAFACADWVV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + L    WA+ +H+L G+R+L +D    L+ + A + ++  I  S++  ++  I
Sbjct: 66  RSWLGFIILTGSMWALWYHLLAGLRHLFYDAGYGLEIEQAHKSSQALIAGSVVLAVLTLI 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|326404267|ref|YP_004284349.1| succinate dehydrogenase cytochrome b subunit [Acidiphilium
           multivorum AIU301]
 gi|325051129|dbj|BAJ81467.1| succinate dehydrogenase cytochrome b subunit [Acidiphilium
           multivorum AIU301]
          Length = 147

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 52/101 (51%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQ+YR   T  +SI+HRITG  +  G  ++  W    A      S  +  +  
Sbjct: 24  RRPLSPHLQVYRPQITSTLSILHRITGVALSAGAVLLSLWLAAAATSSGAFSVAQAIVGS 83

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQM 107
            +  + LF +T+A+ +H   GIR+L+WD  +  +     + 
Sbjct: 84  ILGMIVLFGFTFALFYHFCNGIRHLLWDAGVGFELPSVHRS 124


>gi|285018596|ref|YP_003376307.1| succinate dehydrogenase_cytochrome b subunit protein [Xanthomonas
           albilineans GPE PC73]
 gi|283473814|emb|CBA16316.1| putative succinate dehydrogenase_cytochrome b subunit protein
           [Xanthomonas albilineans]
          Length = 130

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 62/120 (51%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SIVHR TG V+  G  ++V     +  G+ +    R   
Sbjct: 3   TRERPLSPHLQVYRWQIQMVTSIVHRATGIVLAFGALLIVAALLLLMCGQASWDCFRALA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                +V LF ++WA  +H+  G+R+++ D           + + +++I S++ V ++W+
Sbjct: 63  GAWYGQVFLFAWSWAFAYHLCNGLRHIVQDFGHGFSIPAFLRSSWLSVIGSLVIVALIWV 122


>gi|254292677|ref|YP_003058700.1| succinate dehydrogenase, cytochrome b556 subunit [Hirschia baltica
           ATCC 49814]
 gi|254041208|gb|ACT58003.1| succinate dehydrogenase, cytochrome b556 subunit [Hirschia baltica
           ATCC 49814]
          Length = 136

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 64/123 (52%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQ+++  PTM  SI+ RITG    +G  ++V W F IA+G         +   
Sbjct: 9   KRPLSPHLQVWKFHPTMLTSILQRITGVGNAIGVVLIVGWLFAIASGSDVFKCFDVFFTS 68

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
              ++ LF +T +V++H+  GIR+L WD        +A   +   I   +L  + VWI  
Sbjct: 69  IFGKIILFGFTVSVMYHLGQGIRFLFWDAGKGFTPAVANFWSYFTIAFGLLGAVAVWIFA 128

Query: 127 DIV 129
            +V
Sbjct: 129 GLV 131


>gi|49476235|ref|YP_034276.1| succinate dehydrogenase cytochrome b560 subunit [Bartonella
           henselae str. Houston-1]
 gi|49239043|emb|CAF28343.1| Succinate dehydrogenase cytochrome b560 subunit [Bartonella
           henselae str. Houston-1]
          Length = 133

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP SPH+ IYR   TM +SI HRITG  +Y G   +  W   I+ G     ++     
Sbjct: 8   KQRPRSPHVSIYRWTITMAMSIAHRITGIALYFGMVFLAIWLISISCGVEAFRTVHRIYT 67

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLIVWI 124
                  LFLYT A IHHM+GG+R+++WD+  C L K+ AT  A   +  S++    +WI
Sbjct: 68  SFPGLCILFLYTLAGIHHMVGGVRHIVWDIKPCLLAKEKATMTAWATVFISLIITFTIWI 127

Query: 125 IKD 127
           I  
Sbjct: 128 IGY 130


>gi|91205983|ref|YP_538338.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           RML369-C]
 gi|157826653|ref|YP_001495717.1| succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           OSU 85-389]
 gi|122425294|sp|Q1RHB5|DHSC_RICBR RecName: Full=Succinate dehydrogenase cytochrome b556 subunit;
           Short=Cytochrome b-556
 gi|91069527|gb|ABE05249.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           RML369-C]
 gi|157801957|gb|ABV78680.1| Succinate dehydrogenase cytochrome b-556 subunit [Rickettsia bellii
           OSU 85-389]
          Length = 125

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 3/123 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++ +WF       + +    
Sbjct: 6   QEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFAVSILAWWFILSKFDSNYIKLAN 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     +  +     ++A  +H+  GIR+L WD+ L    K         +I S+L  ++
Sbjct: 66  CCCIIKICLIL---TSFAWFYHLCNGIRHLFWDIGLGFSIKAVNLTGWSVVICSVLFTIL 122

Query: 122 VWI 124
           +W+
Sbjct: 123 LWV 125


>gi|114764872|ref|ZP_01444054.1| Succinate dehydrogenase cytochrome b-556 subunit [Pelagibaca
           bermudensis HTCC2601]
 gi|114542758|gb|EAU45781.1| Succinate dehydrogenase cytochrome b-556 subunit [Roseovarius sp.
           HTCC2601]
          Length = 131

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 5   KNNRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +  RPLSP +  Q YRL  T   S++ RITG+ + + T +V++W   +A G     +   
Sbjct: 6   RIERPLSPFMFVQYYRLQLTAVTSVMIRITGNALMVATLLVIWWLLALAAGPEAFETAEW 65

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
           ++   V  + +F   WAV +H LGG+R+LI+D    L+ + A ++    +  S++  ++ 
Sbjct: 66  WITSWVGNLVMFGSLWAVWYHYLGGLRHLIFDAGKGLELETAEKLGWACVYGSVVLTVLT 125

Query: 123 WII 125
            II
Sbjct: 126 VII 128


>gi|209883444|ref|YP_002287301.1| succinate dehydrogenase cytochrome b556 subunit [Oligotropha
           carboxidovorans OM5]
 gi|209871640|gb|ACI91436.1| succinate dehydrogenase cytochrome b556 subunit [Oligotropha
           carboxidovorans OM5]
          Length = 131

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 62/122 (50%), Gaps = 1/122 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + +RPLSP L  YR   TM +S++HR TG  +Y GT ++ +     A+     +    + 
Sbjct: 4   QTDRPLSPFLT-YRWTLTMAMSLIHRATGIALYGGTLLMAWGLIATASSPAAYACFEAFA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
              +  + +F +TW+++HH L G+RYL+WD            M +  +I  +L  + VW 
Sbjct: 63  TSWIGRIAIFGFTWSLMHHALSGLRYLVWDTGHGYAPGPREGMTRGALIGGVLATIAVWA 122

Query: 125 IK 126
           I 
Sbjct: 123 IA 124


>gi|262277891|ref|ZP_06055684.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HIMB114]
 gi|262224994|gb|EEY75453.1| succinate dehydrogenase, cytochrome b556 subunit [alpha
           proteobacterium HIMB114]
          Length = 122

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 56/122 (45%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K   PLSPHLQ+Y+   +  +SI HR+T     +G      W F +  GE        +
Sbjct: 1   MKFESPLSPHLQVYKWQLSSLLSITHRMTSIFNLMGMMFFALWIFMLFLGEDVYKYFEIF 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               + +       W+  +H+L GIR+L WD+    + K A       +++S +   +VW
Sbjct: 61  SATVIGKFIFVGIIWSFSYHLLNGIRHLFWDMGYGYEIKTANLSGIFVLLSSFILTFLVW 120

Query: 124 II 125
           + 
Sbjct: 121 VF 122


>gi|6649873|gb|AAF21608.1|AF018287_2 SdhC [papaya bunchy top disease rickettsia]
          Length = 125

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 3/123 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
             I N RP SPHL IY+   +  +SI+HR+TG  ++    ++ +WF       + +    
Sbjct: 6   QEIYNKRPTSPHLTIYKPRISSTLSILHRMTGVALFFAVSILAWWFIFSKFDSNYIQLAN 65

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
           C     +  +     ++A  +H+  GIR+L WD+      K         +I S+L  ++
Sbjct: 66  CCCIIKICLIL---TSFAWFYHLCNGIRHLFWDIGYGFPIKAVNLTGWSVVICSVLFTIL 122

Query: 122 VWI 124
           +WI
Sbjct: 123 LWI 125


>gi|126311342|ref|XP_001381718.1| PREDICTED: similar to QPS1 [Monodelphis domestica]
          Length = 264

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +  +NRPLSPH+ IY     M +SI HR +G  +  G  +  +       N E  +  L
Sbjct: 139 KNTNSNRPLSPHITIYSWSLPMAMSICHRASGIALSAGVSLFGLAALLLPGNFESHVELL 198

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F     +++H   GIR+L WD+ + L      Q   + +  ++L+ 
Sbjct: 199 KSLSLGPALIHTAKFALVSPLMYHTWNGIRHLTWDLGMGLKIPQLYQSGVVVLALTVLSS 258

Query: 120 LIVWII 125
           + +  +
Sbjct: 259 IGLAAM 264


>gi|221220816|gb|ACM09069.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221221340|gb|ACM09331.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221221580|gb|ACM09451.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + K NRP+SPHL IY+    M +SI HR TG  +  G     +       N  + L  +
Sbjct: 44  KNNKLNRPVSPHLTIYKWSLPMMMSITHRGTGVGLSGGISAFALLALVLPGNYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + V +H L GIR+L WD           +   + I+ SILT 
Sbjct: 104 HSLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILTS 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|49077638|gb|AAT49701.1| PA1581 [synthetic construct]
          Length = 129

