BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781042|ref|YP_003065455.1| succinate dehydrogenase
hydrophobic membrane anchor [Candidatus Liberibacter asiaticus str.
psy62]
         (130 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781042|ref|YP_003065455.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040719|gb|ACT57515.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 130

 Score =  259 bits (661), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV
Sbjct: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS
Sbjct: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120

Query: 121 LLKIAILGTL 130
           LLKIAILGTL
Sbjct: 121 LLKIAILGTL 130


>gi|315122381|ref|YP_004062870.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495783|gb|ADR52382.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 128

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (89%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MRSSLG+VRGMGSAKDGTGHF+KQRFTAIANIPF+IFFI FFI+YG AP+EQIVSV+SN
Sbjct: 2   NMRSSLGKVRGMGSAKDGTGHFLKQRFTAIANIPFVIFFIIFFIRYGSAPHEQIVSVVSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
           + VASIMGLG +SI  HMQLGMQVIIEDY+H +LLKI+ L +NS FVL + +FCLFS+LK
Sbjct: 62  LFVASIMGLGAVSIFFHMQLGMQVIIEDYVHSKLLKIVLLMLNSSFVLFMAVFCLFSILK 121

Query: 124 IAILGT 129
           I+ILG 
Sbjct: 122 ISILGN 127


>gi|325294013|ref|YP_004279877.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           sp. H13-3]
 gi|325061866|gb|ADY65557.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           sp. H13-3]
          Length = 126

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 94/125 (75%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA+AN+P +IFF+ F IKY  APY ++ + LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFWRQRLTAVANVPLLIFFVVFLIKYAGAPYPEVAAALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IMGL  +S  +HM+LGMQVIIEDY+H  + K++ L +N+ F +L+   C+F++LK
Sbjct: 62  PLVAVIMGLVLVSGLIHMKLGMQVIIEDYVHGEVSKLVLLMLNTFFAVLIGGLCIFAILK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|241206663|ref|YP_002977759.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860553|gb|ACS58220.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 126

 Score =  148 bits (373), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (73%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F + Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFVFFMLAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI+ L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIVLLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|209551263|ref|YP_002283180.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537019|gb|ACI56954.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 126

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFLFFMITYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|86359477|ref|YP_471369.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Rhizobium etli CFN 42]
 gi|86283579|gb|ABC92642.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Rhizobium etli CFN 42]
          Length = 126

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA++NIP I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLFS+LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIASLCLFSILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|116254177|ref|YP_770015.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258825|emb|CAK09931.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 126

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F + Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFVFFMLAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    K+  L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKVALLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|218671677|ref|ZP_03521346.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli GR56]
          Length = 126

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA+ANIP I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTSHFWRQRLTAVANIPLILFFVIFMIAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|190893745|ref|YP_001980287.1| succinate dehydrogenase, membrane anchor subunit [Rhizobium etli
           CIAT 652]
 gi|218515348|ref|ZP_03512188.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli 8C-3]
 gi|190699024|gb|ACE93109.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli CIAT 652]
          Length = 126

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA++NIP I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|15889900|ref|NP_355581.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           tumefaciens str. C58]
 gi|15157851|gb|AAK88366.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           tumefaciens str. C58]
          Length = 126

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 94/125 (75%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF++QR TA+AN+P +IFF+ F IKY  APY ++V+ LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFLRQRVTAVANVPLLIFFVIFLIKYAGAPYPEVVAALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IM L  +S  +HM+LGMQVIIEDY+H  + K++ L +N+ F +L+    +F++LK
Sbjct: 62  PLVAVIMALVLVSGLIHMKLGMQVIIEDYVHAEVSKLVLLMLNTFFAILIGGLSIFAILK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|222150047|ref|YP_002551004.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           vitis S4]
 gi|221737029|gb|ACM37992.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           vitis S4]
          Length = 126

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 92/125 (73%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TAIAN+P ++FFI F + +  APY  +VS LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTEHFWRQRLTAIANVPLMLFFIIFMLTHAGAPYADVVSALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IMGL  +S  +HM++GMQ II DYIH  ++K+  + +N+ FV++    CLF++LK
Sbjct: 62  PLVAVIMGLVVLSGLIHMKIGMQEIIADYIHNEVMKMGLMMLNTFFVVITGALCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|218462021|ref|ZP_03502112.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli Kim 5]
          Length = 123

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 89/123 (72%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ LG+VRG+GSAK+GT HF +QR TA++NIP I+FF+ F I Y  APY  +V  LSN  
Sbjct: 1   RTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALSNPF 60

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
           VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLF++LKIA
Sbjct: 61  VAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIAGLCLFAILKIA 120

Query: 126 ILG 128
            +G
Sbjct: 121 FVG 123


>gi|227823651|ref|YP_002827624.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Sinorhizobium fredii NGR234]
 gi|227342653|gb|ACP26871.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Sinorhizobium fredii NGR234]
          Length = 126

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA++N+P + FF+ F  +Y  AP+ ++V+ L+N
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFWRQRLTAVSNLPLLTFFVFFVARYAGAPHAEVVAALAN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IM L  IS  VHM++GMQVIIEDY+H   +KI  L +N+ F + +   CLF++LK
Sbjct: 62  PFVAVIMALVVISALVHMRIGMQVIIEDYVHAEGVKIALLMLNTFFAIAIGGLCLFAVLK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|15966824|ref|NP_387177.1| succinate dehydrogenase membrane anchor subunit protein
           [Sinorhizobium meliloti 1021]
 gi|307301652|ref|ZP_07581411.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti BL225C]
 gi|307316324|ref|ZP_07595768.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti AK83]
 gi|15076096|emb|CAC47650.1| Probable succinate dehydrogenase membrane anchor subunit
           [Sinorhizobium meliloti 1021]
 gi|306898164|gb|EFN28906.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti AK83]
 gi|306903350|gb|EFN33939.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti BL225C]
          Length = 126

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 88/125 (70%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MR+ LG+VRG+GSAK+GT HF +QR TA+A+IP  IFF+ F   Y  AP+ ++++ LSN
Sbjct: 2   NMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA  MGL  ++  VHM++GMQVIIEDY+H    KI  L +N+ F + +   CLF++LK
Sbjct: 62  PFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVLK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|222087468|ref|YP_002546005.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Agrobacterium radiobacter K84]
 gi|221724916|gb|ACM28072.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Agrobacterium radiobacter K84]
          Length = 126

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (73%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA+AN+P  IFF+ F I Y  APY ++V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFWRQRLTAVANVPLFIFFVIFLIIYAGAPYAEVVHALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IMGL  IS  +HM+LGMQVIIEDY+H    KI+ L +N+ F +++   CLF++LK
Sbjct: 62  PFVAVIMGLMVISGIIHMKLGMQVIIEDYVHGEFGKIVLLMLNTFFSIVMAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|150398155|ref|YP_001328622.1| succinate dehydrogenase hydrophobic membrane anchor [Sinorhizobium
           medicae WSM419]
 gi|150029670|gb|ABR61787.1| Succinate dehydrogenase hydrophobic membrane anchor [Sinorhizobium
           medicae WSM419]
          Length = 126

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 87/125 (69%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ LG+VRG+GSAK+GT HF +QR TA+A+IP  IFF+ F   Y  AP+ ++++ L+N
Sbjct: 2   SMRTPLGKVRGLGSAKEGTDHFWRQRVTAVASIPLTIFFVVFLAHYAGAPHAELLAALAN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA  MGL  ++  VHM++GMQVIIEDY+H    KI  L +N+ F + +   CLF++LK
Sbjct: 62  PFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVLK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|319780754|ref|YP_004140230.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166642|gb|ADV10180.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 131

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 88/127 (69%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           + DMR+ L RVRG+GSA++GTGHF +QR TAIANIP I+FF+ F I    A +E + + L
Sbjct: 5   NTDMRTPLARVRGLGSAREGTGHFWRQRLTAIANIPLILFFVGFLIALNGADHEHVRAAL 64

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +N  VA +M L  IS   HM++GMQVIIEDY+H   +K+  + +N+ F + + +  +F+L
Sbjct: 65  ANPFVALVMALVLISGLTHMRIGMQVIIEDYVHGEGMKLALIALNTFFTIAVGVASIFAL 124

Query: 122 LKIAILG 128
           LK+A  G
Sbjct: 125 LKLAFGG 131


>gi|110635574|ref|YP_675782.1| succinate dehydrogenase subunit D [Mesorhizobium sp. BNC1]
 gi|110286558|gb|ABG64617.1| succinate dehydrogenase subunit D [Chelativorans sp. BNC1]
          Length = 127

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 61/125 (48%), Positives = 85/125 (68%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSA+ GT HF +QR TA++NIP IIFFI F   Y  + YE+I + L+ 
Sbjct: 3   DMRTPLNKVRGLGSARGGTEHFWRQRLTAVSNIPLIIFFIGFVAAYSGSSYEEIRAALAQ 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A +MGL  +S+  HM+LGMQVIIEDY+H    KI  + +N+ F +++    L+SLL+
Sbjct: 63  PVSALLMGLAFVSVLYHMRLGMQVIIEDYVHGEGWKIALILLNTFFPVIVGAIALYSLLR 122

Query: 124 IAILG 128
           IA  G
Sbjct: 123 IAFGG 127


>gi|13473608|ref|NP_105176.1| succinate dehydrogenase cytochrome b small subunit [Mesorhizobium
           loti MAFF303099]
 gi|14024358|dbj|BAB50962.1| succinate dehydrogenase cytochrome b small subunit [Mesorhizobium
           loti MAFF303099]
          Length = 132

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 85/125 (68%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSA++GTGHF +QR TAIANIP  +FF+ F I    A Y ++ + L+N
Sbjct: 8   DMRTPLAKVRGLGSAREGTGHFWRQRLTAIANIPLTLFFVGFLIALNGAGYAEVRAALAN 67

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V  ++ L  IS  +HM+LGMQVIIEDYI    LK+  + +N+ F + + +  +F+LLK
Sbjct: 68  PFVGLMLALVLISGLIHMRLGMQVIIEDYITSEGLKLATIALNTFFTVAVGVASIFALLK 127

Query: 124 IAILG 128
           +A  G
Sbjct: 128 LAFGG 132


>gi|17986444|ref|NP_539078.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis bv. 1 str. 16M]
 gi|17982040|gb|AAL51342.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis bv. 1 str. 16M]
          Length = 128

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 89/128 (69%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+SLG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 1   MNNDMRTSLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 61  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 120

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 121 ILKLSFGG 128


>gi|260562820|ref|ZP_05833306.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|260152836|gb|EEW87928.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
          Length = 131

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 89/128 (69%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+SLG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTSLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|254713681|ref|ZP_05175492.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti M644/93/1]
 gi|254715968|ref|ZP_05177779.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti M13/05/1]
 gi|261217732|ref|ZP_05932013.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M13/05/1]
 gi|261321420|ref|ZP_05960617.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M644/93/1]
 gi|260922821|gb|EEX89389.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M13/05/1]
 gi|261294110|gb|EEX97606.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M644/93/1]
          Length = 131

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 89/128 (69%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++++ 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVLAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|163761420|ref|ZP_02168494.1| probable succinate dehydrogenase membrane anchor subunit protein
           [Hoeflea phototrophica DFL-43]
 gi|162281415|gb|EDQ31712.1| probable succinate dehydrogenase membrane anchor subunit protein
           [Hoeflea phototrophica DFL-43]
          Length = 127

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 83/125 (66%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MR+ L +VRG+GSAK+GT HF +QR TA+AN+P IIFFI F I Y   PYE +   LSN
Sbjct: 3   NMRTPLSKVRGLGSAKEGTDHFWRQRVTAVANVPLIIFFILFIIAYNGEPYEVVAGALSN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  VHM+LGMQVIIEDYIH    K+  L  N+ F   +    LFS+LK
Sbjct: 63  PLVAVLMGLVVISGLVHMRLGMQVIIEDYIHAEGAKVALLLFNTFFTAAIGAVSLFSVLK 122

Query: 124 IAILG 128
           +   G
Sbjct: 123 LGFGG 127


>gi|254700547|ref|ZP_05162375.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis bv. 5 str. 513]
 gi|261751051|ref|ZP_05994760.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 5 str. 513]
 gi|261740804|gb|EEY28730.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 5 str. 513]
          Length = 131

