HHsearch alignment for GI: 254781042 and conserved domain: PRK13554

>PRK13554 fumarate reductase cytochrome b-556 subunit; Provisional.
Probab=97.80  E-value=0.00083  Score=42.12  Aligned_cols=118  Identities=9%  Similarity=0.072  Sum_probs=83.6

Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             48998305542210899999999999999999999999996289998999999946259999999999999999840488
Q gi|254781042|r    8 SLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQV   87 (130)
Q Consensus         8 ~~~~~rglgsa~~G~~hW~~QRiSAi~L~~l~i~~i~~~~~~~~~~y~~~~~~~~~~~~~il~~l~~~~~~~Ha~lGl~~   87 (130)
T Consensus       111 ~~~h~~~m~--H~DT~LW~~Q~~TGf~lffl~~vHL~~ilt~p~I~~~~SA~Rv~~~~~w~fYl~LL~~VelHa~IGlYR  188 (241)
T PRK13554        111 LRSHMGSIK--HKDTHAWFWQLITGFILFFLVPVHLFTMILNPEIGPHLSAERVYHDNAWLLYALLLPAVVIHAMIGLYR  188 (241)
T ss_pred             HHHHHHHCC--CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHE
T ss_conf             999984578--888720899999999999999989988650799881051899964760999999999999997764311


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99851277318999999999999999999999999999642
Q gi|254781042|r   88 IIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILG  128 (130)
Q Consensus        88 IieDYI~~~~~k~~~~~~~~~~~~~~~~~~i~~i~~i~l~g  128 (130)
T Consensus       189 l~VKWG~~~~-R~~lrk~~~~ltv~fivlGllsL~af~~iG  228 (241)
T PRK13554        189 VAVKWGLTTN-RSGLRKVAKVLIIYLLCLGTLSLVSYIFIG  228 (241)
T ss_pred             EEEEEEEECC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             4534100035-799999999999999999999999999956