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 70/125 (56%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++ + RP++  L+  +L  T + SI+HRI+G +++LG  V++F      + E     ++
Sbjct: 3   KAVNSKRPVNLDLRTIKLPVTAYTSILHRISGVILFLGIAVLLFALDKSLSSEEGFEQVK 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             +   + ++ ++    A+++H++ G+R+L+ D  +    +   + +KI I  +++ +++
Sbjct: 63  ACLTSPLAKLVIWGLLSALLYHLVAGVRHLVMDAGVGETLEGGKRGSKIVIAIAVVLIVL 122

Query: 122 --VWI 124
             VW+
Sbjct: 123 AGVWV 127


>gi|240848787|ref|NP_001155673.1| succinate dehydrogenase cytochrome b560 subunit, mitochondrial-like
           [Acyrthosiphon pisum]
 gi|239788025|dbj|BAH70709.1| ACYPI006695 [Acyrthosiphon pisum]
          Length = 175

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 53/121 (43%), Gaps = 2/121 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            + + NRP+SPHL IY+   T  +SI HR TG  +  G    +   F   +    +  + 
Sbjct: 50  KNNRLNRPMSPHLAIYKPQLTTILSITHRGTGVALS-GVTAGLGALFIFTDLPTFVQFVH 108

Query: 62  CY-MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  +       L  +   +H+  GIR+L+WD   CL  K         I+ S+L  +
Sbjct: 109 GLELPSAAIMSAKGLVAYPFFYHLCNGIRHLVWDAGKCLTIKQVYSTGYGVIVGSLLLTV 168

Query: 121 I 121
           +
Sbjct: 169 L 169


>gi|15596778|ref|NP_250272.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa PAO1]
 gi|116049526|ref|YP_791670.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218892462|ref|YP_002441329.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa LESB58]
 gi|254234682|ref|ZP_04928005.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa C3719]
 gi|254239930|ref|ZP_04933252.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa 2192]
 gi|296390045|ref|ZP_06879520.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa PAb1]
 gi|9947544|gb|AAG04970.1|AE004586_8 succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa PAO1]
 gi|115584747|gb|ABJ10762.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126166613|gb|EAZ52124.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa C3719]
 gi|126193308|gb|EAZ57371.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa 2192]
 gi|218772688|emb|CAW28473.1| succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa LESB58]
          Length = 128

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 70/125 (56%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++ + RP++  L+  +L  T + SI+HRI+G +++LG  V++F      + E     ++
Sbjct: 3   KAVNSKRPVNLDLRTIKLPVTAYTSILHRISGVILFLGIAVLLFALDKSLSSEEGFEQVK 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             +   + ++ ++    A+++H++ G+R+L+ D  +    +   + +KI I  +++ +++
Sbjct: 63  ACLTSPLAKLVIWGLLSALLYHLVAGVRHLVMDAGVGETLEGGKRGSKIVIAIAVVLIVL 122

Query: 122 --VWI 124
             VW+
Sbjct: 123 AGVWV 127


>gi|221219992|gb|ACM08657.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + K NRP+SPHL IY+    M +SI HR TG  +  G     +       N  + L  +
Sbjct: 44  KNNKLNRPVSPHLTIYKWSLPMMMSITHRGTGVGLSGGISAFALLALVLPGNYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + V +H L GIR+L WD           +   + I+ SILT 
Sbjct: 104 HSLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILTS 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|2137070|pir||I48085 integral membrane protein CII-3 - Chinese hamster (fragment)
          Length = 171

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 2/121 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +  + RP+SPHL IYR    M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 48  KNTSSKRPVSPHLTIYRWSLPMVMSICHRGTGVALSGGVSLFGLSALLLPGNFESYLMFI 107

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F+  + +++H L GIR+LIWD+   L      Q     ++ ++L+ 
Sbjct: 108 KSLCLGPALIHSAKFVLVFPLMYHSLNGIRHLIWDLGKGLSISQVYQSGVAVLMLAVLSS 167

Query: 120 L 120
           +
Sbjct: 168 V 168


>gi|221219496|gb|ACM08409.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221219988|gb|ACM08655.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|221221046|gb|ACM09184.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + K NRP+SPHL IY+    M +SI HR TG  +  G     +       N  + L  +
Sbjct: 44  KNNKLNRPVSPHLTIYKWSLPMMMSITHRGTGVGLSGGISAFALLALVLPGNYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + V +H L GIR+L WD           +   + I+ SILT 
Sbjct: 104 HSLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILTS 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|152985839|ref|YP_001349047.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa PA7]
 gi|150960997|gb|ABR83022.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           aeruginosa PA7]
          Length = 128

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 69/125 (55%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++ + RP++  L+  +L  T + SI+HRI+G +++LG  V++F        E     ++
Sbjct: 3   KAVNSKRPVNLDLRTIKLPVTAYTSILHRISGVILFLGIAVLLFALDKSLRSEEGFEQVK 62

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             +   + ++ ++    A+++H++ GIR+L+ D  +    +   + +KI I  +++ +++
Sbjct: 63  ACLTSPLAKLVIWGLLSALLYHLVAGIRHLVMDAGVGETLEGGKRGSKIVIAIAVVLIVL 122

Query: 122 --VWI 124
             VW+
Sbjct: 123 AGVWV 127


>gi|290463150|sp|D0VWV4|C560_PIG RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; AltName: Full=Succinate-ubiquinone
           oxidoreductase cytochrome B large subunit; Short=CYBL;
           Flags: Precursor
          Length = 169

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            ++ +NRPLSPH+ IYR    M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 44  KNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELV 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + +++H   GIR+LIWD+   L     TQ   + +I ++L+ 
Sbjct: 104 KSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSS 163

Query: 120 LIVWII 125
           + +  +
Sbjct: 164 VGLAAM 169


>gi|221220716|gb|ACM09019.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + K NRP+SPHL IY+    M +SI HR TG  +  G     +       N  + L  +
Sbjct: 44  KNNKLNRPVSPHLTIYKWSLPMMMSITHRGTGVGLSGGISAFALLALVLPGNYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + V +H L GIR+L WD           +   + I+ SILT 
Sbjct: 104 HSLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILTS 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|84684219|ref|ZP_01012121.1| Succinate dehydrogenase cytochrome b-556 subunit [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667972|gb|EAQ14440.1| Succinate dehydrogenase cytochrome b-556 subunit [Rhodobacterales
           bacterium HTCC2654]
          Length = 127

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 1   MSSIK-NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS 59
           M+ +   NRPLSPHLQ YRL     +SI+HRITG  +     ++V++F  +A G     +
Sbjct: 1   MADVNQGNRPLSPHLQAYRLPLNAKLSILHRITGVAMGFSGVLIVWYFLALATGPEYFET 60

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
               +     ++  FL   A+  H   G+R+LIWD      +K   + A I I  +
Sbjct: 61  ASAVLTSWFGDIVFFLSICALWLHFANGVRHLIWDTGSHFGQKTVNRSALIGIGFA 116


>gi|209737836|gb|ACI69787.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
 gi|303658983|gb|ADM15942.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 53/122 (43%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + K NRP+SPH+ IY+    M +SI HR TG  +  G     +       N  + L  +
Sbjct: 44  KNNKLNRPMSPHITIYQWSVPMMMSITHRGTGVGLSGGISAFALLALVLPGNYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + + +H L GIR+L WD           +   + I+ SILT 
Sbjct: 104 HSLSIGPALLGLAKFGIAFPLSYHTLNGIRHLFWDSGKGFTLPEVYRSGYVVIVLSILTS 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|332188523|ref|ZP_08390243.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingomonas sp.
           S17]
 gi|332011428|gb|EGI53513.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingomonas sp.
           S17]
          Length = 161

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 7/135 (5%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY-LGTPVVVFWFFCIANGEHTLSS 59
           +++    RPLSPHLQI++  P M VSI+HR TG+ +  +G  ++V++   IA G  + ++
Sbjct: 26  LAARNTARPLSPHLQIWKWGPNMLVSILHRATGTGMATVGAALLVWFLAAIAGGPESYAT 85

Query: 60  LRCYMD------GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINII 113
            R            +  V     T  +  H+  GIR+L  DV    + K   + A+  I+
Sbjct: 86  FRDVFTVQSGRLNIIGYVVGIGLTACLFQHLANGIRHLFMDVGAGFELKSNKRQAQATIV 145

Query: 114 ASILTVLIVWIIKDI 128
            +++  +  W+   I
Sbjct: 146 FAVVMTVAFWLYLGI 160


>gi|254477708|ref|ZP_05091094.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria sp. R11]
 gi|214031951|gb|EEB72786.1| succinate dehydrogenase, cytochrome b556 subunit [Ruegeria sp. R11]
          Length = 127

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 63/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHLQIYR   T   SI  R TG  ++    + V+W    A  E     +   +
Sbjct: 6   RGNRPLSPHLQIYRPQLTSASSIFVRATGIAIFFLMLLAVWWLLAAATSEAAFGFIDGLL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
            G + ++ L   TW++ + MLG +R++IWD   CLD + + +M +   IA+    +   I
Sbjct: 66  RGWLGDIILLGATWSIWYLMLGRLRHVIWDFGHCLDVETSEKMGQGMFIAATALTVFTAI 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|154251886|ref|YP_001412710.1| succinate dehydrogenase cytochrome b556 subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|154155836|gb|ABS63053.1| Succinate dehydrogenase cytochrome b556 subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 135

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/119 (38%), Positives = 71/119 (59%)

Query: 8   RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGS 67
           RPLSPHLQIYR+  TM +SI+HR TG  +Y GT +V +W    A G    ++ +      
Sbjct: 10  RPLSPHLQIYRVTITMAMSIIHRFTGMGLYAGTALVAWWLVAAATGPEAYATFQAVAGSW 69

Query: 68  VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           + ++ LF +TWA++HH+ GG+RYL+WD  +    + A  ++    IA++L  + VW   
Sbjct: 70  IGQLVLFGFTWALLHHLFGGLRYLLWDAIVATSPRSADIISWAATIAALLATVAVWFAA 128