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 88/128 (68%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVWAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|148559156|ref|YP_001259727.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ovis ATCC 25840]
 gi|161619820|ref|YP_001593707.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella canis ATCC 23365]
 gi|163843926|ref|YP_001628330.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis ATCC 23445]
 gi|225628103|ref|ZP_03786138.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti str. Cudo]
 gi|225853340|ref|YP_002733573.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis ATCC 23457]
 gi|254704917|ref|ZP_05166745.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis bv. 3 str. 686]
 gi|254707569|ref|ZP_05169397.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella pinnipedialis M163/99/10]
 gi|254708894|ref|ZP_05170705.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella pinnipedialis B2/94]
 gi|254717970|ref|ZP_05179781.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. 83/13]
 gi|256030420|ref|ZP_05444034.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella pinnipedialis M292/94/1]
 gi|256045511|ref|ZP_05448394.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059879|ref|ZP_05450066.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella neotomae 5K33]
 gi|256112238|ref|ZP_05453159.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis bv. 3 str. Ether]
 gi|256158404|ref|ZP_05456302.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti M490/95/1]
 gi|256253824|ref|ZP_05459360.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti B1/94]
 gi|256263173|ref|ZP_05465705.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370305|ref|YP_003107816.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella microti CCM 4915]
 gi|260169331|ref|ZP_05756142.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella sp. F5/99]
 gi|260567608|ref|ZP_05838078.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|261220958|ref|ZP_05935239.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           B1/94]
 gi|261315054|ref|ZP_05954251.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M163/99/10]
 gi|261316389|ref|ZP_05955586.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis B2/94]
 gi|261323850|ref|ZP_05963047.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           neotomae 5K33]
 gi|261755613|ref|ZP_05999322.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 3 str. 686]
 gi|261758846|ref|ZP_06002555.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|265982913|ref|ZP_06095648.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella sp.
           83/13]
 gi|265987462|ref|ZP_06100019.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M292/94/1]
 gi|265991934|ref|ZP_06104491.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993666|ref|ZP_06106223.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 3 str. Ether]
 gi|265996917|ref|ZP_06109474.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M490/95/1]
 gi|294851144|ref|ZP_06791817.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella sp. NVSL 07-0026]
 gi|306838922|ref|ZP_07471749.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. NF 2653]
 gi|306842943|ref|ZP_07475577.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO2]
 gi|306843358|ref|ZP_07475959.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO1]
 gi|148370413|gb|ABQ60392.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ovis ATCC 25840]
 gi|161336631|gb|ABX62936.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella canis ATCC 23365]
 gi|163674649|gb|ABY38760.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis ATCC 23445]
 gi|225616928|gb|EEH13975.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti str. Cudo]
 gi|225641705|gb|ACO01619.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis ATCC 23457]
 gi|256000468|gb|ACU48867.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella microti CCM 4915]
 gi|260157126|gb|EEW92206.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|260919542|gb|EEX86195.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           B1/94]
 gi|261295612|gb|EEX99108.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis B2/94]
 gi|261299830|gb|EEY03327.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           neotomae 5K33]
 gi|261304080|gb|EEY07577.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M163/99/10]
 gi|261738830|gb|EEY26826.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|261745366|gb|EEY33292.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 3 str. 686]
 gi|262551385|gb|EEZ07375.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M490/95/1]
 gi|262764647|gb|EEZ10568.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003000|gb|EEZ15293.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093079|gb|EEZ17229.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659659|gb|EEZ29920.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M292/94/1]
 gi|264661505|gb|EEZ31766.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella sp.
           83/13]
 gi|294819733|gb|EFG36732.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella sp. NVSL 07-0026]
 gi|306276049|gb|EFM57749.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO1]
 gi|306286871|gb|EFM58396.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO2]
 gi|306405992|gb|EFM62244.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. NF 2653]
 gi|326409904|gb|ADZ66969.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis M28]
 gi|326539617|gb|ADZ87832.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis M5-90]
          Length = 131

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 88/128 (68%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|260464203|ref|ZP_05812396.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259030006|gb|EEW31289.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 131

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 88/125 (70%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L RVRG+GSA++GTGHF +QR TAIANIP I+FF+ F I    A + ++ + L+N
Sbjct: 7   DMRTPLARVRGLGSAREGTGHFWRQRLTAIANIPLILFFVGFLIALNGAGFAEVRAALAN 66

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA ++ L  +S  +HM++GMQVIIEDY+H   +K+  + +N+ F + + +  +F+LLK
Sbjct: 67  PFVALVVALVLVSGLIHMRIGMQVIIEDYVHGEGMKLALIALNTFFTVAVGVTSIFALLK 126

Query: 124 IAILG 128
           +A  G
Sbjct: 127 LAFGG 131


>gi|153008287|ref|YP_001369502.1| succinate dehydrogenase hydrophobic membrane anchor [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560175|gb|ABS13673.1| Succinate dehydrogenase hydrophobic membrane anchor [Ochrobactrum
           anthropi ATCC 49188]
          Length = 131

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 86/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GTGHF  QR +A A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTGHFWYQRLSAAALVPLVMFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +K++ + +N+ F  ++   C+F+
Sbjct: 64  LSHPFTAIVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKVVLVMLNTFFTAVVGFACIFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|23502754|ref|NP_698881.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis 1330]
 gi|23348772|gb|AAN30796.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella suis 1330]
          Length = 131

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 87/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  +    HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLMGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|239833034|ref|ZP_04681363.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ochrobactrum intermedium LMG 3301]
 gi|239825301|gb|EEQ96869.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ochrobactrum intermedium LMG 3301]
          Length = 131

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 87/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GTGHF  QR +A+A +P ++FFI   +    A + ++ + 
Sbjct: 4   MNKDMRTPLGKVRGLGSAKEGTGHFWYQRLSAVALVPLVMFFIGLVVSLNGASFAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +K++ + +NS F  ++   C+F+
Sbjct: 64  LSHPFTAIVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKVVLVMLNSFFTAVVGFACIFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|62290759|ref|YP_222552.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus bv. 1 str. 9-941]
 gi|82700670|ref|YP_415244.1| hypothetical protein BAB1_1902 [Brucella melitensis biovar Abortus
           2308]
 gi|189024972|ref|YP_001935740.1| succinate dehydrogenase [Brucella abortus S19]
 gi|237816265|ref|ZP_04595258.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus str. 2308 A]
 gi|254690048|ref|ZP_05153302.1| succinate dehydrogenase [Brucella abortus bv. 6 str. 870]
 gi|254694536|ref|ZP_05156364.1| succinate dehydrogenase [Brucella abortus bv. 3 str. Tulya]
 gi|254696161|ref|ZP_05157989.1| succinate dehydrogenase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731079|ref|ZP_05189657.1| succinate dehydrogenase [Brucella abortus bv. 4 str. 292]
 gi|256258301|ref|ZP_05463837.1| succinate dehydrogenase [Brucella abortus bv. 9 str. C68]
 gi|260546024|ref|ZP_05821764.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260755582|ref|ZP_05867930.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 6 str. 870]
 gi|260758808|ref|ZP_05871156.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 4 str. 292]
 gi|260760532|ref|ZP_05872875.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260884608|ref|ZP_05896222.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 9 str. C68]
 gi|261214855|ref|ZP_05929136.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 3 str. Tulya]
 gi|297247146|ref|ZP_06930864.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella abortus bv. 5 str. B3196]
 gi|62196891|gb|AAX75191.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616771|emb|CAJ11858.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|189020544|gb|ACD73266.1| succinate dehydrogenase [Brucella abortus S19]
 gi|237788332|gb|EEP62547.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus str. 2308 A]
 gi|260096131|gb|EEW80007.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260669126|gb|EEX56066.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 4 str. 292]
 gi|260670964|gb|EEX57785.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260675690|gb|EEX62511.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 6 str. 870]
 gi|260874136|gb|EEX81205.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 9 str. C68]
 gi|260916462|gb|EEX83323.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 3 str. Tulya]
 gi|297174315|gb|EFH33662.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella abortus bv. 5 str. B3196]
          Length = 131

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 87/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR  LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRIPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|49476234|ref|YP_034275.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella henselae str. Houston-1]
 gi|49239042|emb|CAF28342.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella henselae str. Houston-1]
          Length = 128

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/128 (47%), Positives = 81/128 (63%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+ LG+VRG GSA +GT HF  QR T   N+P +IFFI   +      Y  I + 
Sbjct: 1   MKKDFRTELGKVRGRGSAHEGTEHFWLQRLTGFINLPLLIFFIVLILSLVGKDYSIIRAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L++  VA +MGL T+S+  HM+LGMQV+IEDYI    L+I+FL +N  F  +L    +F+
Sbjct: 61  LAHPVVAVLMGLLTLSVLYHMKLGMQVVIEDYIPREGLRIIFLVLNILFCFVLGGIIVFA 120

Query: 121 LLKIAILG 128
           LLKIAI G
Sbjct: 121 LLKIAIGG 128


>gi|307942784|ref|ZP_07658129.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseibium sp. TrichSKD4]
 gi|307773580|gb|EFO32796.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseibium sp. TrichSKD4]
          Length = 127

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 81/125 (64%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSAKDGT HF +QR TA+AN+  I FF+   I    + YE +++ L N
Sbjct: 3   DMRTPLAKVRGLGSAKDGTEHFWRQRVTAVANVFLISFFVILVISMQGSSYEDMIATLQN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +M +  +S   HM+LGMQVIIEDYIH   +K++ +  N+ F  L+    +F++LK
Sbjct: 63  PLVAILMLMVILSGVYHMKLGMQVIIEDYIHSEGVKVLAVLGNTFFSALIGFGTVFAVLK 122

Query: 124 IAILG 128
           I   G
Sbjct: 123 IGFGG 127


>gi|154245909|ref|YP_001416867.1| succinate dehydrogenase hydrophobic membrane anchor [Xanthobacter
           autotrophicus Py2]
 gi|154159994|gb|ABS67210.1| Succinate dehydrogenase hydrophobic membrane anchor [Xanthobacter
           autotrophicus Py2]
          Length = 135

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 81/125 (64%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR++LGRVRG+GSA+ GT HF KQR T +AN+  +I FI   I    + Y    + L +
Sbjct: 11  PMRTALGRVRGLGSARSGTDHFFKQRVTGLANLILMIAFIGIVISLAGSSYAATRATLGH 70

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA ++ L  +S++ HM++GMQV+IEDYIH   LK+M +  N+ F + + +   F++LK
Sbjct: 71  PFVAVVILLTLLSVTTHMRIGMQVVIEDYIHTEALKVMLIVANTFFSIAIALAGAFAVLK 130

Query: 124 IAILG 128
           I++ G
Sbjct: 131 ISLGG 135


>gi|254503995|ref|ZP_05116146.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Labrenzia alexandrii DFL-11]
 gi|222440066|gb|EEE46745.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Labrenzia alexandrii DFL-11]
          Length = 127

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 79/125 (63%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+V G+GSAKDGT HF KQR TA+AN+  I FF+   I    + +  +V  L N
Sbjct: 3   DMRTPLGKVLGLGSAKDGTDHFWKQRLTAVANVFLISFFVILVISMQGSSHGDVVETLQN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V+ I+ L  +S   HM+LGMQVIIEDYIH   LK + +  N+ F + +   C+F++LK
Sbjct: 63  PLVSIILLLVILSGVYHMKLGMQVIIEDYIHGEALKFLTVMANTFFCVFIGFGCIFAVLK 122

Query: 124 IAILG 128
           I   G
Sbjct: 123 IGFGG 127


>gi|240851319|ref|YP_002972722.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella grahamii as4aup]
 gi|240268442|gb|ACS52030.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella grahamii as4aup]
          Length = 128

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (61%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+ LG+VRG GSA +GT HF  QR T + N+P +IFFI   +      Y  + + 
Sbjct: 1   MKKDFRTELGKVRGRGSAHEGTEHFWLQRLTGLVNLPLLIFFIVLILSLVGKDYSIVRAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L++  VA +MGL T S+  HM+LGMQV+IEDYI     +I FL +N  F  L+    +FS
Sbjct: 61  LAHPVVAILMGLMTFSVLYHMKLGMQVVIEDYIPREGFRIFFLTLNISFCFLIGGVIIFS 120

Query: 121 LLKIAILG 128
           LLKIA+ G
Sbjct: 121 LLKIALGG 128


>gi|118590534|ref|ZP_01547936.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Stappia aggregata IAM 12614]
 gi|118436997|gb|EAV43636.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Stappia aggregata IAM 12614]
          Length = 127

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 78/125 (62%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSAK+GT HF KQR TA+AN+  I FF+   I    + +  +V  L N
Sbjct: 3   DMRTPLNKVRGLGSAKEGTDHFWKQRLTAVANVFLISFFVILVIAMQGSTHADVVETLKN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V+ I+ L  +S   HM+LGMQVIIEDY+H   +K + L  N+ F   +   C+F++LK
Sbjct: 63  PLVSIILLLVILSGVYHMKLGMQVIIEDYVHGEGIKFLTLMANTFFCAFIGFGCVFAVLK 122

Query: 124 IAILG 128
           I   G
Sbjct: 123 IGFGG 127


>gi|90421133|ref|ZP_01229035.1| succinate dehydrogenase hydrophobic membrane anchor, SdhD
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90334625|gb|EAS48405.1| succinate dehydrogenase hydrophobic membrane anchor, SdhD
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 126

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 81/122 (66%), Gaps = 1/122 (0%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MR+SL RVRG+GSA +GTGHF +QR +AI+N+  I  F+   I   D PY ++ + L++
Sbjct: 3   EMRTSLRRVRGLGSAHEGTGHFWQQRLSAISNLVLITGFVILLIVLHDQPYAEVRAALAH 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V  ++ L  IS + HM+LGMQVIIEDY+H    K+  L +N+ F + + +  LF++ +
Sbjct: 63  PLVGLLVALTVISFTYHMRLGMQVIIEDYVH-GTTKLPLLILNNFFAIAIAVASLFAIAR 121

