HHsearch alignment of GI: 254781042 and MMDB domain: 1kf6_C_1-91

>1kf6_C (C:1-91) Fumarate reductase 15 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli}
Probab=95.19  E-value=0.061  Score=30.93  Aligned_cols=65  Identities=18%  Similarity=0.167  Sum_probs=52.2

Q ss_pred             CCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHC--CCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             2210899-9999999999999999999999962--899989999999462599999999999999998
Q gi|254781042|r   18 AKDGTGH-FIKQRFTAIANIPFIIFFIAFFIKY--GDAPYEQIVSVLSNVAVASIMGLGTISISVHMQ   82 (130)
Q Consensus        18 a~~G~~h-W~~QRiSAi~L~~l~i~~i~~~~~~--~~~~y~~~~~~~~~~~~~il~~l~~~~~~~Ha~   82 (130)
                      .|++-.. ....-.|++..+.+.+.+++-...+  .+.+++.+.++.+||+.-++-++.+.++++|+.
T Consensus        17 ~k~~FYr~YMlRE~T~v~~~~f~lvLl~Gl~~L~~g~~aw~~f~~fl~nPivi~lniiaL~a~L~H~~   84 (91)
T 1kf6_C           17 KKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTK   84 (91)
T ss_dssp             GSSHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHTSSHHHHHHHHHHHHHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             55848999999998589999999999999999806888999999998385999999999999999999