>gi|84500178|ref|ZP_00998444.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           batsensis HTCC2597]
 gi|84392112|gb|EAQ04380.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicola
           batsensis HTCC2597]
          Length = 129

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 62/123 (50%), Gaps = 2/123 (1%)

Query: 5   KNNRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + NRPLSP +  Q YR       SI+ RITG+ + +   ++ +WF   A G         
Sbjct: 6   RGNRPLSPFMLGQYYRFQLNSVASILTRITGNALIVAAFLIAWWFMAAAAGPEYFRVADY 65

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +   V ++ L   T  + +H L G+R+LIWD    LD + + +M+ I I  S++  L+ 
Sbjct: 66  VITSWVGDLILLFSTLGLWYHTLAGVRHLIWDNGYLLDMESSDKMSWIIIGGSVVLTLLT 125

Query: 123 WII 125
            II
Sbjct: 126 VII 128


>gi|323138215|ref|ZP_08073287.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocystis sp.
           ATCC 49242]
 gi|322396467|gb|EFX98996.1| succinate dehydrogenase, cytochrome b556 subunit [Methylocystis sp.
           ATCC 49242]
          Length = 135

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/129 (34%), Positives = 75/129 (58%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           +  +   RPLSPHL +Y+ + TM +SI HRITG+ +Y+G  ++  +    A G    S+ 
Sbjct: 6   LDKLAAKRPLSPHLSVYKPMLTMMMSIAHRITGAGLYVGMALLALFLLGAAMGGWVFSAF 65

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
                G +  + +FL TWA+ HH+LGG+R+ +WD  L +D K    +A+  +   +   L
Sbjct: 66  SWLGSGFIGGLIVFLVTWAIFHHLLGGVRHALWDRGLYMDPKGREFLAQATLGGGVTLTL 125

Query: 121 IVWIIKDIV 129
           +VW++K +V
Sbjct: 126 LVWVLKSLV 134


>gi|73535958|pdb|1ZOY|C Chain C, Crystal Structure Of Mitochondrial Respiratory Complex Ii
           From Porcine Heart At 2.4 Angstroms
 gi|73535962|pdb|1ZP0|C Chain C, Crystal Structure Of Mitochondrial Respiratory Complex Ii
           Bound With 3-Nitropropionate And
           2-Thenoyltrifluoroacetone
 gi|322812260|pdb|3ABV|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide
 gi|322812268|pdb|3AE1|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With N-Phenyl-2-(Trifluoromethyl)-Benzamide
 gi|322812272|pdb|3AE2|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Hydroxy-N-Phenyl-Benzamide
 gi|322812276|pdb|3AE3|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Nitro-N-Phenyl-Benzamide
 gi|322812280|pdb|3AE4|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-Methyl-Benzamide
 gi|322812284|pdb|3AE5|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Methyl-N-(3-Isopropoxy-Phenyl)-Benzamide
 gi|322812288|pdb|3AE6|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With N-(3-Isopropoxy-Phenyl)-Phthalamicacid
 gi|322812292|pdb|3AE7|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-(3-Isopropoxy-Phenyl)-Benzamide
 gi|322812296|pdb|3AE8|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Isopropoxy-Phenyl)-2-Trifluoromethylbenzamide
 gi|322812300|pdb|3AE9|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Pentafluorophenyloxy-Phenyl)-2-Trifluoromethyl-
           Benzamide
 gi|322812304|pdb|3AEA|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Dimethylaminomethyl-Phenyl)-2-Trifluoromethyl-
           Benzamide
 gi|322812308|pdb|3AEB|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With
           N-(3-Phenoxy-Phenyl)-2-Trifluoromethyl-Benzamide
 gi|322812312|pdb|3AEC|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-(1-Methylethyl)-Benzamid
 gi|322812316|pdb|3AED|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With 2-Iodo-N-Phenyl-Benzamide
 gi|322812320|pdb|3AEE|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With Atpenin A5
 gi|322812324|pdb|3AEF|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii With An Empty Quinone-Binding Pocket
 gi|322812328|pdb|3AEG|C Chain C, Crystal Structure Of Porcine Heart Mitochondrial Complex
           Ii Bound With N-Biphenyl-3-Yl-2-Iodo-Benzamide
          Length = 140

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            ++ +NRPLSPH+ IYR    M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 15  KNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELV 74

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + +++H   GIR+LIWD+   L     TQ   + +I ++L+ 
Sbjct: 75  KSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSS 134

Query: 120 LIVWII 125
           + +  +
Sbjct: 135 VGLAAM 140


>gi|21362398|sp|P70097|C560_CRIGR RecName: Full=Succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial; AltName: Full=Integral membrane protein
           CII-3; AltName: Full=QPs-1; Short=QPs1; Flags: Precursor
 gi|1518874|gb|AAB07265.1| integral membrane protein CII-3 [Cricetulus griseus]
          Length = 169

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +  + RP+SPHL IYR    M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 44  KNTSSKRPVSPHLTIYRWSLPMVMSICHRGTGVALSGGVSLFGLSALLLPGNFESYLMFI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F+  + +++H L GIR+LIWD+   L      Q     ++ ++L+ 
Sbjct: 104 KSLCLGPALIHSAKFVLVFPLMYHSLNGIRHLIWDLGKGLSISQVYQSGVAVLMLAVLSS 163

Query: 120 LIVWII 125
           + +  +
Sbjct: 164 VGLAAM 169


>gi|83944805|ref|ZP_00957171.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851587|gb|EAP89442.1| succinate dehydrogenase, cytochrome b556 subunit [Oceanicaulis
           alexandrii HTCC2633]
          Length = 134

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RP+SPHL+I+R   TM  SI HR TG   Y+G   +  W   +A G          M G
Sbjct: 8   PRPISPHLEIWRWHATMASSIFHRATGVGNYIGAIFLTLWLVLLAAGPDAYGGFEALMAG 67

Query: 67  SVFEVCLFLY---TWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
            +  +   +    T ++I+H++ G+R+L+WD     + K A   +   IIASIL  + +W
Sbjct: 68  PLGLLVKLVLFLFTLSLIYHLINGVRHLVWDAGKGFEPKFANTASMAIIIASILVTVAIW 127

Query: 124 IIKD 127
           ++  
Sbjct: 128 LLSG 131


>gi|84515883|ref|ZP_01003244.1| succinate dehydrogenase, cytochrome b556 subunit [Loktanella
           vestfoldensis SKA53]
 gi|84510325|gb|EAQ06781.1| succinate dehydrogenase, cytochrome b556 subunit [Loktanella
           vestfoldensis SKA53]
          Length = 127

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 64/121 (52%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A G    +     +
Sbjct: 6   RGNRPLSPHLTIYRPQWTSITSILVRITGNALLVAGLLIVWWFVAAATGPAAFALADGVL 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ +    WA+ +H LGG+R+L+WD    LD   + +  +  +  S++  +I  I
Sbjct: 66  TSWFGKLVMLGSIWALWYHSLGGLRHLVWDSGRMLDVASSERAGQAMVALSVVLTIITVI 125

Query: 125 I 125
           I
Sbjct: 126 I 126


>gi|260576579|ref|ZP_05844567.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter sp.
           SW2]
 gi|259021183|gb|EEW24491.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter sp.
           SW2]
          Length = 131

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 65/131 (49%), Gaps = 6/131 (4%)

Query: 1   MSSIKNN--RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLS 58
           M+  K    RPLSPHLQ+YR+  +M  S++ RITG  +  G  + V+W    A      +
Sbjct: 1   MAEAKREIVRPLSPHLQVYRMKASMATSVLIRITGVGLMSGFILFVWWLLAAAISPEYFA 60

Query: 59  SLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIA---- 114
            +   +      +       A+ +H LGG+R+L WD    LD +   +++   +I     
Sbjct: 61  FVNGIVTSWFGYLIFIGSLAAIWYHYLGGLRHLYWDTGKGLDLETVDKLSWGMVIGTPVL 120

Query: 115 SILTVLIVWII 125
           ++LT+L +W I
Sbjct: 121 TVLTILAIWGI 131


>gi|57111445|ref|XP_536140.1| PREDICTED: similar to succinate dehydrogenase complex, subunit C
           precursor [Canis familiaris]
          Length = 169

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 56/126 (44%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +   NRPLSPH+ IY     M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 44  KNTDLNRPLSPHITIYSWSLPMAMSICHRGTGVALSAGVSLFGLSALLVPGNFESHLELV 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + +++H   GIR+LIWD+   L      Q     ++ ++L+ 
Sbjct: 104 KSLCLGPSLIYTAKFALVFPLMYHTWNGIRHLIWDLGKGLKIPQLYQSGVAVLVLTVLSS 163

Query: 120 LIVWII 125
           + +  +
Sbjct: 164 VGLAAM 169


>gi|166712288|ref|ZP_02243495.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 131

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 58/119 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R +  
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLTVGALVIAAALLTLMLGPDHWNCFRDHAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW+   H+ GG+R+++ D       +    M  +++I S +    VW 
Sbjct: 64  SWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFVGMGWLSVILSFVLTGAVWA 122


>gi|85544667|pdb|2FBW|C Chain C, Avian Respiratory Complex Ii With Carboxin Bound
 gi|85544671|pdb|2FBW|P Chain P, Avian Respiratory Complex Ii With Carboxin Bound
 gi|304445606|pdb|2WQY|C Chain C, Remodelling Of Carboxin Binding To The Q-Site Of Avian
           Respiratory Complex Ii
 gi|304445610|pdb|2WQY|P Chain P, Remodelling Of Carboxin Binding To The Q-Site Of Avian
           Respiratory Complex Ii
          Length = 141

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 57/127 (44%), Gaps = 2/127 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            + K++RPLSPH+ IY+    M +SI HR TG  + LG  +  V          H ++ +
Sbjct: 15  KNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSVAALLLPEQFPHYVAVV 74

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +       +     F   + + +H   GIR+L+WD+          Q   + +I ++L+ 
Sbjct: 75  KSLSLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQVEQSGVVVLILTLLSS 134

Query: 120 LIVWIIK 126
             +  I 
Sbjct: 135 AGIAAIS 141


>gi|225717282|gb|ACO14487.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Esox lucius]
          Length = 173

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 50/122 (40%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + K NRP+SPH+ +Y+    M +SI HR TG  +  G     +       +  + L  +
Sbjct: 44  KNNKLNRPMSPHVTVYKWSVPMMMSISHRGTGLGLSAGVSAFALLALVLPGSYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + + +H   GIR+L WD                 I+ ++LT 
Sbjct: 104 HSQSFGPALIGLAKFGIAFPLSYHTFNGIRHLCWDSGKGFKIPEVYGSGYTVIVLTVLTT 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|319786900|ref|YP_004146375.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465412|gb|ADV27144.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 130

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 58/122 (47%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI+HR TG V+  G  V+      +  G  + +    + 
Sbjct: 3   SRERPLSPHLQVYRWQVQMVTSILHRATGIVLAGGALVLAGGLLALMVGPESWACFTGHA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                +V L  +TWA  +H+  GIR++  D +         + + ++I  S++   IVW 
Sbjct: 63  GAWYGKVFLLGWTWAFAYHLCNGIRHVAQDFAHGYAIPDFVRNSWLSIAGSLVITAIVWA 122

Query: 125 IK 126
           + 
Sbjct: 123 LA 124


>gi|301786725|ref|XP_002928776.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit,
           mitochondrial-like isoform 1 [Ailuropoda melanoleuca]
          Length = 169

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +   NRPLSPH+ IY     M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 44  KNTDLNRPLSPHITIYSWSLPMAMSICHRGTGVALSAGVSLFGLSALLIPGNFESHLELV 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + +++H   GIR+L+WD+   L      Q     ++ ++L+ 
Sbjct: 104 KSLCLGPSLIYTAKFALVFPLMYHTWNGIRHLVWDLGKGLKIPQLYQSGVAVLVLTVLSS 163

Query: 120 LIVWII 125
           + +  +
Sbjct: 164 VGLAAM 169


>gi|138519774|gb|AAI35209.1| LOC496650 protein [Xenopus (Silurana) tropicalis]
          Length = 164

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            + + NRPLSPH+ IY+    M +SI HR TG  +  G  +  +       +    L  +
Sbjct: 39  KNTRLNRPLSPHITIYKWSLPMAMSISHRGTGIAMTAGVSLFGLAALVLPGDFASYLELV 98

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + + +H+  GIR+L WD+   L      +     +  +++T 
Sbjct: 99  KSLSLGPALIYSAKFALAFPLTYHVWNGIRHLTWDLGKGLKIPQVYRSGVTVLALTLITT 158

Query: 120 LIVWII 125
             +  +
Sbjct: 159 ATLAAM 164


>gi|289665883|ref|ZP_06487464.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289669028|ref|ZP_06490103.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 131

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 57/119 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSVGALVIAAALLTLMLGPDHWNCFRDQTA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW+   H+ GG+R+++ D       +    M  +++I S +    VW 
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVILSFVLTGAVWA 122


>gi|294624875|ref|ZP_06703532.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|294665038|ref|ZP_06730345.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292600834|gb|EFF44914.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292605195|gb|EFF48539.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 131

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 57/119 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSVGALGIAAALLTLMLGPDHWNCFRDQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++    +W 
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTAAIWA 122


>gi|209738020|gb|ACI69879.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 52/122 (42%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFC-IANGEHTLSSL 60
            + K NRP+SPH+ IY+    M +SI HR TG  +  G             N  + L  +
Sbjct: 44  KNNKLNRPMSPHITIYQWSVPMMMSITHRGTGVGLSGGILAFALLALVLPGNYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + + +H L GIR+L WD           +   + I+ SILT 
Sbjct: 104 HSLSIGPALLGLAKFGIAFPLSYHTLNGIRHLFWDSGKGFTLPEVYRSGYVVIVLSILTS 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|325928377|ref|ZP_08189572.1| succinate dehydrogenase subunit C [Xanthomonas perforans 91-118]
 gi|325541253|gb|EGD12800.1| succinate dehydrogenase subunit C [Xanthomonas perforans 91-118]
          Length = 131

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 58/119 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSVGALGIAAALLTLMLGPDHWNCFRDQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++  + +W 
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTIAIWA 122


>gi|58581933|ref|YP_200949.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84623845|ref|YP_451217.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|50313515|gb|AAT74619.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae]
 gi|58426527|gb|AAW75564.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84367785|dbj|BAE68943.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
          Length = 131

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 58/119 (48%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R +  
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLTVGALVIAAALLTLMLGPDHWNCFRDHAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S +    VW 
Sbjct: 64  SWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFVGMGWLSVLLSFVLTGAVWA 122


>gi|281352142|gb|EFB27726.1| hypothetical protein PANDA_018826 [Ailuropoda melanoleuca]
          Length = 144

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +   NRPLSPH+ IY     M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 19  KNTDLNRPLSPHITIYSWSLPMAMSICHRGTGVALSAGVSLFGLSALLIPGNFESHLELV 78

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + +++H   GIR+L+WD+   L      Q     ++ ++L+ 
Sbjct: 79  KSLCLGPSLIYTAKFALVFPLMYHTWNGIRHLVWDLGKGLKIPQLYQSGVAVLVLTVLSS 138

Query: 120 LIVWII 125
           + +  +
Sbjct: 139 VGLAAM 144


>gi|209731756|gb|ACI66747.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 170

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 2/122 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + K NRP+SPH+ +Y+    M +SI HR TG  +  G     +       N  + L  +
Sbjct: 44  KNNKLNRPMSPHITVYQRSVPMMMSITHRGTGVGLSGGISAFALLALVLPGNYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G  +  +  F   + + +H L GIR+L WD           +   + I+ SILT 
Sbjct: 104 HSLSIGPALLGLAKFGIAFPLSYHTLNGIRHLFWDSGKGFTLPEVYRSGYVVIVLSILTS 163

Query: 120 LI 121
           + 
Sbjct: 164 IA 165


>gi|148554233|ref|YP_001261815.1| succinate dehydrogenase subunit C [Sphingomonas wittichii RW1]
 gi|148499423|gb|ABQ67677.1| succinate dehydrogenase subunit C [Sphingomonas wittichii RW1]
          Length = 135

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 1/121 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY-LGTPVVVFWFFCIANGEHTLSSLRCY 63
              RPLSPHL I++  P M VSI+HR TG  +  +     V+W    A+G    ++    
Sbjct: 4   NPGRPLSPHLTIWKWGPHMAVSILHRATGVGLAIVAGLAFVWWLVAAASGPDAYATFYKV 63

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
                  +     TW+   H+  G+R+ + D+    + KI    +   ++ S+L  L++W
Sbjct: 64  ATSWFGYLVAIGLTWSFFQHLFSGLRHFVLDIGAGYELKINKTGSIATMVGSVLVTLLIW 123

Query: 124 I 124
           +
Sbjct: 124 V 124


>gi|56611131|gb|AAH87773.1| LOC496650 protein [Xenopus (Silurana) tropicalis]
          Length = 167

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            + + NRPLSPH+ IY+    M +SI HR TG  +  G  +  +       +    L  +
Sbjct: 42  KNTRLNRPLSPHITIYKWSLPMAMSISHRGTGIAMTAGVSLFGLAALVLPGDFASYLELV 101

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + + +H+  GIR+L WD+   L      +     +  +++T 
Sbjct: 102 KSLSLGPALIYSAKFALAFPLTYHVWNGIRHLTWDLGKGLKIPQVYRSGVTVLALTLITT 161

Query: 120 LIVWII 125
             +  +
Sbjct: 162 ATLAAM 167


>gi|308323411|gb|ADO28842.1| mitochondrial succinate dehydrogenase cytochrome b560 subunit
           [Ictalurus punctatus]
          Length = 166

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 2/123 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + + NRPLSPH+ IYR    M +SI HR TG V+  G             +  + L  +
Sbjct: 41  KNSRLNRPLSPHITIYRWSVPMMMSITHRGTGVVLSAGISAFAAAALVLPGSFPYYLDLV 100

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
             +  G  +     F  ++ V +H   GIR+L+WDV              I I  SI T 
Sbjct: 101 HSFSMGPALITTAKFALSFPVAYHTYNGIRHLMWDVGKGFKIPEVYHSGYIVIALSIFTS 160

Query: 120 LIV 122
           + +
Sbjct: 161 VAL 163


>gi|218847754|ref|NP_001136371.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa [Xenopus (Silurana) tropicalis]
 gi|163915714|gb|AAI57547.1| LOC496650 protein [Xenopus (Silurana) tropicalis]
          Length = 169

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            + + NRPLSPH+ IY+    M +SI HR TG  +  G  +  +       +    L  +
Sbjct: 44  KNTRLNRPLSPHITIYKWSLPMAMSISHRGTGIAMTAGVSLFGLAALVLPGDFASYLELV 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F   + + +H+  GIR+L WD+   L      +     +  +++T 
Sbjct: 104 KSLSLGPALIYSAKFALAFPLTYHVWNGIRHLTWDLGKGLKIPQVYRSGVTVLALTLITT 163

Query: 120 LIVWII 125
             +  +
Sbjct: 164 ATLAAM 169


>gi|126734839|ref|ZP_01750585.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           CCS2]
 gi|126715394|gb|EBA12259.1| succinate dehydrogenase, cytochrome b556 subunit [Roseobacter sp.
           CCS2]
          Length = 127

