HHsearch alignment for GI: 254781042 and conserved domain: pfam02967

>pfam02967 consensus.
Probab=98.14  E-value=0.00012  Score=47.01  Aligned_cols=113  Identities=12%  Similarity=0.048  Sum_probs=84.9

Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             48998305542210899999999999999999999999996289-99899999994625999999999999999984048
Q gi|254781042|r    8 SLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQ   86 (130)
Q Consensus         8 ~~~~~rglgsa~~G~~hW~~QRiSAi~L~~l~i~~i~~~~~~~~-~~y~~~~~~~~~~~~~il~~l~~~~~~~Ha~lGl~   86 (130)
T Consensus       107 ~~~h~~~m~--H~DT~lW~~Q~~Tgf~lffl~~vHL~~i~~~~~~I~~~~Sa~Rv~~~~~~~fYl~LL~~V~lH~~IGlY  184 (223)
T pfam02967       107 LRAHKQRMK--HKDTTLWWWQAVTGFALFFLASVHLFTILTNPETIGPHLSAERIYHGNMWLLYLLLLPAVELHAGIGLY  184 (223)
T ss_pred             HHHHHHHCC--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             999983578--887602899999999999999999999971802078367789995787199999999999999887676


Q ss_pred             HHHHHHC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8998512--77318999999999999999999999999
Q gi|254781042|r   87 VIIEDYI--HYRLLKIMFLFMNSCFVLLLIIFCLFSLL  122 (130)
Q Consensus        87 ~IieDYI--~~~~~k~~~~~~~~~~~~~~~~~~i~~i~  122 (130)
T Consensus       185 Rl~VKWG~~~~~~~r~~l~~~k~~l~~~fi~lGl~sL~  222 (223)
T pfam02967       185 RLAVKWGWIEGLENRKRLRKVKKVLSVVFIVLGLLSLL  222 (223)
T ss_pred             HHEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             32013441247104899999999999999999999972