BLAST/PSIBLAST alignment of GI: 254781042 and GI: 116254177 at iteration 1
>gi|116254177|ref|YP_770015.1| succinate dehydrogenase hydrophobic membrane anchor protein [Rhizobium leguminosarum bv. viciae 3841] Length = 126
>gi|115258825|emb|CAK09931.1| putative succinate dehydrogenase hydrophobic membrane anchor protein [Rhizobium leguminosarum bv. viciae 3841] Length = 126
 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F + Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFVFFMLAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    K+  L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKVALLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126