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 67/121 (55%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
           + NRPLSPHL IYR   T   SI+ RITG+ + +   ++V+WF   A G    ++   ++
Sbjct: 6   RGNRPLSPHLTIYRPQWTSMSSILVRITGNALIVAALMIVWWFVAAAAGPDAFATANGFV 65

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                ++ + L    + +H+LGG+R+L+WD    LD   +   A++ ++ S+L  +   +
Sbjct: 66  TSWFGDLIMTLSVLGLWYHLLGGLRHLVWDSGRMLDVDKSELAAQMMVVLSVLLTIFTIV 125

Query: 125 I 125
           +
Sbjct: 126 V 126


>gi|119472931|ref|ZP_01614804.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhD [Alteromonadales bacterium TW-7]
 gi|119444649|gb|EAW25958.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhD [Alteromonadales bacterium TW-7]
          Length = 153

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 59/124 (47%), Gaps = 2/124 (1%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L    +  T   SI HR+TG  ++     V++ +    +   +   ++ 
Sbjct: 28  TVKKQRPVNLDLTTISMPATAKASIFHRVTGVALFFALTFVIWAWSESLSSAESFEFVKG 87

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI- 121
             +G + +   +     + +H++GGIR+++ D+    + +     AKI +   ++  ++ 
Sbjct: 88  LFNGFIAKFIAWGTISVLGYHLIGGIRHMVMDMGHWEELESGNLSAKIAMALGVVFAVLA 147

Query: 122 -VWI 124
            VWI
Sbjct: 148 GVWI 151


>gi|70997878|ref|XP_753671.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           fumigatus Af293]
 gi|66851307|gb|EAL91633.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           fumigatus Af293]
 gi|159126596|gb|EDP51712.1| succinate dehydrogenase cytochrome b560 subunit [Aspergillus
           fumigatus A1163]
          Length = 208

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 58/130 (44%), Gaps = 5/130 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVV-----YLGTPVVVFWFFCIANGEH 55
           ++  + NRP+SPHL IYR   T   S  HRITG  +        T  +    F       
Sbjct: 79  LAQQRLNRPVSPHLSIYRPQITWIGSSAHRITGIALSGSLYLFATAYLAAPLFGWHLESA 138

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
           ++++    +  +   +      +  ++H L G+R+L+WD+   +  +   +     +  +
Sbjct: 139 SIAAAFGALPIAAKVLIKGTAAFPFVYHCLNGVRHLVWDLGRGISNQQVIKSGWTVVGLT 198

Query: 116 ILTVLIVWII 125
           +++ L + ++
Sbjct: 199 VVSALTLALL 208


>gi|110590576|pdb|2H88|C Chain C, Avian Mitochondrial Respiratory Complex Ii At 1.8 Angstrom
           Resolution
 gi|110590580|pdb|2H88|P Chain P, Avian Mitochondrial Respiratory Complex Ii At 1.8 Angstrom
           Resolution
 gi|110590584|pdb|2H89|C Chain C, Avian Respiratory Complex Ii With Malonate Bound
          Length = 140

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 2/123 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSL 60
            + K++RPLSPH+ IY+    M +SI HR TG  + LG  +       +     H ++ +
Sbjct: 15  KNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSLAALLLPEQFPHYVAVV 74

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +       +     F   + + +H   GIR+L+WD+          Q   + +I ++L+ 
Sbjct: 75  KSLSLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQVEQSGVVVLILTLLSS 134

Query: 120 LIV 122
             +
Sbjct: 135 AAI 137


>gi|21231576|ref|NP_637493.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768302|ref|YP_243064.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|188991441|ref|YP_001903451.1| succinate dehydrogenase (ubiquinone) cytochrome b556 subunit
           [Xanthomonas campestris pv. campestris str. B100]
 gi|21113263|gb|AAM41417.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573634|gb|AAY49044.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167733201|emb|CAP51399.1| succinate dehydrogenase (ubiquinone) cytochrome b556 subunit
           [Xanthomonas campestris pv. campestris]
          Length = 131

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 56/120 (46%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RPLSPHLQ+YR    M  SI++R TG V+ +G  V+      +  G    +  R   
Sbjct: 3   TRERPLSPHLQVYRWQIQMVTSILNRATGIVLSIGALVIAAALLTLMLGPDHWNCFRDMA 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
                +V LF +TW    H+ GG+R+++ D       +    +  +++I S +    +W 
Sbjct: 63  AAWYGQVFLFGWTWCFAFHLFGGLRHILQDFGQGYAVRSFVSIGWLSVILSFVLTAAIWA 122


>gi|169153946|emb|CAQ14311.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Danio rerio]
          Length = 167

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 52/126 (41%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + + NRP+SPH+ IY+    M +SI HR TG  +  G     +       +  + L  +
Sbjct: 42  KNTRLNRPMSPHMTIYKWSVPMAMSISHRGTGIALSSGISAFALAALVLPESYPYYLDLI 101

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G        F   + V++H   GIR+L WD           +   + +  ++LT 
Sbjct: 102 HSLTFGPQFLAFSKFALAFPVVYHTYNGIRHLAWDAGKGFKIPEVYRSGYVVLGLTVLTS 161

Query: 120 LIVWII 125
           + +  +
Sbjct: 162 IGLAAM 167


>gi|312375419|gb|EFR22798.1| hypothetical protein AND_14194 [Anopheles darlingi]
          Length = 192

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 44/117 (37%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RP SPHL IY    T  +SI HR TG  +      +      + +      ++  
Sbjct: 56  NARLKRPQSPHLTIYSFQLTSTLSITHRFTGLALTGYITALGLGALVMPHDATHYLTMLE 115

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
            +         F+  +   +H + G+R+L WD+   L  K         +  S +  
Sbjct: 116 GLSAPTLIALKFMLAYPFAYHTVNGVRHLFWDMGKFLTIKEVYTTGYTMLGVSGVLA 172


>gi|169153945|emb|CAQ14310.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein [Danio rerio]
          Length = 169

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 52/126 (41%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTP-VVVFWFFCIANGEHTLSSL 60
            + + NRP+SPH+ IY+    M +SI HR TG  +  G     +       +  + L  +
Sbjct: 44  KNTRLNRPMSPHMTIYKWSVPMAMSISHRGTGIALSSGISAFALAALVLPESYPYYLDLI 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
                G        F   + V++H   GIR+L WD           +   + +  ++LT 
Sbjct: 104 HSLTFGPQFLAFSKFALAFPVVYHTYNGIRHLAWDAGKGFKIPEVYRSGYVVLGLTVLTS 163

Query: 120 LIVWII 125
           + +  +
Sbjct: 164 IGLAAM 169


>gi|119183341|ref|XP_001242721.1| hypothetical protein CIMG_06617 [Coccidioides immitis RS]
          Length = 305

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/130 (27%), Positives = 59/130 (45%), Gaps = 5/130 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVV-FWFFCIANGEHTLSS 59
           ++  + NRP+SPHL IYR   + ++S ++RITGSV+  G  V    +    A G H  S+
Sbjct: 176 LAQQRLNRPVSPHLTIYRPQISWYLSALNRITGSVLSGGLYVFATAYLVAPAIGWHLESA 235

Query: 60  LRCYMDGSVFEVCLF----LYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
                 G++     F            H + G+R+LIWD+   L  K         +  S
Sbjct: 236 SLAAAFGALPLAAKFAIKLGVAMPFTFHCMNGVRHLIWDLGKKLSNKEVIATGWTVVGLS 295

Query: 116 ILTVLIVWII 125
           + +   + +I
Sbjct: 296 MASAFALALI 305


>gi|221220958|gb|ACM09140.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Salmo salar]
          Length = 186

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 52/116 (44%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K NRP+SPHL IY++     +S  HR TG +  + +  V    F   N    L ++R
Sbjct: 51  KNVKLNRPVSPHLSIYKMELPPLLSGSHRTTGFIFTVMSVSVATMSFLPWNWATILETMR 110

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASIL 117
            Y+         F     V +H   GIR+L+WD+          +   + I  ++L
Sbjct: 111 YYVPYPPIVFAKFGCVAGVSYHFFNGIRHLVWDLGYGFKMPTLYKTGYLVIALALL 166


>gi|148251845|ref|YP_001236430.1| succinate dehydrogenase subunit C [Bradyrhizobium sp. BTAi1]
 gi|146404018|gb|ABQ32524.1| succinate dehydrogenase subunit C [Bradyrhizobium sp. BTAi1]
          Length = 111

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 58/107 (54%)

Query: 23  MFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIH 82
           M +SIVHR TG  +Y GT ++ +W    A+G    S ++ +M   +  + +F YTWA++H
Sbjct: 1   MILSIVHRATGVALYFGTLLLAWWLIAAASGPSAYSYVQGFMGSFLGRLIMFGYTWALLH 60

Query: 83  HMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV 129
           H+L GIR+ +WD+           +    +I  I   ++VWI+   V
Sbjct: 61  HLLSGIRHFVWDLGYGFKPNERETLTWGALIGGITLTVLVWIVAYAV 107


>gi|294676288|ref|YP_003576903.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter
           capsulatus SB 1003]
 gi|294475108|gb|ADE84496.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodobacter
           capsulatus SB 1003]
          Length = 132

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 2/113 (1%)

Query: 5   KNNRPLSPHL--QIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +  RPLSP +    YR   T   SI+ RITG+ +  G  +  +W     +       +  
Sbjct: 6   RVERPLSPFMIGPYYRPQMTSMSSILTRITGNALIAGFLLGAWWLIAAVSSPGYFGFVNW 65

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
            +   +  +      WA+ +H L G+R+L+WD    LD + A ++    II S
Sbjct: 66  IVTSWLGWLIFAGMAWAMWYHYLTGLRHLLWDTGKGLDIETAEKLGWGAIIGS 118