Query: 124 IA 125
           ++
Sbjct: 122 MS 123


>gi|49474756|ref|YP_032798.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella quintana str. Toulouse]
 gi|49240260|emb|CAF26730.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella quintana str. Toulouse]
          Length = 128

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 80/126 (63%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D ++ LG+VRG+GSA++GT HF  +R T++ N+P  IFFI   +      Y  + + 
Sbjct: 1   MKKDFQTELGKVRGLGSAREGTEHFWLERLTSVLNLPLCIFFIVLILSLIGKDYTIVHAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  V  +MGL T S+  HM+L MQV+IEDYI    L+I+FL +N  F  +L    +F+
Sbjct: 61  LSHPVVTILMGLLTFSVLYHMKLEMQVVIEDYIRREGLRILFLVLNVSFCFVLGGIIIFA 120

Query: 121 LLKIAI 126
           LLKIA+
Sbjct: 121 LLKIAL 126


>gi|328541810|ref|YP_004301919.1| Succinate dehydrogenase, hydrophobic membrane anchor protein
           [polymorphum gilvum SL003B-26A1]
 gi|326411562|gb|ADZ68625.1| Succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Polymorphum gilvum SL003B-26A1]
          Length = 127

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 79/125 (63%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSAKDGT HF +QR TA+AN+  I FF+   I    A Y+++ + L N
Sbjct: 3   DMRTPLAKVRGLGSAKDGTEHFWRQRVTAVANVFLISFFVITLISLQGAGYDEVRTCLGN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +M L   S   HM+LGMQVIIEDY+H   +K + L  N+ F   + +  +F++LK
Sbjct: 63  PIVAILMLLVIASGVYHMKLGMQVIIEDYVHGDGVKFLALMANTFFCAFIGLGSVFAVLK 122

Query: 124 IAILG 128
           +   G
Sbjct: 123 LGFGG 127


>gi|158425368|ref|YP_001526660.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azorhizobium caulinodans ORS 571]
 gi|158332257|dbj|BAF89742.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azorhizobium caulinodans ORS 571]
          Length = 128

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 78/128 (60%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M   MR+ LGRVRG+GSA+ GT HF  QR TAI N+  ++  +   I    A Y    + 
Sbjct: 1   MHSPMRTPLGRVRGLGSARSGTEHFFLQRLTAIGNLILVVITLGIMISLLGAGYNAAHAT 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L N  VA ++ L  +S++ HM++GMQV+IEDY+H   LK+  +  N+ F  ++ +   F+
Sbjct: 61  LGNPIVAVVILLLLLSVTTHMRIGMQVVIEDYVHSEGLKVALIIANTFFTTVVGLAGAFA 120

Query: 121 LLKIAILG 128
           +LKI++ G
Sbjct: 121 VLKISLGG 128


>gi|254471020|ref|ZP_05084423.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudovibrio sp. JE062]
 gi|211960162|gb|EEA95359.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudovibrio sp. JE062]
          Length = 127

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 78/125 (62%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSAKDGT HF +QR TA+AN+  I FF+   I    A Y      L N
Sbjct: 3   DMRTPLAKVRGLGSAKDGTTHFWRQRVTAVANVFLISFFVILVIALQGADYASFTEALQN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             ++ ++ L  +   +HM+LGMQVIIEDYIH   LK++ L  N  FV ++ +  + ++LK
Sbjct: 63  PVISILLLLVILVGCLHMKLGMQVIIEDYIHSEGLKLLLLMGNIFFVSIIALSSVVAVLK 122

Query: 124 IAILG 128
           I+  G
Sbjct: 123 ISFGG 127


>gi|319409392|emb|CBI83036.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella schoenbuchensis R1]
          Length = 128

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 78/126 (61%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+  G+VRG GSA +GTGHF  +  T   ++   IFFI   I      Y+ I + 
Sbjct: 1   MKKDFRTEFGKVRGFGSAHEGTGHFWLENLTGFTSVLLWIFFIVLVISLVGEGYDVIYAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  VA +MGL T S   +M+LGMQV+IEDYI +  L+I+FL +N+ F  +L  F +F+
Sbjct: 61  LSHPIVAVLMGLMTFSSLYYMKLGMQVVIEDYIPHGNLRILFLVLNTLFCCVLGGFIIFA 120

Query: 121 LLKIAI 126
           LLKI +
Sbjct: 121 LLKIVL 126


>gi|121602811|ref|YP_988427.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Bartonella bacilliformis KC583]
 gi|120614988|gb|ABM45589.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Bartonella bacilliformis KC583]
          Length = 128

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  ++R+ LG+VRG+GSA  GT HF  Q  T+  NIP +IFFI   I      Y  I + 
Sbjct: 1   MKKNLRTELGKVRGLGSAHKGTEHFWVQNLTSWINIPLLIFFIILMISLAGEDYSTIHAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  +   M L   S   HM+L MQV+IEDYI ++++++ FL +N  +  L+    +F+
Sbjct: 61  LSHPVILVFMVLTVFSNLYHMKLEMQVVIEDYIPHKIIRMFFLILNISYCCLIGSLIIFA 120

Query: 121 LLKIAI 126
           LLKIA+
Sbjct: 121 LLKIAL 126


>gi|170744095|ref|YP_001772750.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium sp. 4-46]
 gi|168198369|gb|ACA20316.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium sp. 4-46]
          Length = 137

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 80/122 (65%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           +R+S  RV+G+G A  GTG +   R TA++N+P I+ F+          YE  V ++S+ 
Sbjct: 12  IRTSYARVQGLGPAHHGTGEWWLHRVTAVSNVPLILSFVVIVALCAGRSYEDAVRLVSHP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            VA ++ LG +S++ HM++GMQ++IEDY+H + LKI  +  N+ +  ++ + CL+++++I
Sbjct: 72  LVAILLILGVLSVTNHMRMGMQIVIEDYVHDKGLKIAAVIANTFYSTVVAVACLYAIVRI 131

Query: 125 AI 126
           ++
Sbjct: 132 SL 133


>gi|304394276|ref|ZP_07376199.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Ahrensia sp. R2A130]
 gi|303293716|gb|EFL88093.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Ahrensia sp. R2A130]
          Length = 136

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%)

Query: 1  MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
          MD D R+ L RVRG+GSAKDGT HF  QR TA+AN+  I FF+   +    A +E+ V+ 
Sbjct: 1  MDQDFRTPLSRVRGLGSAKDGTQHFWHQRLTAMANLVLITFFVWTVVALNGATWEETVAY 60

Query: 61 LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIH 94
          LS+  VA +M +   +   HM+LGMQVIIEDY+H
Sbjct: 61 LSSPLVAIVMVMVLGAGIYHMKLGMQVIIEDYVH 94


>gi|220926985|ref|YP_002502287.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium nodulans ORS 2060]
 gi|219951592|gb|ACL61984.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium nodulans ORS 2060]
          Length = 137

 Score = 94.0 bits (232), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 80/122 (65%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           +R++  RV+G+G A  GT  +   R TA++NIP I+ F+          YE  V ++S+ 
Sbjct: 12  IRTAYARVQGLGPAHHGTSEWWLHRVTAVSNIPLIVSFVVIVALCAGRSYEDAVRLVSHP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            VA ++ LG +S++ HM++G+Q++IEDY+H + LKI  +  N+ + +++ + CL+++++I
Sbjct: 72  LVAILLILGVLSVTNHMRMGLQIVIEDYVHDKGLKIAAVIANTFYSVVVAVACLYAIVRI 131

Query: 125 AI 126
           ++
Sbjct: 132 SL 133


>gi|163853007|ref|YP_001641050.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium extorquens PA1]
 gi|163664612|gb|ABY31979.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium extorquens PA1]
          Length = 139

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (59%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
             MR+   RV+G+G++  G GHF  QR T  +N   ++ F+          Y Q V+++S
Sbjct: 12  LSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALVS 71

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +  VA I+ L  +S+++HM+LGMQ +IEDY+H   LK   L  N+ + + +   CL+++L
Sbjct: 72  HPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAVAVAAACLYAIL 131

Query: 123 KIAILG 128
           ++++ G
Sbjct: 132 RVSLGG 137


>gi|218531817|ref|YP_002422633.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium chloromethanicum CM4]
 gi|240140348|ref|YP_002964827.1| Succinate dehydrogenase delta subunit [Methylobacterium extorquens
           AM1]
 gi|254562943|ref|YP_003070038.1| succinate dehydrogenase, membrane anchor subunit [Methylobacterium
           extorquens DM4]
 gi|27902657|gb|AAO24620.1| succinate dehydrogenase delta subunit [Methylobacterium extorquens]
 gi|218524120|gb|ACK84705.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium chloromethanicum CM4]
 gi|240010324|gb|ACS41550.1| Succinate dehydrogenase delta subunit [Methylobacterium extorquens
           AM1]
 gi|254270221|emb|CAX26215.1| succinate dehydrogenase, membrane anchor subunit [Methylobacterium
           extorquens DM4]
          Length = 139

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (59%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
             MR+   RV+G+G++  G GHF  QR T  +N   ++ F+          Y Q V+++S
Sbjct: 12  LSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALVS 71

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +  VA I+ L  +S+++HM+LGMQ +IEDY+H   LK   L  N+ + + +   CL+++L
Sbjct: 72  HPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAVAVAAACLYAIL 131

Query: 123 KIAILG 128
           ++++ G
Sbjct: 132 RVSLGG 137


>gi|300024742|ref|YP_003757353.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526563|gb|ADJ25032.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 126

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 73/121 (60%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+ L   R +GSAK+G  HF KQR TA+AN+   +F +   +    A Y  +   L N 
Sbjct: 3   MRTPLKTARYLGSAKEGADHFWKQRVTAVANVVLAVFLVWLVVSLTGADYATVKRQLGNP 62

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            VA  +    +S ++HM+LGMQ IIEDY+H    KI+ L +N+ F +++ +  +FS+LK+
Sbjct: 63  LVALGLLSLVLSGAIHMRLGMQTIIEDYVHGEGAKIVALMLNTFFTIVVALVSIFSVLKL 122

Query: 125 A 125
           +
Sbjct: 123 S 123


>gi|319406314|emb|CBI79951.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella sp. AR 15-3]
          Length = 128

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 73/126 (57%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ D+R+ LG+VRG GSA  GT HF  +   + AN+    FFI   +      Y  + S 
Sbjct: 1   MEKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTFFIILVMSCVGKDYSVVYSR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
            S+  VA +MGL   S   +M+LGMQV+IEDYI    ++I FL +N  F  LL    +F+
Sbjct: 61  FSHPIVAVLMGLIIFSSLYYMKLGMQVVIEDYIPNEGMRIFFLVLNILFCFLLGSIMMFA 120

Query: 121 LLKIAI 126
           LLKIA+
Sbjct: 121 LLKIAL 126


>gi|188583473|ref|YP_001926918.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium populi BJ001]
 gi|179346971|gb|ACB82383.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium populi BJ001]
          Length = 139

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 74/126 (58%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
             MR+   RV+G+G++  G  HF  QR T  +N   ++ F+          Y Q V+++S
Sbjct: 12  LSMRTPRARVKGLGASGHGASHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALVS 71

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +  VA I+ L  +S+++HM+LGMQ +IEDY+H   LK   L  N+ + + +   CL++++
Sbjct: 72  HPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAVAVAAACLYAII 131

Query: 123 KIAILG 128
           ++++ G
Sbjct: 132 RVSLGG 137


>gi|298293273|ref|YP_003695212.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Starkeya novella DSM 506]
 gi|296929784|gb|ADH90593.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Starkeya novella DSM 506]
          Length = 136

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 75/124 (60%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+   RV G+GSA+ GTGHF  QR TA++N+  +I  +   I      +  +V+ L N 
Sbjct: 13  MRTPRRRVAGLGSARSGTGHFWLQRVTALSNLILVIIALPIVIAVAGEGHAGVVATLGNP 72

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            VA ++ L  +S+ +HM++GMQV+IEDY+H   +K++ L  N+ F   +     F++LKI
Sbjct: 73  LVAIVLLLLLLSVCMHMRIGMQVVIEDYVHAEGVKVLALIANTFFTTAVGFAGAFAILKI 132

Query: 125 AILG 128
           +  G
Sbjct: 133 SFGG 136


>gi|254292678|ref|YP_003058701.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hirschia baltica ATCC 49814]
 gi|254041209|gb|ACT58004.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hirschia baltica ATCC 49814]
          Length = 132

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 13/135 (9%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFI------KYGDAPY 54
           M   MR+ LG+VRG+GSA+DG GHFI QR +A+A    ++F + +F+        GD   
Sbjct: 1   MSNSMRTPLGKVRGLGSARDGAGHFIGQRVSAVA----LVFLVPWFLISLLGATRGDNTL 56

Query: 55  EQIVSV---LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVL 111
           E+  +    LS    A ++ L       HM+LG+QV+IEDYI   + +I+ L +N+    
Sbjct: 57  ERFANAEAWLSQPLNAILVLLAVCGTIYHMRLGLQVVIEDYISGHMPRIVLLMLNTFLSF 116

