HHsearch alignment for GI: 254781042 and conserved domain: cd00581

>cd00581 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinone oxidoreductase (SQR). QFRs oxidize low potential quinols such as menaquinol and rhodoquinol and are involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunit. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron donor (quinol). The
Probab=97.98  E-value=0.00026  Score=45.09  Aligned_cols=117  Identities=8%  Similarity=0.003  Sum_probs=83.8

Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8998305542210899999999999999999999999996289-998999999946259999999999999999840488
Q gi|254781042|r    9 LGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQV   87 (130)
Q Consensus         9 ~~~~rglgsa~~G~~hW~~QRiSAi~L~~l~i~~i~~~~~~~~-~~y~~~~~~~~~~~~~il~~l~~~~~~~Ha~lGl~~   87 (130)
T Consensus        87 ~~h~~~m~--H~DT~lW~~Q~~TGf~lffl~~iHL~~i~t~~~~I~~~~Sa~Rv~~~~~~~fYl~LL~~VelH~~IGlYR  164 (206)
T cd00581          87 RRHMQLMK--HGDTSLWWIQAVTGFVLFFLASAHLYEMLTNPEIIGPHTSAYRVVHGGWWLLYLALLPAVELHGGIGLYR  164 (206)
T ss_pred             HHHHHHCC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99984477--8876018999999999999999999999748511374021899975771999999999999998654441


Q ss_pred             HHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9985127-731899999999999999999999999999964
Q gi|254781042|r   88 IIEDYIH-YRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAIL  127 (130)
Q Consensus        88 IieDYI~-~~~~k~~~~~~~~~~~~~~~~~~i~~i~~i~l~  127 (130)
T Consensus       165 l~VKWG~~~~~~R~~lrk~~~~~~~~fl~lGl~tL~a~~~i  205 (206)
T cd00581         165 LAVKWGWFASESRKRLRRIKNVLSAFFLVLGLLTLLAYIKI  205 (206)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             13446413644569999999999999999999999999953