>gi|224824513|ref|ZP_03697620.1| succinate dehydrogenase, cytochrome b556 subunit [Lutiella
           nitroferrum 2002]
 gi|224603006|gb|EEG09182.1| succinate dehydrogenase, cytochrome b556 subunit [Lutiella
           nitroferrum 2002]
          Length = 124

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 58/122 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++  RP    L   RL     VSI+HRI+G  ++   P++++      +      + R  
Sbjct: 1   MQKQRPKHLDLAKIRLPIPGIVSILHRISGVALFFSLPLLIYLLHGTLSSAEAFDAYRAV 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + ++ L    WA +HH   GIR+L  DV   L+ + A   AK  I+ S+   +I+ 
Sbjct: 61  VSHPLMKLVLIGLLWAFMHHFCAGIRFLFLDVHKGLELQTARATAKSVIVISLALTVILG 120

Query: 124 II 125
           ++
Sbjct: 121 VV 122


>gi|28869397|ref|NP_792016.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|28852638|gb|AAO55711.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|330875700|gb|EGH09849.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|331018601|gb|EGH98657.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 124

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HRI+G ++++G  ++++        E     ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVGIAIMLYAMDKSLASEEGFGEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ ++    A+++HM+ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  LTSPLAKLIIWGLLSALLYHMVAGIRHLIMDTGVGETLEGGKLGSKIVIAVSVVLILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|225713228|gb|ACO12460.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Lepeophtheirus salmonis]
          Length = 173

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 3/125 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY-LGTPVVVFWFFCIANGEHTLSSL 60
            + + NRPLSPHL IY+   T  +SI HR TG  +  +     +  F   +N    L SL
Sbjct: 51  KNKRLNRPLSPHLTIYKPQLTSMLSITHRGTGIFLTGVVYAGGLIPFLLPSNFPTFLQSL 110

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  S+  +  F   +    H   GIR+L WD+ + L  +       + +  +++T +
Sbjct: 111 E--VAPSLILLFKFGIAFPFAFHSWNGIRHLFWDMGIGLKIREVYSSGSLVVALALVTSV 168

Query: 121 IVWII 125
           I+ ++
Sbjct: 169 ILTVL 173


>gi|290560974|gb|ADD37889.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           [Lepeophtheirus salmonis]
          Length = 173

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 3/125 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY-LGTPVVVFWFFCIANGEHTLSSL 60
            + + NRPLSPHL IY+   T  +SI HR TG  +  +     +  F   +N    L SL
Sbjct: 51  KNKRLNRPLSPHLTIYKPQLTSMLSITHRGTGIFLTGVVYAGGLIPFLLPSNFPTFLQSL 110

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  S+  +  F   +    H   GIR+L WD+ + L  +       + +  +++T +
Sbjct: 111 E--VAPSLILLFKFGIAFPFAFHSWNGIRHLFWDMGIGLKIREVYSSGSLVVALALVTSV 168

Query: 121 IVWII 125
           I+ ++
Sbjct: 169 ILTVL 173


>gi|149911925|ref|ZP_01900524.1| succinate dehydrogenase, cytochrome b556 subunit [Moritella sp.
           PE36]
 gi|149805018|gb|EDM65046.1| succinate dehydrogenase, cytochrome b556 subunit [Moritella sp.
           PE36]
          Length = 128

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 61/122 (50%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  LQ   +  T   SI+HRI+G ++     ++++      + E    + +  
Sbjct: 5   VKKQRPVNLDLQTIDMPITAIASILHRISGVIMLFAVGILLWLLAESLSSEQGFQNAQEI 64

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           + G      L+    A+ +H+ GGIR+L+ D+    + +     AK++ +A+++  ++  
Sbjct: 65  VSGFFGTFILWGILTALAYHIAGGIRHLLMDMGYFEELESGALSAKVSFVATVVLSILAG 124

Query: 124 II 125
           I+
Sbjct: 125 IM 126


>gi|213968188|ref|ZP_03396333.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301383807|ref|ZP_07232225.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato Max13]
 gi|302059585|ref|ZP_07251126.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato K40]
 gi|302133374|ref|ZP_07259364.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213927168|gb|EEB60718.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tomato T1]
          Length = 124

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HR++G ++++G  ++++        E     ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRVSGVILFVGIAIMLYAMDKSLASEEGFGEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ ++    A+++HM+ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  LTSPLAKLIIWGLLSALLYHMVAGIRHLIMDTGVGETLEGGKLGSKIVIAVSVVLILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|85544002|pdb|1YQ3|C Chain C, Avian Respiratory Complex Ii With Oxaloacetate And
           Ubiquinone
 gi|85544006|pdb|1YQ4|C Chain C, Avian Respiratory Complex Ii With 3-Nitropropionate And
           Ubiquinone
          Length = 141

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 2/127 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIA-NGEHTLSSL 60
            + K++RPLSPH+ IY+    M +SI HR TG  + LG  +       +     H ++ +
Sbjct: 15  KNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSLAALLLPEQFPHYVAVV 74

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +       +     F   + + +H   GIR+L+WD+          Q   + +I ++L+ 
Sbjct: 75  KSLSLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQVEQSGVVVLILTLLSS 134

Query: 120 LIVWIIK 126
             +  I 
Sbjct: 135 AGIAAIS 141


>gi|330862922|emb|CBX73057.1| succinate dehydrogenase cytochrome b556 subunit [Yersinia
           enterocolitica W22703]
          Length = 143

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 60/125 (48%), Gaps = 1/125 (0%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
            ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      + +       
Sbjct: 17  KTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVMTFVAVGILLWLLGLSVSSQEGFMQAA 76

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTVL 120
             M+    +   +    A+ +H+ GGIR+L+ D     +     T+ A++ ++ +++  +
Sbjct: 77  AVMNSFFVKFIFWGILTALAYHVCGGIRHLLMDFGYVEESLAAGTRSAQVVMVLTLVLSV 136

Query: 121 IVWII 125
           +  ++
Sbjct: 137 LAGVL 141


>gi|295096572|emb|CBK85662.1| succinate dehydrogenase subunit C [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 159

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 60/126 (47%), Gaps = 5/126 (3%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  L+  R   T   SI+HR++G + ++   ++++      +          
Sbjct: 34  NVKKQRPVNLDLKTIRFPVTAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFLQASA 93

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD-----KKIATQMAKINIIASIL 117
            M+    +  ++    A+ +H++GG+R+++ D     +     K+ A     I ++ S+L
Sbjct: 94  IMNSFFVKFIMWGILTALAYHVVGGVRHMLMDFGYLEETFEAGKRTANISFVITVVLSLL 153

Query: 118 TVLIVW 123
             ++VW
Sbjct: 154 AGVLVW 159


>gi|307295105|ref|ZP_07574947.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306879579|gb|EFN10797.1| succinate dehydrogenase, cytochrome b556 subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 131

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 1/121 (0%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY-LGTPVVVFWFFCIANGEHTLSSLRCY 63
             +RPLSPHL I++  P M VSI+HR+TG+ +   G   +V+W    A+G    ++    
Sbjct: 4   TTSRPLSPHLTIWKWGPAMAVSIMHRVTGNGLATAGALGLVWWLMAAASGPEAYATFVTC 63

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
               +  + +   +W    H+  G+R+ + D+    + K     + +  + S    +  W
Sbjct: 64  ATSPIGYLVMAGLSWFFFQHLCSGLRHFVLDMGAGYELKNNKLWSVLTFVLSTSLTIAFW 123

Query: 124 I 124
            
Sbjct: 124 A 124


>gi|71737948|ref|YP_274200.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257485479|ref|ZP_05639520.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289624405|ref|ZP_06457359.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289646681|ref|ZP_06478024.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298486513|ref|ZP_07004573.1| Succinate dehydrogenase cytochrome b-556 subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|71558501|gb|AAZ37712.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298158990|gb|EFI00051.1| Succinate dehydrogenase cytochrome b-556 subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320329258|gb|EFW85255.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330880846|gb|EGH14995.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|331010660|gb|EGH90716.1| succinate dehydrogenase, cytochrome b556 subunit [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 124

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HRI+G ++++G  ++++        E     ++  
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVGIAIMLYAMDKSLASEEGFGEVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ ++    A+++HM+ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  LTSPLAKLIIWGLLSALLYHMVAGIRHLIMDSGVGETLEGGKLGSKIVIAVSVVLILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|149374990|ref|ZP_01892763.1| succinate dehydrogenase (C subunit) [Marinobacter algicola DG893]
 gi|149360879|gb|EDM49330.1| succinate dehydrogenase (C subunit) [Marinobacter algicola DG893]
          Length = 150

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 68/125 (54%), Gaps = 2/125 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLR 61
           S++ + RP++  L  +        SI+HR++G ++++G   +++      +GE   S + 
Sbjct: 25  SAVNSKRPVNLDLGKFHFPLPAITSILHRVSGIIIFVGVAFMLYGLQLSLSGEEGFSRVS 84

Query: 62  CYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI 121
             +D  + ++  +    A+++H++ GI++L+ D+ +  + +     AK  ++ S++ +L+
Sbjct: 85  DLLDSFLAKLITWGILSALLYHLVAGIKHLLMDMGIGEELESGRLAAKATVVISVILILL 144

Query: 122 --VWI 124
             VW+
Sbjct: 145 AGVWV 149


>gi|119572984|gb|EAW52599.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, 15kDa, isoform CRA_b [Homo sapiens]
          Length = 189

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 2/109 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +I +NRPLSPH+ IY     M +SI HR TG  +  G  +  +       N E  L  +
Sbjct: 64  KNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELV 123

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMA 108
           +    G  +     F   + +++H   GIR+L+WD+   L      Q  
Sbjct: 124 KSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSG 172


>gi|290510449|ref|ZP_06549819.1| LOW QUALITY PROTEIN: succinate dehydrogenase, cytochrome b556
           subunit [Klebsiella sp. 1_1_55]
 gi|289777165|gb|EFD85163.1| LOW QUALITY PROTEIN: succinate dehydrogenase, cytochrome b556
           subunit [Klebsiella sp. 1_1_55]
          Length = 147