Query: 112 LLIIFCLFSLLKIAI 126
            LI   +FS+ K+A+
Sbjct: 117 ALIAATVFSVFKVAV 131


>gi|319899435|ref|YP_004159532.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella clarridgeiae 73]
 gi|319403403|emb|CBI76971.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella clarridgeiae 73]
          Length = 128

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 71/126 (56%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D+R+ LG+VRG GSA  GT HF  +   + AN+    FFI   +      Y  + S 
Sbjct: 1   MKKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTFFIILVMSCVGKDYNVVHSR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
            S+  V  +MGL   S   +M+LGMQV+IEDYI +  ++I F  +N  F  +L    +F+
Sbjct: 61  FSHPIVTVLMGLMIFSSLYYMKLGMQVVIEDYIPHEGMRIFFFVLNILFCFILGSIMMFA 120

Query: 121 LLKIAI 126
           LLKIA+
Sbjct: 121 LLKIAL 126


>gi|319407789|emb|CBI81440.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella sp. 1-1C]
          Length = 128

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 71/126 (56%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D+R+ LG+VRG GSA  GT HF  +   + AN+    FFI   +      Y  + + 
Sbjct: 1   MKKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTFFIILVMSCVGKDYSVVHAK 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  V   MGL   S   +M+LGMQV+IEDYI +  ++I F  +N  F  +L    +F+
Sbjct: 61  LSHPMVTVWMGLMIFSSLYYMKLGMQVVIEDYIPHEGMRIFFFVLNILFCFILGSIMMFA 120

Query: 121 LLKIAI 126
           LLKIA+
Sbjct: 121 LLKIAL 126


>gi|163796398|ref|ZP_02190358.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [alpha proteobacterium BAL199]
 gi|159178248|gb|EDP62792.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [alpha proteobacterium BAL199]
          Length = 132

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 70/122 (57%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ L RVRG+GSAK+G  H+  QR TAIA +P  I+F+          +   V+ + +
Sbjct: 8   SMRNPLARVRGLGSAKEGVHHWWAQRLTAIALVPLTIWFVISIAGLAGVDHAGAVAWIGS 67

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA ++ L   ++  H QLG+QV+IEDY+H   +K+  L       + L +  +F++L+
Sbjct: 68  APVAVLLVLLIAAVYWHAQLGVQVVIEDYVHNEAVKLTALIALKFAAIALGVASIFAVLR 127

Query: 124 IA 125
           +A
Sbjct: 128 LA 129


>gi|319404829|emb|CBI78430.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 128

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 70/126 (55%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D+R+ LG+VRG GSA  GT HF  +   + AN+     FI   +      Y  + + 
Sbjct: 1   MKKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTLFIILVMSCVGKDYSVVHAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  V   MGL   S   +M+LGMQV+IEDYI +  ++I F  +N  F  +L    +F+
Sbjct: 61  LSHPMVTVWMGLMIFSSLYYMKLGMQVVIEDYIPHEGMRIFFFVLNILFCFILGSIMMFA 120

Query: 121 LLKIAI 126
           LLKIA+
Sbjct: 121 LLKIAL 126


>gi|114320489|ref|YP_742172.1| succinate dehydrogenase subunit D [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226883|gb|ABI56682.1| succinate dehydrogenase subunit D [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 126

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 71/123 (57%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           ++R+++   +G+GSAKDG  H+  QR TA+A +P +++      ++G A YE  V+ ++N
Sbjct: 2   NLRTNIKEAQGLGSAKDGVSHWWLQRLTAVALVPLMLWLAFGLARHGGAGYEATVAWVAN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
                +  L   ++  H++LG+QV+IEDY+H    K   L       +LL    + ++L+
Sbjct: 62  PMTTVLWVLSLAALFWHIKLGLQVVIEDYVHDERAKFASLIAMKFITVLLAAIAILAVLR 121

Query: 124 IAI 126
           +A+
Sbjct: 122 VAL 124


>gi|163869247|ref|YP_001610503.1| SdhD succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella tribocorum CIP 105476]
 gi|161018950|emb|CAK02508.1| SdhD succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella tribocorum CIP 105476]
          Length = 128

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 76/128 (59%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+ LG+VRG GSA +GT HF  +R T   N+P +IF I   +      Y  + + 
Sbjct: 1   MKKDFRTELGKVRGRGSAHEGTEHFWLERLTGFINLPLLIFLIVLILSLVGKDYAIVRAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L++  VA +MGL T+S+  HM+L MQV+IEDYI     ++ FL +N  F   +    +FS
Sbjct: 61  LAHPIVAILMGLMTLSVIYHMKLVMQVVIEDYIPREGFRLFFLILNILFCFFIGGVIIFS 120

Query: 121 LLKIAILG 128
           LLKIA+ G
Sbjct: 121 LLKIALGG 128


>gi|218679248|ref|ZP_03527145.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Rhizobium etli CIAT 894]
          Length = 81

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 54/80 (67%)

Query: 49  YGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSC 108
           Y  APY  +V  LSN  VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ 
Sbjct: 2   YAGAPYADVVRALSNPFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTF 61

Query: 109 FVLLLIIFCLFSLLKIAILG 128
           F +L+   CLF++LKIA +G
Sbjct: 62  FAILIAGLCLFAILKIAFVG 81


>gi|148554232|ref|YP_001261814.1| succinate dehydrogenase subunit D [Sphingomonas wittichii RW1]
 gi|148499422|gb|ABQ67676.1| succinate dehydrogenase subunit D [Sphingomonas wittichii RW1]
          Length = 129

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSAK G  H+ +QR TA  N+    +F+    +  +  ++ +V  + +  V
Sbjct: 5   TGIGRVRGLGSAKHGAMHWWRQRVTAAGNLLLATWFVVSLFRLPNLGHDVVVQWIGSPIV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L T+S+  HM+LG+QV++EDY+H    K+  L + + + +      +FS+LKIA 
Sbjct: 65  AVPLVLLTVSVFYHMRLGLQVVLEDYVHEDAGKVFSLLLLNLYTIAGAALAIFSILKIAF 124

Query: 127 LG 128
            G
Sbjct: 125 GG 126


>gi|23014377|ref|ZP_00054197.1| COG2142: Succinate dehydrogenase, hydrophobic anchor subunit
           [Magnetospirillum magnetotacticum MS-1]
          Length = 127

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 70/122 (57%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           + S +GR RG+GSAK+G  H+I QR TAI  IP  ++F    I    A Y    + ++  
Sbjct: 4   LESPVGRARGLGSAKEGASHWIAQRVTAIFLIPLSLWFAVSVIGLSHADYATFKAWMAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             +S++ L  +++  H QLG+QV+IEDY+H    K+  L  +   +  L +F   S+LK+
Sbjct: 64  GNSSLLLLTVLTVLYHAQLGLQVVIEDYVHCECKKVAALVGSKLVIAFLAVFMTVSILKV 123

Query: 125 AI 126
           AI
Sbjct: 124 AI 125


>gi|319777840|ref|YP_004134270.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317171559|gb|ADV15096.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 129

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            +R+ L RVRG+GSAK GT  F+ +R T+ A +  +I+ +A  I+    P + ++ V+ +
Sbjct: 6   SIRTPLARVRGLGSAKHGTETFMLERLTSAALLILVIYIVAVVIRLSGEPRDVVIRVVGS 65

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
           + VA  +    +   VHM+LGMQ IIEDY H  +LK + L  N  F   + +   F++L 
Sbjct: 66  IYVAPALIAFILVNCVHMRLGMQSIIEDYCHATVLKSVLLIANWLFCWAVALASFFAVLV 125

Query: 124 IA 125
           I+
Sbjct: 126 IS 127


>gi|85374259|ref|YP_458321.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Erythrobacter litoralis HTCC2594]
 gi|84787342|gb|ABC63524.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Erythrobacter litoralis HTCC2594]
          Length = 128

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 60/88 (68%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          +SLGRVRG+GSAK+G  H+I QRFTAI N+  +++ +A FI   +  Y+ +   L++   
Sbjct: 5  TSLGRVRGLGSAKEGAHHWIVQRFTAIGNVVLMLWLVASFILLPNLSYDTVSGWLASPIP 64

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYIH 94
          A+ M L  +S+  H +LG+ V+IEDY+H
Sbjct: 65 AAAMVLLIVSVFWHARLGLTVLIEDYVH 92


>gi|83313050|ref|YP_423314.1| succinate dehydrogenase, hydrophobic anchor subunit
           [Magnetospirillum magneticum AMB-1]
 gi|82947891|dbj|BAE52755.1| Succinate dehydrogenase, hydrophobic anchor subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 126

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 70/123 (56%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            + S +GR RG+GSAK+G GH+I QR TAI  IP  ++F    I    A Y    + ++ 
Sbjct: 2   SLESPVGRARGLGSAKEGAGHWIAQRVTAIFLIPLSLWFAVSVIGLSHADYATFKAWMAK 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              +S++ L  +++  H QLG+QV+IEDY+     KI  L  +   +  L +F   S+LK
Sbjct: 62  PGNSSLLLLTVLTVLYHAQLGLQVVIEDYVSCECKKIAALVGSKLIIAFLAVFMTVSILK 121

Query: 124 IAI 126
           +AI
Sbjct: 122 VAI 124


>gi|312112887|ref|YP_004010483.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311218016|gb|ADP69384.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 130

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 77/123 (62%), Gaps = 7/123 (5%)

Query: 6   RSSLGRVRGMGSA--KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           R+ L +VRG+GSA    GT HF  QR TA++N+  + F +   +    AP   + +   +
Sbjct: 7   RTELKKVRGLGSAIGGPGTDHFWAQRLTAVSNLFVVAFLVYTGLTLAGAPLGDVKAFFGH 66

Query: 64  V--AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
              A+ASI  L  IS ++HM+LGMQV +E+Y+ +  LK+ FLF+N+ FV+++ +  + S+
Sbjct: 67  PFNAIASI--LVVISTAIHMRLGMQVPVEEYMPHG-LKVPFLFLNTFFVIVIAVVGVLSI 123

Query: 122 LKI 124
           LK+
Sbjct: 124 LKL 126


>gi|114328743|ref|YP_745900.1| succinate dehydrogenase membrane anchor subunit [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316917|gb|ABI62977.1| succinate dehydrogenase membrane anchor subunit [Granulibacter
           bethesdensis CGDNIH1]
          Length = 132

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS LGR RG+GSAK G  H+  +R T++A +P  ++FI   +        ++   + + 
Sbjct: 11  MRSHLGRARGLGSAKHGLTHWWAERVTSVALVPLTLWFIFAALHLTGHSRAEVAQWVGHP 70

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++     +   H+QLG+QVIIEDY+H   +KI  L        LL + C  S+LK+
Sbjct: 71  VHAVLLLSLVFATFHHVQLGLQVIIEDYVHTESVKIASLLATKAVCFLLGLACAVSILKM 130

Query: 125 AI 126
            +
Sbjct: 131 TL 132


>gi|146337398|ref|YP_001202446.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bradyrhizobium sp. ORS278]
 gi|146190204|emb|CAL74196.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bradyrhizobium sp. ORS278]
          Length = 124

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 72/121 (59%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+ LGRVR +G+A  GTG F +QR TA+A    I+  +   I            +L ++
Sbjct: 1   MRTPLGRVRNLGAAHSGTGDFWRQRITAVAMTLLIVPVVVVVIMLLGRNQAGAAQILGSL 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            +A IM L  ++   HM++GMQVIIEDY+H   LK++ +  N+ F + + I  +++L+K+
Sbjct: 61  PIALIMLLFVVASCWHMKIGMQVIIEDYVHTESLKLIAIMGNNFFAVTVAIASIYALIKL 120

Query: 125 A 125
           +
Sbjct: 121 S 121


>gi|83944806|ref|ZP_00957172.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Oceanicaulis alexandrii HTCC2633]
 gi|83851588|gb|EAP89443.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Oceanicaulis alexandrii HTCC2633]
          Length = 125

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           D R+ L + RG+GSAK G GHFI QR +A+A +  +  F+        A Y    + + +
Sbjct: 3   DFRTPLAKARGLGSAKSGVGHFIAQRVSALALVILVPLFVWAVASLPGADYASAYAFVGS 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A +  L   +   HM+LG+QV+IEDYIH  + K + L  N+     L +  L+++L 
Sbjct: 63  PYGAILTLLTLTAALYHMRLGLQVVIEDYIHKPMSKALLLIANTLICAGLWVAALYAVLA 122

Query: 124 IA 125
           IA
Sbjct: 123 IA 124


>gi|332188518|ref|ZP_08390238.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingomonas sp. S17]
 gi|332011423|gb|EGI53508.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingomonas sp. S17]
          Length = 127

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 71/123 (57%), Gaps = 3/123 (2%)

Query: 5   MRS--SLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
           MRS  ++GRVRG+GSAK GT H++ QR TA +N   +++ +   ++     Y  +   L+
Sbjct: 1   MRSGTAIGRVRGLGSAKSGTHHWLNQRLTAGSNFLLVVWLLISILRQPSYDYAAMRLWLA 60

