HHsearch alignment for GI: 254781042 and conserved domain: cd03493

>cd03493 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction. SQR, also called succinate dehydrogenase or Complex II, is part of the citric acid cycle and the aerobic respiratory chain, while QFR is involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQRs may reduce either high or low potential quinones while QFRs oxidize only low potential quinols. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit(s) containing the electron donor/acceptor (quinol or quinone). The reversible reduction of
Probab=99.23  E-value=1.2e-10  Score=81.90  Aligned_cols=88  Identities=22%  Similarity=0.263  Sum_probs=73.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHH--HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--HHHHHH
Q ss_conf             999999999999999999999962899989--9999994625999999999999999984048899851277--318999
Q gi|254781042|r   26 IKQRFTAIANIPFIIFFIAFFIKYGDAPYE--QIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHY--RLLKIM  101 (130)
Q Consensus        26 ~~QRiSAi~L~~l~i~~i~~~~~~~~~~y~--~~~~~~~~~~~~il~~l~~~~~~~Ha~lGl~~IieDYI~~--~~~k~~  101 (130)
T Consensus         1 ~~~Ritgv~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~H~~~Gir~~~~D~~~~~~~~~~~~   80 (98)
T cd03493           1 ILHRITGVALLLFLPLHLLGLLALLGGPYAFAEVVAFLSSPLGKLLYLLLLLALLYHALNGIRHLIWDYGKGLELKLRKA   80 (98)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCHHHHHHHCCCCCCHHHHHH
T ss_conf             92113779999999999999999806989999999999269999999999999999974072677442011466899999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q gi|254781042|r  102 FLFMNSCFVLLL  113 (130)
Q Consensus       102 ~~~~~~~~~~~~  113 (130)
T Consensus        81 ~~~~~~~~~~~~   92 (98)
T cd03493          81 LGYAVLALSVLL   92 (98)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999