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +      +   
Sbjct: 22  NVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFLTAAS 81

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLC-LDKKIATQMAKINIIASILTVLI 121
            MD    +  ++    A+ +H++ GIR+L+ D        +   + AKI+ + +++  L+
Sbjct: 82  IMDSFFVKFIMWGILTALAYHVVVGIRHLMMDFGYLDETLEAGKRSAKISFVITVVLSLL 141

Query: 122 VWII 125
             ++
Sbjct: 142 AGVL 145


>gi|34496520|ref|NP_900735.1| succinate dehydrogenase cytochrome b-556 subunit [Chromobacterium
           violaceum ATCC 12472]
 gi|34102374|gb|AAQ58740.1| succinate dehydrogenase cytochrome b-556 subunit [Chromobacterium
           violaceum ATCC 12472]
          Length = 125

 Score =  117 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 59/123 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           ++  RP    L   RL    FVSI+HR++G  ++   P++++      +   +  + +  
Sbjct: 1   MQKQRPKHLDLARIRLPVPGFVSILHRVSGVALFFSLPLLIYLLHGSLSSAESFDTYKAV 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           +   + ++ L    WA +HH   GIR+L  D+   L+ + A   AK  ++ S++   ++ 
Sbjct: 61  VSHPLMKLALLGLIWAYLHHFCAGIRFLFLDIHKGLELETARGTAKTVLVVSLVLTAVLG 120

Query: 124 IIK 126
            I 
Sbjct: 121 GIA 123


>gi|117618735|ref|YP_856454.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560142|gb|ABK37090.1| succinate dehydrogenase, cytochrome b556 subunit [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 129

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 58/121 (47%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RP++  LQ      T   SI+HR++G + ++   ++++             ++   M
Sbjct: 7   NKQRPVNLDLQTISFPVTAIASILHRVSGVITFVALSILLWMLGTSLASPEGFETVVSIM 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           D  + +  L+    A+ +H++GG+R+L+ D+    + +   Q A++  + + +  ++  +
Sbjct: 67  DNFLVKFVLWGILTALAYHIVGGLRHLVMDMGYWEELESGNQSARVAFVITAVLAVLAGV 126

Query: 125 I 125
           +
Sbjct: 127 L 127


>gi|167648795|ref|YP_001686458.1| succinate dehydrogenase, cytochrome b556 subunit [Caulobacter sp.
           K31]
 gi|167351225|gb|ABZ73960.1| succinate dehydrogenase, cytochrome b556 subunit [Caulobacter sp.
           K31]
          Length = 135

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 61/120 (50%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66
            RPLSPHLQ++R   TM  SI+HR     +Y+G  ++  W   +A+G    ++    +  
Sbjct: 10  ERPLSPHLQVWRWHITMACSILHRGCIFALYVGVLLLAGWGLALASGPDAYAAFTGCLGS 69

Query: 67  SVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
            + ++ LF  T AV+ ++   +R   WD+      KIA       I  +++  ++VW+I 
Sbjct: 70  PLGKLVLFGLTVAVLFNIAYTVRQSFWDMGKGFTPKIADMTGACAIAFAVVGAIVVWVIA 129


>gi|225713156|gb|ACO12424.1| Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
           precursor [Lepeophtheirus salmonis]
          Length = 173

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 3/122 (2%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVY-LGTPVVVFWFFCIANGEHTLSSL 60
            + + NRPLSPHL IY+   T  +SI HR TG  +  +     +  F   +N    L SL
Sbjct: 51  KNKRLNRPLSPHLTIYKPQLTSMLSITHRGTGIFLTGVVYAGGLIPFLLPSNFPTFLQSL 110

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
              +  S+  +  F   +    H   GIR+L WD+ + L  +       + +  +++T +
Sbjct: 111 E--VAPSLILLFKFGIAFPFAFHSWNGIRHLFWDMGIGLKIREVYSSGSLVVALALVTSV 168

Query: 121 IV 122
           I+
Sbjct: 169 IL 170


>gi|258571015|ref|XP_002544311.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237904581|gb|EEP78982.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 204

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 5/130 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVV-FWFFCIANGEH---- 55
           ++  + NRP++PHL IY+   + ++S ++RITG  V  G  +    +    A G H    
Sbjct: 75  LAKQRLNRPVAPHLSIYKPQISWYLSALNRITGCTVSGGLYLFATAYLVAPAVGWHLESM 134

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
           +L++    +  +      F        H + G+R+L+WD    +  K         +  S
Sbjct: 135 SLAAAFGALPLAAKFAIKFGVAMPFTFHCMNGVRHLVWDFGKKMTNKDVIATGWTVVGLS 194

Query: 116 ILTVLIVWII 125
           + + L + +I
Sbjct: 195 VASSLALALI 204


>gi|21242814|ref|NP_642396.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|21108300|gb|AAM36932.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|50981400|gb|AAT91478.1| succinate dehydrogenase subunit C [Xanthomonas citri]
          Length = 131

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 57/119 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLTVGALAIAAALLTLMLGPDHWNCFRAQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++    +W 
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTAAIWA 122


>gi|325917571|ref|ZP_08179771.1| succinate dehydrogenase subunit C [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536205|gb|EGD08001.1| succinate dehydrogenase subunit C [Xanthomonas vesicatoria ATCC
           35937]
          Length = 131

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 56/119 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+YR    M  SI++R TG V+  G   +      +  G      LR +  
Sbjct: 4   RERPLSPHLQVYRWQIQMVTSILNRATGIVLSFGALAIAAALLTLMLGPEHWDCLRQHAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW    H+ GG+R+++ D       +    +  ++++ S++    +W 
Sbjct: 64  AWYGQVFLFGWTWCFAFHLFGGLRHIMQDFGQGYAVRSFVSLGWLSVVLSLVLTAAIWA 122


>gi|330811091|ref|YP_004355553.1| succinate dehydrogenase (succinate dehydrogenase cytochrome b556
           subunit) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379199|gb|AEA70549.1| Succinate dehydrogenase (Succinate dehydrogenase cytochrome b556
           subunit) [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 124

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K+ RP++  L+  +L  T + SI+HRI+G ++++   ++++      + E     ++  
Sbjct: 1   MKSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVSLAIMLYALDKSLDSEEGFGQVKAC 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           +   + ++ ++    A+++H++ G+R+LI D+ +    +     +KI I  S + +++  
Sbjct: 61  LTSPLAKLVIWGILSALLYHLVAGVRHLIMDMGIGETLEGGKLGSKIIIAVSAVLIVLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|195038233|ref|XP_001990564.1| GH19420 [Drosophila grimshawi]
 gi|193894760|gb|EDV93626.1| GH19420 [Drosophila grimshawi]
          Length = 171

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGT-PVVVFWFFCIANGEHTLSSL 60
            + +  R +SPHL IY+   T  +SI+HR TG  + +G   + +       +  H ++ +
Sbjct: 46  KNERLGREMSPHLTIYKPQLTSMLSIMHRGTGLALGMGVWGLGLGALIASQDISHYVTMV 105

Query: 61  RCY-MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               + G+      F+  + V +H   GIR+L+WD    L  K         + AS +  
Sbjct: 106 EGLQLSGATLTAIKFIIAYPVGYHSANGIRHLLWDTGRFLKIKEVYSTGYAMVAASFVLT 165

Query: 120 LIVWII 125
            I+ ++
Sbjct: 166 AILALL 171


>gi|157120010|ref|XP_001653486.1| succinate dehydrogenase [Aedes aegypti]
 gi|94468558|gb|ABF18128.1| mitochondrial succinate dehydrogenase cytochrome b subunit [Aedes
           aegypti]
 gi|108875100|gb|EAT39325.1| succinate dehydrogenase [Aedes aegypti]
          Length = 171

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 46/120 (38%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           + +  RP SPHL IY    T  +SI HR+TG  +     ++      + +      ++  
Sbjct: 49  NARLQRPQSPHLTIYAPQLTSMLSITHRMTGMALAGYATMMGLGALALPHDATHYLTMLE 108

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +         F   +    H + G+R+L WD+   L  K         ++ S +    +
Sbjct: 109 GLSAPTLMALKFTLAYPFAFHSVNGVRHLFWDMGKFLTIKEVYSTGYTMLLVSGVVAAAL 168


>gi|66045245|ref|YP_235086.1| succinate dehydrogenase, cytochrome b subunit [Pseudomonas syringae
           pv. syringae B728a]
 gi|63255952|gb|AAY37048.1| Succinate dehydrogenase, cytochrome b subunit [Pseudomonas syringae
           pv. syringae B728a]
          Length = 124

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           + + RP++  L+  +L  T + SI+HRI+G ++++G  ++++        E     ++ Y
Sbjct: 1   MNSQRPVNLDLRTIKLPVTAYTSILHRISGVILFVGIAIMLYAMDKSLASEEGFGEVKAY 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLI-- 121
           M   + ++ ++    A+++H++ GIR+LI D  +    +     +KI I  S++ +L+  
Sbjct: 61  MTSPLAKLIIWGLLSALLYHLVAGIRHLIMDSGVGETLEGGKLGSKIVIAVSVILILLAG 120

Query: 122 VWI 124
           VWI
Sbjct: 121 VWI 123


>gi|257093959|ref|YP_003167600.1| succinate dehydrogenase, cytochrome b556 subunit [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046483|gb|ACV35671.1| succinate dehydrogenase, cytochrome b556 subunit [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 130

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 62/120 (51%)

Query: 3   SIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRC 62
           +IK  RP +  L   RL     +SI+HR++G+ ++L  PV+++ F        T ++++ 
Sbjct: 5   AIKKRRPKNLDLPTIRLPLPGILSILHRVSGAGLFLMLPVLLWLFQGSLASSETFAAVKG 64