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           N   A  M +   SI  HM+LG+QV+IEDY   +    + + MN  FV  +    +FS+L
Sbjct: 61  NPWAAIPMVMLVASIFYHMRLGLQVVIEDYEQDQNRVALLVVMN-LFVFTIAAVAIFSIL 119

Query: 123 KIA 125
           KIA
Sbjct: 120 KIA 122


>gi|103488507|ref|YP_618068.1| succinate dehydrogenase, cytochrome b subunit [Sphingopyxis
           alaskensis RB2256]
 gi|98978584|gb|ABF54735.1| succinate dehydrogenase subunit D [Sphingopyxis alaskensis RB2256]
          Length = 134

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 74/120 (61%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + LGRVRG+GS+  G+ H+++QR TA+ NI  + F     ++   A +  ++   SN +V
Sbjct: 5   TRLGRVRGLGSSHHGSHHWLQQRLTALGNILLVSFLFVSLLRLPLADHGAVLRWASNPSV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L  IS+  H++LG+QV+IEDYIH    ++  L + + + +    + +F++++IA+
Sbjct: 65  ALALILMVISVFWHLRLGLQVMIEDYIHGEATRLFALVLLNFYAIGGAAYGIFAIVRIAL 124


>gi|94496885|ref|ZP_01303459.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Sphingomonas sp. SKA58]
 gi|94423561|gb|EAT08588.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Sphingomonas sp. SKA58]
          Length = 129

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 64/95 (67%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSAK+G  H++ QR+TA+ N+  +++ +   I      Y+ +V+ ++N  V
Sbjct: 5   TGIGRVRGLGSAKEGAHHWLTQRYTAVGNLLLVLWLLFSLISLPGLDYDSVVAWIANPLV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
           A  M L  +SI +H++LGMQV++EDY+H + L  +
Sbjct: 65  AVPMMLMLVSIFLHLRLGMQVMLEDYVHDKGLNFL 99


>gi|307822159|ref|ZP_07652391.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacter tundripaludum SV96]
 gi|307736725|gb|EFO07570.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacter tundripaludum SV96]
          Length = 126

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           D R+ L RV+G+GSAKDGT H+  QR TA+A IP   + I F      APY+Q V  L++
Sbjct: 2   DYRTPLSRVKGLGSAKDGTTHWWMQRVTAVALIPLSFWLIYFLGLSLTAPYQQTVVWLTS 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLF 104
                 +    I+   H  LG+QV+IEDY+     KI+ ++
Sbjct: 62  PVNTVCIVAWIIAAFYHAALGLQVVIEDYVAAEGPKIISIW 102


>gi|154251887|ref|YP_001412711.1| succinate dehydrogenase hydrophobic membrane anchor [Parvibaculum
           lavamentivorans DS-1]
 gi|154155837|gb|ABS63054.1| Succinate dehydrogenase hydrophobic membrane anchor [Parvibaculum
           lavamentivorans DS-1]
          Length = 141

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 72/122 (59%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L RV  +GSAK GT   I+QR TA+A  P  +FF+   +    A YE   S L+N
Sbjct: 17  DMRTPLARVLHLGSAKSGTQDHIRQRLTAVAIAPLSLFFLVLLVALTGADYETARSWLAN 76

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V  +     ++  +HM++GMQ++IEDY+    LK + +  N+ F   + + CL+++LK
Sbjct: 77  PLVGILALCLIVAAIIHMRIGMQIVIEDYVIAPGLKHLSILANTFFSYGVGLACLYAVLK 136

Query: 124 IA 125
           +A
Sbjct: 137 LA 138


>gi|148251846|ref|YP_001236431.1| succinate dehydrogenase subunit D [Bradyrhizobium sp. BTAi1]
 gi|146404019|gb|ABQ32525.1| succinate dehydrogenase subunit D [Bradyrhizobium sp. BTAi1]
          Length = 124

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 71/121 (58%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+ LGRVR +G+A  GT  F +QR TA+A    I+  +   I            +L ++
Sbjct: 1   MRTPLGRVRNLGAAHSGTSDFWRQRITAVAMTLLIVPVVVVVIMLLGRNQAGAAQILGSL 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            +A IM L  I+   HM++GMQV+IEDY+H   LK++ +  N+ F + + +  +++L+K+
Sbjct: 61  PIALIMLLFVIASCWHMKIGMQVVIEDYVHSEPLKLVAIMANNFFAVTVALASIYALIKL 120

Query: 125 A 125
           +
Sbjct: 121 S 121


>gi|197103677|ref|YP_002129054.1| succinate dehydrogenase,hydrophobic membrane anchor protein
           [Phenylobacterium zucineum HLK1]
 gi|196477097|gb|ACG76625.1| succinate dehydrogenase,hydrophobic membrane anchor protein
           [Phenylobacterium zucineum HLK1]
          Length = 139

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 70/125 (56%), Gaps = 2/125 (1%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L R +G+GSAK G GH+I +R +A A IP  ++ +   I+     Y   V+ +S   
Sbjct: 16  RTPLSRAKGLGSAKHGVGHWIGERVSAAALIPLTLWAVYAVIRLAALDYYGAVAWISTPL 75

Query: 66  VASIMGLGTISIS-VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             ++M L T++ S  HM  G++V++EDYIH  L K   L +N     L     +FS+LK+
Sbjct: 76  NMTLMVL-TLAFSFWHMHAGLRVVVEDYIHKTLSKAALLLLNFFVCGLAGALAVFSVLKV 134

Query: 125 AILGT 129
           A+ G 
Sbjct: 135 ALGGA 139


>gi|294011058|ref|YP_003544518.1| succinate dehydrogenase hydrophobic anchor subunit [Sphingobium
           japonicum UT26S]
 gi|292674388|dbj|BAI95906.1| succinate dehydrogenase hydrophobic anchor subunit [Sphingobium
           japonicum UT26S]
          Length = 129

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 73/122 (59%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSA+ G  H++ QR+TAI N+  +++ +   I      Y+ +V  ++N  V
Sbjct: 5   TGIGRVRGLGSARHGAHHWLAQRYTAIGNLLLVLWLLFSLIALPGLDYQSVVGWIANPLV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L  +SI  H++LGMQV++EDY+H + L  + + + + +        +F++ KIA 
Sbjct: 65  AVPLMLMIVSIFWHLRLGMQVMLEDYVHDKGLAFLSMLLLNFYAFGGAAAGVFAIAKIAF 124

Query: 127 LG 128
            G
Sbjct: 125 TG 126


>gi|307295106|ref|ZP_07574948.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingobium chlorophenolicum L-1]
 gi|306879580|gb|EFN10798.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingobium chlorophenolicum L-1]
          Length = 129

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 73/122 (59%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSA+ G  H++ QR+TAI N+  +++ +   I      Y+ +V  ++N  V
Sbjct: 5   TGIGRVRGLGSARHGAHHWLAQRYTAIGNLLLVLWLLFSLIALPGLDYQSVVGWIANPLV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L  +SI  H++LGMQV++EDY+H + L  + + + + +        +F++ KIA 
Sbjct: 65  AVPLMLMIVSIFWHLRLGMQVMLEDYVHDKGLAFLSMLLLNFYAFGGAAAGVFAIAKIAF 124

Query: 127 LG 128
            G
Sbjct: 125 TG 126


>gi|27375624|ref|NP_767153.1| succinate dehydrogenase hydrophobic membrane anchor protein subunit
           [Bradyrhizobium japonicum USDA 110]
 gi|3169723|gb|AAC17941.1| succinate dehydrogenase membrane anchor subunit [Bradyrhizobium
           japonicum]
 gi|27348761|dbj|BAC45778.1| succinate dehydrogenase hydrophobic membrane anchor protein subunit
           [Bradyrhizobium japonicum USDA 110]
          Length = 134

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 72/126 (57%), Gaps = 8/126 (6%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIAN----IPFIIFFIAFFIKYGDAPYEQIVS 59
            MR+ LGRVR +G+A  GT  F +QR T +A     IP I+  +  F +        +  
Sbjct: 10  SMRTPLGRVRNLGAAHSGTSDFWRQRITGVAMVLMMIPVIVIIVMLFGRN----QAFVAQ 65

Query: 60  VLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
            + ++ +A IM L   + + HM++GMQV+IEDY+H   LK+  + +N+ F + + +   +
Sbjct: 66  TIGSLPIAIIMLLFIFASAWHMKIGMQVVIEDYVHNEKLKLTAIMLNNFFSIAVALASTY 125

Query: 120 SLLKIA 125
           ++LK++
Sbjct: 126 AILKLS 131


>gi|209967179|ref|YP_002300094.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Rhodospirillum centenum SW]
 gi|209960645|gb|ACJ01282.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Rhodospirillum centenum SW]
          Length = 132

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 69/125 (55%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           D   R+ LGRVRG+GSA+ G+ H+   R  A AN+P +++ +   I    A + ++V+ L
Sbjct: 7   DAGFRTPLGRVRGLGSARSGSAHWFGYRMLAAANVPLLLWLLVSLIPLAGAGHAEVVAFL 66

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
                A +M L   +I  H   GM  ++EDY+  +L+K +   +     LLL +   F++
Sbjct: 67  QRPLNAVLMLLTIGAIFYHAAYGMMEVLEDYVQAKLVKTLAAALIKGGCLLLAVASAFAV 126

Query: 122 LKIAI 126
           LKIA+
Sbjct: 127 LKIAL 131


>gi|162147200|ref|YP_001601661.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544253|ref|YP_002276482.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785777|emb|CAP55348.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531930|gb|ACI51867.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 140

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 72/124 (58%), Gaps = 5/124 (4%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS L R RG+GSAK G  H+  +R +A+A +P   +F+   ++   +  E +V      
Sbjct: 12  MRSQLSRARGLGSAKTGVDHWWMERMSAVALVPLSGWFVLQVLRLAGSSQEDVVE-WGGK 70

Query: 65  AVASIMGLGTISIS-VHMQLGMQVIIEDYIHYRL-LKIMFLFMNSCFVLLLIIFCLFSLL 122
            V S M L  + ++  HMQLG+QVII+DY+H +  L +  L   + F  L+ +F + ++L
Sbjct: 71  PVNSSMLLALMVLTFYHMQLGLQVIIDDYVHGKAHLPVSLLMKGAAF--LIGLFAVIAVL 128

Query: 123 KIAI 126
           K+A+
Sbjct: 129 KLAL 132


>gi|75676983|ref|YP_319404.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|74421853|gb|ABA06052.1| succinate dehydrogenase subunit D [Nitrobacter winogradskyi Nb-255]
          Length = 135

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 67/122 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ LGRVR  GSA  GT  F +QR T++A I  I+  +   +            +L +
Sbjct: 11  SMRTPLGRVRNHGSAHSGTTDFWRQRLTSVAMILLIVPMVVVMMILLGRNQAGAAQILGS 70

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             +A IM L  ++   HM++GMQVIIEDY+H   LK+  +  N+ F + L +   +++ K
Sbjct: 71  PPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDGKLKLASIMANNFFSVTLALTAAYAIFK 130

Query: 124 IA 125
           ++
Sbjct: 131 LS 132


>gi|325920387|ref|ZP_08182318.1| succinate dehydrogenase subunit D [Xanthomonas gardneri ATCC 19865]
 gi|325549134|gb|EGD20057.1| succinate dehydrogenase subunit D [Xanthomonas gardneri ATCC 19865]
          Length = 128

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 68/123 (55%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +   I+F+ F +    + Y   V+ +S   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVLQRLTATALVVLSIWFLVFVLSLLGSDYPTAVAAVSRPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    +++  H Q+G+QV++EDYIH  LL +           L  I  +F++ +IA
Sbjct: 65  NAILLVGFLVAMFWHAQIGLQVVLEDYIHNSLLALALQTTVKFVAALGAIVSIFAVARIA 124

Query: 126 ILG 128
           + G
Sbjct: 125 LGG 127


>gi|85714478|ref|ZP_01045466.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698925|gb|EAQ36794.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
          Length = 135

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 59/106 (55%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ LGRVR +GSA  GT  F +QR T++A I  II  +   +            +L +
Sbjct: 11  SMRTPLGRVRNLGSAHSGTTDFWRQRLTSVAMILLIIPMVVVMMILLGRNQAGAAQILGS 70

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCF 109
             +A IM L  ++   HM++GMQVIIEDY+H   LK+  +  N+ F
Sbjct: 71  PPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDEKLKLASIMANNFF 116


>gi|92119076|ref|YP_578805.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           hamburgensis X14]
 gi|91801970|gb|ABE64345.1| succinate dehydrogenase subunit D [Nitrobacter hamburgensis X14]
          Length = 133

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 66/122 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ L RVR +G+A  GT  F +QR TA+A I  I+  I   +            +L +
Sbjct: 9   SMRTPLSRVRNLGAAHSGTKDFWRQRLTAVAMILLIVPMIVVMMILLGRNQAGAAQILGS 68

