BLAST/PSIBLAST alignment of GI: 254781042 and GI: 241206663 at iteration 1
>gi|241206663|ref|YP_002977759.1| succinate dehydrogenase, hydrophobic membrane anchor protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 126
>gi|240860553|gb|ACS58220.1| succinate dehydrogenase, hydrophobic membrane anchor protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 126
 Score =  148 bits (373), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (73%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F + Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFVFFMLAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI+ L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIVLLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126