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +   V ++ L    W  +HH   GIRYL+ D+   ++ + A   +KI    SI   LI+
Sbjct: 65  VVGHPVAKIVLLGLIWFYMHHFCAGIRYLLLDLHKGIELEAARLSSKIVFAVSIALTLII 124


>gi|145299317|ref|YP_001142158.1| succinate dehydrogenase cytochrome b556 large membrane subunit
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852089|gb|ABO90410.1| succinate dehydrogenase cytochrome b556 subunit [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 129

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 58/121 (47%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RP++  LQ      T   SI+HR++G + ++   ++++             ++   M
Sbjct: 7   NKQRPVNLDLQTISFPVTAIASILHRVSGVITFVALSILLWMLGTSLASPEGFETVVSIM 66

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           D  + +  L+    A+ +H++GG+R+L+ D+    + +   Q A++  + + +  ++  +
Sbjct: 67  DNFLVKFVLWGILTALAYHIVGGLRHLVMDMGYWEELESGNQSARVAFVITAILAVLAGV 126

Query: 125 I 125
           +
Sbjct: 127 L 127


>gi|46201871|ref|ZP_00054198.2| COG2009: Succinate dehydrogenase/fumarate reductase, cytochrome b
           subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 109

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 54/108 (50%)

Query: 19  LIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTW 78
           +  T  +SI HRITG  + +GT V+ +W    A G       +  +   + ++ LF +T 
Sbjct: 1   MPFTAILSISHRITGVALAVGTIVLAYWLASAAYGPVAYGHAQAVLGSVLGKLVLFGWTA 60

Query: 79  AVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIK 126
           A+ +H+  GIR+L WD     +   A +  ++ + A+ L  ++ W+  
Sbjct: 61  ALFYHLCNGIRHLFWDKGRGYEIAEADKSGRMVVGAAALLTVLAWVFG 108


>gi|53850596|ref|NP_001005534.1| succinate dehydrogenase complex, subunit C [Rattus norvegicus]
 gi|51980592|gb|AAH82027.1| Succinate dehydrogenase complex, subunit C, integral membrane
           protein [Rattus norvegicus]
 gi|149040638|gb|EDL94595.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_b [Rattus norvegicus]
          Length = 169

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +  +NRP+SPHL IYR    M +S+ HR +G  +  G  +  +       N E  L  +
Sbjct: 44  KNTSSNRPVSPHLTIYRWSLPMAMSVCHRGSGIAMSGGVSLFGLSALLLPGNFESYLMLV 103

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F+  + +++H L G+R+L+WD+   L            ++ ++L+ 
Sbjct: 104 KSLCLGPALIHAAKFVLVFPLMYHSLNGVRHLMWDLGKGLSISQVQLSGVTVLVLAVLSS 163

Query: 120 LIVWII 125
             +  I
Sbjct: 164 AGLAAI 169


>gi|119479383|ref|XP_001259720.1| succinate dehydrogenase cytochrome b560 subunit [Neosartorya
           fischeri NRRL 181]
 gi|119407874|gb|EAW17823.1| succinate dehydrogenase cytochrome b560 subunit [Neosartorya
           fischeri NRRL 181]
          Length = 188

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 57/130 (43%), Gaps = 5/130 (3%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVV-----YLGTPVVVFWFFCIANGEH 55
           ++  + NRP+SPHL IYR   T   S  HRITG  +        T  +    F       
Sbjct: 59  LAQQRLNRPVSPHLSIYRPQITWIGSSAHRITGIALSGSLYLFATAYLAAPLFGWHLESA 118

Query: 56  TLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIAS 115
           ++++    +  +          +  ++H L G+R+L+WD+   +  +   +     +  +
Sbjct: 119 SIAAAFGALPIAAKVFIKGTAAFPFVYHCLNGVRHLVWDLGRGISNQQVIKSGWTVVGLT 178

Query: 116 ILTVLIVWII 125
           +++ L + ++
Sbjct: 179 VVSALTLALL 188


>gi|85374260|ref|YP_458322.1| hypothetical protein ELI_07165 [Erythrobacter litoralis HTCC2594]
 gi|84787343|gb|ABC63525.1| hypothetical protein ELI_07165 [Erythrobacter litoralis HTCC2594]
          Length = 126

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 1/123 (0%)

Query: 7   NRPLSPHLQIYRLIPTMFVSIVHRITGSVVYL-GTPVVVFWFFCIANGEHTLSSLRCYMD 65
           NRPLSPHLQI++  P M VSI+HRITG  + L G  V+++W   +A+G     +      
Sbjct: 3   NRPLSPHLQIWKWGPHMLVSILHRITGDGMALVGLGVLLWWLGALASGPEAYETFSTLAT 62

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWII 125
             +  V L   +WA   H++ G+R+ + D+    +       + ++ +  +L  +  W +
Sbjct: 63  TPIGYVVLVGLSWAFFTHLMSGLRHFVLDIGAGYELDTNKMWSIVSPVLGVLLTVAFWAV 122

Query: 126 KDI 128
             +
Sbjct: 123 VLL 125


>gi|330829371|ref|YP_004392323.1| succinate dehydrogenase cytochrome b556 subunit [Aeromonas veronii
           B565]
 gi|328804507|gb|AEB49706.1| Succinate dehydrogenase cytochrome b556 subunit [Aeromonas veronii
           B565]
          Length = 125

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 59/121 (48%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYM 64
              RP++  LQ      T   SI+HR++G + ++   ++++             ++   M
Sbjct: 3   NKQRPVNLDLQTISFPVTAIASILHRVSGVITFVALGILLWMLGTSLASPEGFETVVAIM 62

Query: 65  DGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
           D  + ++ L+    A+ +H++GG+R+L+ D+    + +   Q A++  + + +  ++  +
Sbjct: 63  DNFLVKLVLWGILTALAYHIVGGLRHLVMDMGYWEELESGNQSARVAFVITAILAVLAGV 122

Query: 125 I 125
           +
Sbjct: 123 L 123


>gi|239993980|ref|ZP_04714504.1| succinate dehydrogenase, cytochrome b subunit [Alteromonas
           macleodii ATCC 27126]
          Length = 124

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 58/121 (47%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L   +  P+   SI+HR+TG  ++     V++ +    +     + ++  
Sbjct: 1   MKKQRPVNLELNTIKFPPSAISSILHRVTGVAMFFALLFVIWAWAVSVHSPEGFADVQAI 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           MDG   +        A+ +H+LGG+R+++ D+    + +     AK  I   ++  +++ 
Sbjct: 61  MDGFFGKFVAIGTASALTYHILGGLRHVVMDLGHWEELESGNTSAKAVIALWVVLTVVLG 120

Query: 124 I 124
           +
Sbjct: 121 V 121


>gi|221134277|ref|ZP_03560582.1| succinate dehydrogenase, cytochrome b subunit [Glaciecola sp.
           HTCC2999]
          Length = 124

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 59/121 (48%)

Query: 4   IKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY 63
           +K  RP++  L   +  P+   SI+HR+TG  ++     V++ +      E   ++++  
Sbjct: 1   MKKQRPVNLDLNTIKFPPSAISSILHRVTGVAMFFALLFVIWAWAVSLGSEEGFNNVQII 60

Query: 64  MDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVW 123
           MDG + +        A+ +H+LGGIR+ I D+    + +     A + I   ++  +I+ 
Sbjct: 61  MDGFLGKFVAIGTVSALTYHILGGIRHGIMDMGYWEELESGNTSANVVIGIWVVLTVILG 120

Query: 124 I 124
           +
Sbjct: 121 V 121


>gi|78047797|ref|YP_363972.1| putative succinate dehydrogenase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036227|emb|CAJ23918.1| putative succinate dehydrogenase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 131

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 57/119 (47%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RPLSPHLQ+Y     M  SI++R TG V+ +G   +      +  G    +  R    
Sbjct: 4   RERPLSPHLQVYLWQIQMVTSILNRATGIVLSVGALGIAAALLTLMLGPDHWNCFRDQAA 63

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124
               +V LF +TW+   H+ GG+R+++ D       +    M  ++++ S++  + +W 
Sbjct: 64  TWYGQVFLFGWTWSFAFHLFGGLRHMLQDFGQGYAVRSFISMGWLSVVLSLVLTIAIWA 122


>gi|162147201|ref|YP_001601662.1| succinate dehydrogenase cytochrome b556 subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785778|emb|CAP55349.1| putative Succinate dehydrogenase cytochrome b556 subunit
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 153

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 60/117 (51%)

Query: 6   NNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMD 65
             RP+SPHLQ+YR   +MF+SI +R  G     G+ + V W    A G  +   ++    
Sbjct: 19  TRRPMSPHLQVYRFRLSMFLSIANRAAGVAAAAGSVLGVCWLNAAAKGPESFKKVQKVTR 78

Query: 66  GSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
             + ++ L  +T ++++H + G+R+L WD     +KK   +   I +  ++ T L +
Sbjct: 79  NPLGKLALVGWTLSLVYHFVAGLRHLSWDAGYRFEKKEINEDGPIAVGVTVGTTLAL 135


>gi|149040639|gb|EDL94596.1| succinate dehydrogenase complex, subunit C, integral membrane
           protein, isoform CRA_c [Rattus norvegicus]
          Length = 150

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVV-VFWFFCIANGEHTLSSL 60
            +  +NRP+SPHL IYR    M +S+ HR +G  +  G  +  +       N E  L  +
Sbjct: 25  KNTSSNRPVSPHLTIYRWSLPMAMSVCHRGSGIAMSGGVSLFGLSALLLPGNFESYLMLV 84

Query: 61  RCYMDGS-VFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
           +    G  +     F+  + +++H L G+R+L+WD+   L            ++ ++L+ 
Sbjct: 85  KSLCLGPALIHAAKFVLVFPLMYHSLN