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             +A IM L  ++   HM++GMQVIIEDY+H    K+  +  N+ F + L +   +++ K
Sbjct: 69  PPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDEKTKLASIMANNFFSVTLALAAAYAIFK 128

Query: 124 IA 125
           ++
Sbjct: 129 LS 130


>gi|241518523|ref|YP_002979151.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862936|gb|ACS60600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 127

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 70/120 (58%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           M + LGRVRG+GSAK GT  ++ ++ + +A      + I   I       + +V+ + + 
Sbjct: 1   MTTPLGRVRGLGSAKGGTRPYVLKQASGLALGILTPYLIGIGIYLLGRDRDFVVASIGSF 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            +   +    +  +VHM +GM+ IIEDY+H  + K++ LF+NS F  L+ + C+F++L++
Sbjct: 61  WIGPALLAFILLSAVHMDIGMRTIIEDYVHGHMRKLVILFLNSAFTWLVCLLCVFAILRM 120


>gi|114571386|ref|YP_758066.1| succinate dehydrogenase subunit D [Maricaulis maris MCS10]
 gi|114341848|gb|ABI67128.1| succinate dehydrogenase subunit D [Maricaulis maris MCS10]
          Length = 123

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (52%), Gaps = 10/127 (7%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIA----FFIKYGDAPYEQIVS 59
           D R+   +VRG+G++  G  H+I  R T+IA     +FF+A    + +    AP      
Sbjct: 3   DYRTPTAKVRGLGASGHGASHWIVHRVTSIA-----LFFLAPVFVWMLAKSGAP-ASAAE 56

Query: 60  VLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             S+ A A I  L   +   HM+LGMQVIIEDY+H    K + +  N+   L L +   F
Sbjct: 57  FFSSPAGAIITLLTLTAGLSHMRLGMQVIIEDYVHKHGTKTLLMLANTFLTLGLWLVTAF 116

Query: 120 SLLKIAI 126
           +LLK+A+
Sbjct: 117 ALLKLAL 123


>gi|21231575|ref|NP_637492.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768303|ref|YP_243065.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|188991442|ref|YP_001903452.1| succinate dehydrogenase (ubiquinone) membrane anchor subunit
           [Xanthomonas campestris pv. campestris str. B100]
 gi|21113262|gb|AAM41416.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573635|gb|AAY49045.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167733202|emb|CAP51400.1| succinate dehydrogenase (ubiquinone) membrane anchor subunit
           [Xanthomonas campestris pv. campestris]
          Length = 128

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 67/121 (55%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+   +    A +    + ++   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVVQRLTATALVPLSIWFLILVLSLIGADHTAASAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I+   H QLGMQV++EDY+H  LL +    +     +L  I  +F++ +IA
Sbjct: 65  NAILLVGFLIASFWHAQLGMQVVLEDYVHNSLLALAAQTLVRFVAVLGAIVSVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|254521173|ref|ZP_05133228.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas sp. SKA14]
 gi|219718764|gb|EED37289.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas sp. SKA14]
          Length = 128

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+GSAK GT HF+ QR TA A +   I+F+ F +    + Y    + ++   
Sbjct: 5   RTPLKSVRGLGSAKTGTEHFVHQRLTAAALVVLGIWFLVFVLSLLGSDYATAAAAVAKPW 64

Query: 66  VA-SIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            A  ++GL  I++  H QLGMQV++EDYIH  LL ++         +L +I  +F++ +I
Sbjct: 65  NAVPLIGL-LIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAVGRI 123

Query: 125 AI 126
           A+
Sbjct: 124 AL 125


>gi|194365314|ref|YP_002027924.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas maltophilia R551-3]
 gi|194348118|gb|ACF51241.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas maltophilia R551-3]
          Length = 128

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+GSAK GT HF+ QR TA A +   I+F+ F +    + Y    + ++   
Sbjct: 5   RTPLKGVRGLGSAKTGTEHFVHQRLTAAALVALGIWFLVFVLGLLGSDYATAAAAVAKPW 64

Query: 66  VA-SIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            A  ++GL  I++  H QLGMQV++EDYIH  LL ++         +L +I  +F++ +I
Sbjct: 65  NAVPLIGL-LIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAVGRI 123

Query: 125 AI 126
           A+
Sbjct: 124 AL 125


>gi|190573777|ref|YP_001971622.1| putative succinate dehydrogenase hydrophobic membrane anchor
           subunit [Stenotrophomonas maltophilia K279a]
 gi|190011699|emb|CAQ45318.1| putative succinate dehydrogenase hydrophobic membrane anchor
           subunit [Stenotrophomonas maltophilia K279a]
          Length = 128

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+GSAK GT HF+ QR TA A +   I+F+ F +    + Y    + ++   
Sbjct: 5   RTPLKNVRGLGSAKTGTEHFVHQRLTAAALVVLGIWFLVFVLGLLGSDYATAAAAVAKPW 64

Query: 66  VA-SIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            A  ++GL  I++  H QLGMQV++EDYIH  LL ++         +L +I  +F++ +I
Sbjct: 65  NAVPLIGL-LIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAVGRI 123

Query: 125 AI 126
           A+
Sbjct: 124 AL 125


>gi|299133111|ref|ZP_07026306.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Afipia sp. 1NLS2]
 gi|298593248|gb|EFI53448.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Afipia sp. 1NLS2]
          Length = 135

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 68/122 (55%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ L RVR +G+A  GT  F +QR TAIA    II      +            +L +
Sbjct: 11  SMRTPLARVRRLGAAHAGTSDFFRQRVTAIAMALLIIPVAIIVLMLTGRDQAAAAQLLGS 70

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA ++ L  ++  +HM++G+QV+IEDY+H   LK++ +  N+ F   + +  +F++LK
Sbjct: 71  PIVAILLALFIVAGCLHMKIGVQVVIEDYVHSEALKLLAIIANNFFSFAVGLASIFAILK 130

Query: 124 IA 125
           ++
Sbjct: 131 LS 132


>gi|258541136|ref|YP_003186569.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632214|dbj|BAH98189.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635271|dbj|BAI01240.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638326|dbj|BAI04288.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641380|dbj|BAI07335.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644435|dbj|BAI10383.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647490|dbj|BAI13431.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650543|dbj|BAI16477.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653534|dbj|BAI19461.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 137

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 53/92 (57%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS LGR RG+G+   G GH+  +R TA + +P   +F+    + G A + ++V      
Sbjct: 11  MRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADHTEVVKWGGKP 70

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYR 96
             A+++    I+   H QLG+QVI++DY+H +
Sbjct: 71  VNATMLIALIITTFYHAQLGLQVIVDDYVHGK 102


>gi|85708848|ref|ZP_01039914.1| hypothetical protein NAP1_06395 [Erythrobacter sp. NAP1]
 gi|85690382|gb|EAQ30385.1| hypothetical protein NAP1_06395 [Erythrobacter sp. NAP1]
          Length = 128

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 65/123 (52%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +S+G+VRG+GS+  G  H++  R TAI N+  + + I  F+   D  Y+ +   LS    
Sbjct: 5   TSIGKVRGLGSSHHGAHHWLAARTTAIGNLVLMTWLILSFVLLPDFSYQSVSGWLSQPIA 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  M L  IS+  H +LG+QV+IEDYIH    K   L   +        F +FS+  +A+
Sbjct: 65  AVPMILLIISVFYHARLGLQVVIEDYIHEPGSKFALLSALNLAAFGGGAFAIFSVASLAL 124

Query: 127 LGT 129
            G 
Sbjct: 125 TGA 127


>gi|329114747|ref|ZP_08243504.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Acetobacter pomorum DM001]
 gi|326695878|gb|EGE47562.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Acetobacter pomorum DM001]
          Length = 137

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 53/92 (57%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS LGR RG+G+   G GH+  +R TA + +P   +F+    + G A + ++V      
Sbjct: 11  MRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADHAEVVKWGGKP 70

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYR 96
             A+++    I+   H QLG+QVI++DY+H +
Sbjct: 71  VNATMLIALIITTFYHAQLGLQVIVDDYVHGK 102


>gi|316931810|ref|YP_004106792.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris DX-1]
 gi|315599524|gb|ADU42059.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris DX-1]
          Length = 137

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 6/125 (4%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFI---IFFIAFFIKYGDAPYEQIVSV 60
            MR+ +G+VR  G A  GT  F +QR T +A    I   I  I   +    A   QI   
Sbjct: 13  SMRTPIGKVRKFGPAGSGTSDFWRQRITGVAMTLLILPTIVVIMMLLGRNQAAAAQI--- 69

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L +  +A +M L  I+ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  +F+
Sbjct: 70  LGSPLIALVMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNFFSIAVALAAIFA 129

Query: 121 LLKIA 125
           + K+A
Sbjct: 130 IFKMA 134


>gi|289669027|ref|ZP_06490102.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 128

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 69/121 (57%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I+   H QLGMQV++EDY+H  LL +M   +     +L  I  +F++ +IA
Sbjct: 65  NAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALMAQTLVRFVAVLGAIVSVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|15837673|ref|NP_298361.1| succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
 gi|9106018|gb|AAF83881.1|AE003943_12 succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
          Length = 127

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 69/121 (57%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L   RG+G+AK GTGHF+ QR TAIA +   ++F+AF +      Y   V+ ++   
Sbjct: 5   RTPLKNARGLGAAKAGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    ++   H QLG+QV++EDYIH   L +    M     +L  +  +F++++IA
Sbjct: 65  NAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALALQTMVKFIAVLGAVASVFAVVRIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|319786901|ref|YP_004146376.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465413|gb|ADV27145.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 127

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 67/123 (54%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +   ++F+ F +    + Y      +S   
Sbjct: 5   RTPLKNVRGLGTAKTGTDHFVHQRLTATALVFLSLWFVYFVLGLVGSDYMAATDAVSKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    +++  H QLG+QV++EDY+H  L+ +          +L  I  +F++ +IA
Sbjct: 65  NAVLLVGFLVAMFWHAQLGLQVVLEDYVHNSLVALALQVSVKFIAVLGAIVSIFAVARIA 124

Query: 126 ILG 128
           + G
Sbjct: 125 LAG 127


>gi|330991157|ref|ZP_08315110.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Gluconacetobacter sp. SXCC-1]
 gi|329761743|gb|EGG78234.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Gluconacetobacter sp. SXCC-1]
          Length = 143

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 66/125 (52%), Gaps = 1/125 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS L R RG+GS + G GH+  +R +A+A +P   +F+    +   A   ++    +  
Sbjct: 12  MRSQLSRARGLGSGQAGVGHWWAERASAVALVPLSGWFVIQVFRLAGASQPEVAKWGARP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
              ++M    I    H QLG+QVII+DY+H +      L M    V LL +F   S+LK+
Sbjct: 72  FNTTMMLSLVILTFYHTQLGLQVIIDDYVHGKAHLPAGLLMKG-IVFLLGLFGTVSVLKL 130

Query: 125 AILGT 129
           A+ G+
Sbjct: 131 ALAGS 135


>gi|114799518|ref|YP_761917.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomonas neptunium ATCC 15444]
 gi|114739692|gb|ABI77817.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomonas neptunium ATCC 15444]
          Length = 129

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 58/98 (59%), Gaps = 6/98 (6%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIAN---IPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASI 69
           RG+GSAK GT H I+ R TAIA    +P+ ++ +   IK   A YE  ++ +     A++
Sbjct: 14  RGLGSAKSGTQHHIRLRVTAIALAFLVPWCLYAV---IKASGAGYEGALAWVGQPINATL 70

Query: 70  MGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNS 107
           + L   ++S HM+LGMQVIIEDYI     +   L +N+
Sbjct: 71  LILTAAAVSYHMRLGMQVIIEDYIAKTATRTTLLILNT 108


>gi|149184715|ref|ZP_01863033.1| succinate dehydrogenase, cytochrome b subunit [Erythrobacter sp.
           SD-21]
 gi|148832035|gb|EDL50468.1| succinate dehydrogenase, cytochrome b subunit [Erythrobacter sp.
           SD-21]
          Length = 128

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 68/125 (54%), Gaps = 6/125 (4%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFF---IAFFIKYGDAPYEQIVSVLSN 63
           + +GRVRG+GSA +G  H+++QRFTAI N+  ++F    IA    Y    Y  +    S 
Sbjct: 5   TPIGRVRGLGSAHEGPHHWLQQRFTAIGNLVLVLFLAVSIALLPSY---DYTTMSGWASQ 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A+ + L  I+   H ++G+QV+IEDY+H    K   + + +   +   +F L S+ +
Sbjct: 62  TLPATALALICINTFWHARIGLQVLIEDYVHTPGNKFACIALLNLAAIGGAVFGLVSIAR 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFGG 126


>gi|285018595|ref|YP_003376306.1| succinate dehydrogenase membrane anchor subunit protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473813|emb|CBA16315.1| putative succinate dehydrogenase membrane anchor subunit protein
           [Xanthomonas albilineans]
          Length = 128

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (53%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +   I+F+   +    A Y      ++   
Sbjct: 5   RTPLKNVRGLGAAKSGTEHFVLQRLTATALVGLTIWFLTLVLSLLGADYVTATQAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I++  H Q+G+QVI+EDY+H  LL +          +L  I  +F++ +IA
Sbjct: 65  NAVLLVGFLIAMFWHAQIGLQVILEDYVHNSLLALALQTTVKFIAVLGAIVGVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|28198268|ref|NP_778582.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa Temecula1]
 gi|182680905|ref|YP_001829065.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xylella fastidiosa M23]
 gi|28056338|gb|AAO28231.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa Temecula1]
 gi|182631015|gb|ACB91791.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xylella fastidiosa M23]
 gi|307579373|gb|ADN63342.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 127

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 69/121 (57%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L   RG+G+AK GTGHF+ QR TAIA +   ++F+AF +      Y   V+ ++   
Sbjct: 5   RTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    ++   H QLG+QV++EDYIH   L +    M     +L  +  +F++++IA
Sbjct: 65  NAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALTLQTMVRFIAVLGAVASVFAVVRIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|71275602|ref|ZP_00651887.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Dixon]
 gi|71899419|ref|ZP_00681578.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|71899499|ref|ZP_00681656.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|170729590|ref|YP_001775023.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa M12]
 gi|71163493|gb|EAO13210.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Dixon]
 gi|71730719|gb|EAO32793.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|71730828|gb|EAO32900.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|167964383|gb|ACA11393.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa M12]
          Length = 127

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 69/121 (57%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L   RG+G+AK GTGHF+ QR TAIA +   ++F+AF +      Y   V+ ++   
Sbjct: 5   RTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    ++   H QLG+QV++EDYIH   L +    M     +L  +  +F++++IA
Sbjct: 65  NAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALALQTMVRFIAVLGAVASVFAVVRIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|86747452|ref|YP_483948.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris HaA2]
 gi|86570480|gb|ABD05037.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris HaA2]
          Length = 140

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 72/128 (56%), Gaps = 8/128 (6%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIAN----IPFIIFFIAFFIKYGDAPYEQI 57
           +  MR+ +G+VR +G A  GT  F +QR T +A     +P I+  I   +    A   QI
Sbjct: 14  ERTMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLILPVIVV-IMMLLGRNQAGAAQI 72

Query: 58  VSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
              L +  ++  M L  I+ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  
Sbjct: 73  ---LGSPLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNFFSIAVALAA 129

Query: 118 LFSLLKIA 125
           +F++ K+A
Sbjct: 130 IFAIFKLA 137


>gi|87199762|ref|YP_497019.1| succinate dehydrogenase subunit D [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135443|gb|ABD26185.1| succinate dehydrogenase subunit D [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 127

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 66/122 (54%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +S+GRVRG+GS+ +GT H++  R TA+ N+  I F +       D  Y  +   ++    
Sbjct: 5   TSIGRVRGLGSSHEGTHHWLTARLTAVGNLVLITFLVVSLALLPDYSYATVRGWVARPVP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           +  + L  I+   H ++G+QV++EDY+H    KI    + +    +   F + S+L+IA+
Sbjct: 65  SIALILIMINTFTHARMGVQVMLEDYVHEEGGKIAAWLLVNIVPFVAAAFGILSVLRIAL 124

Query: 127 LG 128
            G
Sbjct: 125 GG 126


>gi|153868749|ref|ZP_01998496.1| succinate dehydrogenase membrane anchor subunit [Beggiatoa sp. PS]
 gi|152074660|gb|EDN71494.1| succinate dehydrogenase membrane anchor subunit [Beggiatoa sp. PS]
          Length = 128

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 73/127 (57%), Gaps = 7/127 (5%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIA----FFIKYGDAPYEQIVSVL 61
           ++ L +VR  GSA++GT HFI QR +AIA +P +++F+A    F +K   A   + + + 
Sbjct: 5   QTPLSQVRLWGSAREGTSHFIAQRLSAIALVPLLLWFVAAIIFFIVKADHASLVEWIRLY 64

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            N  +  ++ L T     H   G+Q I+ DY+H  ++K + + +   FV+ + +  + ++
Sbjct: 65  WNTELLILLILLTFH---HAHAGLQEILVDYVHNEIIKAIVMTLMKFFVIGITVASVLAV 121

Query: 122 LKIAILG 128
           L+IA+ G
Sbjct: 122 LRIALGG 128


>gi|53804138|ref|YP_114004.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylococcus capsulatus str. Bath]
 gi|53757899|gb|AAU92190.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Methylococcus capsulatus str. Bath]
          Length = 126

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           + R+ L R RG+GSA++G   + +QR TA+A +P  ++F         A + ++V+ + N
Sbjct: 3   NYRTPLARARGLGSAREGLHDWWRQRVTAVALVPLGLWFAFSVALLPSASHAELVAWI-N 61

Query: 64  VAVASIMGLGTISIS-VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           V   +++ L  I I+  H  LG+QV+IEDY+H   LK++ +      V  L +  ++++L
Sbjct: 62  VPWNTLLLLSFILIAFYHTMLGLQVVIEDYVHLDWLKLVGILGVKLVVSFLTLAAVYAIL 121

Query: 123 KI 124
           +I
Sbjct: 122 RI 123


>gi|289665884|ref|ZP_06487465.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 128

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 68/121 (56%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I    H QLGMQV++EDY+H  LL +M   +     +L  I  +F++ +IA
Sbjct: 65  NAILLVAFLIVSFWHAQLGMQVVLEDYVHDSLLALMAQTLVRFVAVLGAIVSVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|39933295|ref|NP_945571.1| succinate dehydrogenase cytochrome b subunit [Rhodopseudomonas
           palustris CGA009]
 gi|192288648|ref|YP_001989253.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris TIE-1]
 gi|39652920|emb|CAE25662.1| succinate dehydrogenase cytochrome b small subunit
           [Rhodopseudomonas palustris CGA009]
 gi|192282397|gb|ACE98777.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris TIE-1]
          Length = 137

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 71/126 (56%), Gaps = 8/126 (6%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIAN----IPFIIFFIAFFIKYGDAPYEQIVS 59
            MR+ +G+VR  G A  GT  F +QR T +A     +P I+  I   +    A   QI  
Sbjct: 13  SMRTPIGKVRKFGPAGSGTSDFWQQRITGVAMALLILPTIVV-IMMLLGRNQAAAAQI-- 69

Query: 60  VLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
            L +  ++ IM L  I+ ++HM++GMQV+IEDY+    LK++ +  N+ F + + +  +F
Sbjct: 70  -LGSPLISLIMILFIIASAIHMKIGMQVVIEDYVQNEKLKLVTIMANNFFSIAVALAAIF 128

Query: 120 SLLKIA 125
           ++ K+A
Sbjct: 129 AIFKMA 134


>gi|254448797|ref|ZP_05062254.1| succinate dehydrogenase, hydrophobic membrane anchor protein [gamma
           proteobacterium HTCC5015]
 gi|198261638|gb|EDY85926.1| succinate dehydrogenase, hydrophobic membrane anchor protein [gamma
           proteobacterium HTCC5015]
          Length = 120

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 66/122 (54%), Gaps = 8/122 (6%)

Query: 9   LGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVAS 68
           + +  G+GSAKDGT HF+ QR T IA +P +++        G A    +   ++N   A+
Sbjct: 1   MSKAYGLGSAKDGTHHFMIQRLTGIALVPLMLWLTFSIACLGGADLASVRDFIANPLNAT 60

Query: 69  IMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILG 128
           ++   T+S+  H  LGMQV++EDY+    L++         V +LI F  F+L  ++IL 
Sbjct: 61  LLICLTVSVFYHSSLGMQVVLEDYLRPHWLRLT--------VQILINFANFALAVVSILA 112

Query: 129 TL 130
            L
Sbjct: 113 IL 114


>gi|21242815|ref|NP_642397.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|21108301|gb|AAM36933.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|50981402|gb|AAT91479.1| succinate dehydrogenase subunit D [Xanthomonas citri]
          Length = 128

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 69/121 (57%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLVFVLSLIGADHAAASAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I+   H QLGMQV++EDY+H  LL ++   +     +L  I  +F++ +IA
Sbjct: 65  NAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALIAQTLVRFVAVLGAIVSVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|288957015|ref|YP_003447356.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azospirillum sp. B510]
 gi|288909323|dbj|BAI70812.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azospirillum sp. B510]
          Length = 131

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           +RS L   RG+GSAK GT H+  QR TAIA +P  ++F+   I +  A +   V+ + + 
Sbjct: 8   LRSPLQVARGLGSAKHGTEHWWSQRLTAIALVPLTVWFVFGVIGHLGADHAAFVAWMKSP 67

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKI 100
             A +M L  +    H Q G+QV+IEDY++    K+
Sbjct: 68  FSAVMMVLTAVVTFHHAQSGLQVVIEDYVNVEWQKM 103


>gi|296532572|ref|ZP_06895278.1| succinate dehydrogenase membrane anchor subunit [Roseomonas
           cervicalis ATCC 49957]
 gi|296267097|gb|EFH13016.1| succinate dehydrogenase membrane anchor subunit [Roseomonas
           cervicalis ATCC 49957]
          Length = 132

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 69/126 (54%), Gaps = 2/126 (1%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              + S+LGRVRG+GSAK GT H+  QR +++A +P  ++F+          +E  ++ +
Sbjct: 8   SLRLESALGRVRGLGSAKQGTHHWWMQRVSSMALLPLTLWFVISVATLAGKSHEATIAWI 67

Query: 62  SNVAVASIMGLGTISIS-VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           ++  + +++ L +I +S  H   G+QV+IEDY+     ++  +        L  +    +
Sbjct: 68  AH-PLNAVLLLASIGLSFQHAASGLQVVIEDYVRGEFARMFSVLAVKAACWLFGLLSAIA 126

Query: 121 LLKIAI 126
           +LKIA+
Sbjct: 127 VLKIAL 132


>gi|182679665|ref|YP_001833811.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635548|gb|ACB96322.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 130

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 68/124 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR++  RVR +G+A+ GT      R T++A +P  I F+   +      Y+ +V+ L +
Sbjct: 7   SMRTAASRVRFLGAARSGTAETWHMRATSVALLPLSIAFVWIVLSLLGKNYQDVVATLGS 66

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A ++ L  ++   HM++GMQ II+DY+H    K   L  N  F   + + C++++LK
Sbjct: 67  PLPALLILLFVLASVYHMKIGMQSIIDDYVHEPHFKDWALLGNLFFSFCIGLACIYAVLK 126

Query: 124 IAIL 127
           ++ L
Sbjct: 127 LSFL 130


>gi|294624874|ref|ZP_06703531.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|294665037|ref|ZP_06730344.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292600833|gb|EFF44913.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292605194|gb|EFF48538.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 128

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 22/132 (16%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK-----------YGDAPY 54
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +                P+
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLIGADHAAASAAVAKPW 64

Query: 55  EQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
             I  +L    VAS           H QLGMQV++EDY+H  LL ++   +     +L  
Sbjct: 65  NAI--LLVAFLVASFW---------HAQLGMQVVLEDYVHDSLLALIAQTLVRFVAVLGA 113

Query: 115 IFCLFSLLKIAI 126
           I  +F++ +IA+
Sbjct: 114 IVSVFAVARIAL 125


>gi|78047798|ref|YP_363973.1| putative succinate dehydrogenase membrane anchor subunit
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325928376|ref|ZP_08189571.1| succinate dehydrogenase subunit D [Xanthomonas perforans 91-118]
 gi|78036228|emb|CAJ23919.1| putative succinate dehydrogenase membrane anchor subunit
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325541252|gb|EGD12799.1| succinate dehydrogenase subunit D [Xanthomonas perforans 91-118]
          Length = 128

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 69/121 (57%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLIGADHAAATAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I+   H QLGMQV++EDY+H  LL ++   +     +L  I  +F++ +IA
Sbjct: 65  NAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALIAQTLVRFVAVLGAIVSVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|170746892|ref|YP_001753152.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium radiotolerans JCM 2831]
 gi|170653414|gb|ACB22469.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium radiotolerans JCM 2831]
          Length = 139

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 60/101 (59%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            +R+   RVRG+G +  G  H+  QR TA+AN+  ++ F+    K     Y +   +++ 
Sbjct: 13  SIRTPRARVRGLGVSHHGADHWWLQRLTAVANVVLMLSFVVIIAKMAGRGYAEARLLVAT 72

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLF 104
             V+ ++ L  +S++VHM+LGMQVIIEDY+H    KI  +F
Sbjct: 73  PLVSILLILALLSVTVHMRLGMQVIIEDYVHAPSTKIAAVF 113


>gi|325917572|ref|ZP_08179772.1| succinate dehydrogenase subunit D [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536206|gb|EGD08002.1| succinate dehydrogenase subunit D [Xanthomonas vesicatoria ATCC
           35937]
          Length = 128

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 22/132 (16%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK-----------YGDAPY 54
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +                P+
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVVQRLTATALVPLSIWFLIFVLSLIGADHAAASAAVAKPW 64

Query: 55  EQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
             I  +L    +AS           H QLGMQV++EDY+H  LL +    +     +L  
Sbjct: 65  NAI--LLVGFLIASFW---------HAQLGMQVVLEDYVHNSLLALAAQTIVRFVAVLGA 113

Query: 115 IFCLFSLLKIAI 126
           I  +F++ +IA+
Sbjct: 114 IVSVFAVARIAL 125


>gi|332285735|ref|YP_004417646.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Pusillimonas sp. T7-7]
 gi|330429688|gb|AEC21022.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Pusillimonas sp. T7-7]
          Length = 137

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 64/121 (52%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            +R+ L   R +GS+K G  H+  QR TAIA IP  I+ + F      A Y  +++ ++ 
Sbjct: 9   SLRTPLKVARRLGSSKSGVHHWWLQRLTAIALIPLSIWLLYFMGALMHASYPTVLAAIAQ 68

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A  + + ++ +  H  LG+QVIIEDY+H R L++          +L  + C+ ++L 
Sbjct: 69  PVHAIFLIVLSLCLFWHGALGLQVIIEDYVHTRWLEVALQIALRFGAILATLACVLAVLA 128

Query: 124 I 124
           I
Sbjct: 129 I 129


>gi|88812337|ref|ZP_01127587.1| succinate dehydrogenase membrane anchor subunit [Nitrococcus
           mobilis Nb-231]
 gi|88790344|gb|EAR21461.1| succinate dehydrogenase membrane anchor subunit [Nitrococcus
           mobilis Nb-231]
          Length = 126

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 70/123 (56%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L +  G+G++  GT  +  QR +++A +P +I+ I   +++G A Y    + LS+  
Sbjct: 4   RTPLKQALGLGASHSGTSRWWAQRVSSVALVPLLIWLIIGIVRHGGADYTDAQAWLSSPI 63

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A +  L  ++   H  LGMQVI+EDY+ +  +++  + +     ++L +  +F++L +A
Sbjct: 64  TAVLTILTLVASFYHGALGMQVIVEDYVSHETVQLALVVLVKFAAMVLAVAGIFAVLLVA 123

Query: 126 ILG 128
           + G
Sbjct: 124 LGG 126


>gi|58581932|ref|YP_200948.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84623844|ref|YP_451216.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|188576492|ref|YP_001913421.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|50313516|gb|AAT74620.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae]
 gi|58426526|gb|AAW75563.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84367784|dbj|BAE68942.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|188520944|gb|ACD58889.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 128

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 68/121 (56%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVMQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I+   H QLGMQV++EDY+H  LL +    +     ++  I  +F++ +IA
Sbjct: 65  NAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALTAQTLVRFVAVVGAIVSVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|83592539|ref|YP_426291.1| succinate dehydrogenase subunit D [Rhodospirillum rubrum ATCC
           11170]
 gi|83575453|gb|ABC22004.1| succinate dehydrogenase subunit D [Rhodospirillum rubrum ATCC
           11170]
          Length = 128

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 2/123 (1%)

Query: 4   DMRSSLGRVRGMGSAKDGTG-HFIKQRFTAIANIPFIIFFI-AFFIKYGDAPYEQIVSVL 61
            +RS LGR RG+GSAK G   H++ +R  AIA +P  ++F+    I    A Y QI + +
Sbjct: 2   SLRSPLGRARGLGSAKAGAANHWMAERLPAIALVPLALWFVFVAIISNLGASYAQIQAFM 61

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +    A++M L       H  LG+ VIIEDY+    +K   +F    + L   +    S+
Sbjct: 62  AVPLNATLMLLTVFCAFFHGALGLIVIIEDYVQNHAVKNALVFGTKLYALFGAVLAAVSI 121

Query: 122 LKI 124
           LK+
Sbjct: 122 LKL 124


>gi|166712287|ref|ZP_02243494.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 128

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 68/121 (56%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++   
Sbjct: 5   RTPLKNVRGLGAAKTGTEHFVMQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVAKPW 64

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++    I+   H QLGMQV++EDY+H  LL +    +     ++  I  +F++ +IA
Sbjct: 65  NAILLVAFLIASFWHAQLGMQVVLEDYVHDPLLALTAQTLVRFVAVVGAIVSVFAVARIA 124

Query: 126 I 126
           +
Sbjct: 125 L 125


>gi|114707254|ref|ZP_01440152.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Fulvimarina pelagi HTCC2506]
 gi|114537450|gb|EAU40576.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Fulvimarina pelagi HTCC2506]
          Length = 113

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGT 74
           MG++  GT HF +QR TAIAN+     F+   +    A   ++     N  + ++  L  
Sbjct: 1   MGASSGGTEHFWQQRLTAIANLVLFTTFLIIVLTLIGADITEVRETFGNPIIGTLAALMI 60

Query: 75  ISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
           +S  VHM+LGMQ I+EDY+H   +K      N+ F  L+    L++++K++
Sbjct: 61  VSACVHMRLGMQTILEDYVHGP-MKWPLAIANTFFACLIAALGLYAIVKMS 110


>gi|115522539|ref|YP_779450.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisA53]
 gi|115516486|gb|ABJ04470.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris
           BisA53]
          Length = 137

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 69/121 (57%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+ LG+VR +G A+ GT  F +QR T +A    I+  I   +            +L + 
Sbjct: 14  MRTPLGKVRKLGPARSGTSDFWQQRITGVAMTLLILPVIIIIMMLLGRNQAGAAQILGSP 73

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            +A  M L  ++ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  +F+++K+
Sbjct: 74  LIALTMILFIVASAIHMKIGMQVVIEDYIQNEKLKLVTIMANNFFSIAVALAPIFAIIKL 133

Query: 125 A 125
           +
Sbjct: 134 S 134


>gi|209883445|ref|YP_002287302.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Oligotropha carboxidovorans OM5]
 gi|209871641|gb|ACI91437.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Oligotropha carboxidovorans OM5]
          Length = 134

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 8/129 (6%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIAN----IPFIIFFIAFFIKYGDAPYEQI 57
           +  MR+ L  VR +G+A  GT  F +QR TA+A     IP  +  I    +  D    Q 
Sbjct: 8   NVSMRTPLANVRRLGAAHGGTSDFFRQRLTAVAMALLMIPVAVIVIMLVGR--DQASAQ- 64

Query: 58  VSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
            ++L +  VA ++ L  I+  VHM++G+QV+IEDY+H    KI  +  N+ F   + +  
Sbjct: 65  -ALLGSPVVAILLTLFIIAGCVHMKIGVQVVIEDYVHSEAAKISAILANNFFSFAVGLAS 123

Query: 118 LFSLLKIAI 126
           ++++ K+++
Sbjct: 124 IYAIFKLSV 132


>gi|91974960|ref|YP_567619.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB5]
 gi|91681416|gb|ABE37718.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris
           BisB5]
          Length = 140

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 66/122 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ +G+VR +G A  GT  F +QR T +A     +  +   +            +L +
Sbjct: 16  SMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLTLPVVVVVMMLLGRNQAGAAQILGS 75

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             ++  M L  I+ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  +F++ K
Sbjct: 76  PLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNFFTIAVALAAIFAIFK 135

Query: 124 IA 125
           +A
Sbjct: 136 LA 137


>gi|90421599|ref|YP_529969.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB18]
 gi|90103613|gb|ABD85650.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris
           BisB18]
          Length = 140

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 8/126 (6%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIAN----IPFIIFFIAFFIKYGDAPYEQIVS 59
            +R+ LG+VR  G A  GT  F +QR T +A     +P ++  I   +    A   QI+ 
Sbjct: 16  SLRTPLGKVRKFGPAGSGTSDFWQQRITGVAMTLLILPVVVV-IMMLLGRNQAGAAQIIG 74

Query: 60  VLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
              +  +A  + L  IS +VHM++GMQV+IEDY+    LK++ +  N+ F + + +  +F
Sbjct: 75  ---SPLIALTLILFIISSAVHMKIGMQVVIEDYVQNEKLKLVTIMANNFFSIAVALAAIF 131

Query: 120 SLLKIA 125
           ++ K++
Sbjct: 132 AIFKLS 137


>gi|296285023|ref|ZP_06863021.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Citromicrobium bathyomarinum JL354]
          Length = 128

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 69/123 (56%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +S+GRVRG+GSA +G  H++ QRFTAI N+  ++F +  F+      Y  +   LS+   
Sbjct: 5   TSIGRVRGLGSAHEGAHHWLLQRFTAIGNLVLVLFLLVSFLLLPAYDYGTVTGWLSSPIA 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A+ + L  +S   H +LG+QV+IEDYIH    +   + + +   +   +F +F +  IA 
Sbjct: 65  AAALILLIVSTFWHARLGLQVLIEDYIHQGGSRFALIALLNLVAVAGAVFGIFCIASIAF 124

Query: 127 LGT 129
            G 
Sbjct: 125 AGA 127


>gi|16127758|ref|NP_422322.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter crescentus CB15]
 gi|13425260|gb|AAK25490.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Caulobacter crescentus CB15]
          Length = 139

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L R RGMG+++ G  HFI +R + +A  P  ++     +K   AP++ +V  ++   
Sbjct: 13  RTPLSRARGMGASRHGVSHFITERVSGLALAPLTVWGAYAALKQVRAPHDVVVQWMAQPV 72

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++ L  I+  VH+Q  +QV+IEDYI     K   +  N    +L     +FS+LK+A
Sbjct: 73  NAVLLSLLLIAALVHLQSAVQVVIEDYIERFTTKTALVIGNLFVCVLAGAVGVFSILKVA 132

Query: 126 I 126
           +
Sbjct: 133 L 133


>gi|144898838|emb|CAM75702.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 127

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 2/126 (1%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            +RS +GR RG+GSAK G GH      +A+  IP  ++F+    +   A +    + ++ 
Sbjct: 3   TLRSPIGRARGLGSAKSGMGHHWSTIVSAVGLIPLSLWFVVSIARLAGADHAVFTAWIAK 62

Query: 64  VAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              A+++ L TI ++  H  LG+ ++IEDY+  +  K   L        LL +    S+L
Sbjct: 63  GPNAALLIL-TIGLTCYHASLGLSMVIEDYVTCKAKKFAALLATRLIAALLAVGMSVSIL 121

Query: 123 KIAILG 128
           K+AI G
Sbjct: 122 KVAIGG 127


>gi|241518580|ref|YP_002979208.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862993|gb|ACS60657.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 127

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 70/121 (57%), Gaps = 6/121 (4%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIA---NIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           M + LGRVRG+GSA  GT  ++ ++ + IA     P+I+    +   +G      ++SV 
Sbjct: 1   MTTPLGRVRGLGSAHGGTKAYVLKQASGIAIGVLTPYIVGLGIYL--FGRDRDFLVLSVG 58

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S      ++    +S ++HM++GM+ IIEDY+H  + K+  LF+NS F   + + C+F++
Sbjct: 59  SFWVGPPLLAFVILS-AIHMEIGMRTIIEDYVHGHMRKLALLFLNSAFTWSVCLLCVFAI 117

Query: 122 L 122
           +
Sbjct: 118 V 118


>gi|221236579|ref|YP_002519016.1| succinate dehydrogenase membrane anchor subunit [Caulobacter
           crescentus NA1000]
 gi|220965752|gb|ACL97108.1| succinate dehydrogenase membrane anchor subunit [Caulobacter
           crescentus NA1000]
          Length = 151

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L R RGMG+++ G  HFI +R + +A  P  ++     +K   AP++ +V  ++   
Sbjct: 25  RTPLSRARGMGASRHGVSHFITERVSGLALAPLTVWGAYAALKQVRAPHDVVVQWMAQPV 84

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A ++ L  I+  VH+Q  +QV+IEDYI     K   +  N    +L     +FS+LK+A
Sbjct: 85  NAVLLSLLLIAALVHLQSAVQVVIEDYIERFTTKTALVIGNLFVCVLAGAVGVFSILKVA 144

Query: 126 I 126
           +
Sbjct: 145 L 145


>gi|114769285|ref|ZP_01446911.1| probable succinate dehydrogenase membrane anchor subunit protein
           [alpha proteobacterium HTCC2255]
 gi|114550202|gb|EAU53083.1| probable succinate dehydrogenase membrane anchor subunit protein
           [alpha proteobacterium HTCC2255]
          Length = 126

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 63/123 (51%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+   +V G+GSAK G  H+  +R  ++A IP  I F++         +  ++S   N  
Sbjct: 4   RTDRAKVLGLGSAKSGADHWFGERLKSVALIPLTIIFVSIVAPLIGKDHTTVISSFQNPF 63

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
           V+  + L  +    H++ G+QV+IEDY+H +   ++ +  N  F     +  +F++LKI 
Sbjct: 64  VSISLILFFLVSFKHLEEGLQVVIEDYVHSKGSLLLLIIFNKLFCWTFGLAAVFAILKIT 123

Query: 126 ILG 128
             G
Sbjct: 124 FAG 126


>gi|121996855|ref|YP_001001642.1| succinate dehydrogenase, cytochrome b subunit [Halorhodospira
          halophila SL1]
 gi|121588260|gb|ABM60840.1| succinate dehydrogenase subunit D [Halorhodospira halophila SL1]
          Length = 127

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 6  RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFF-IAFFIKYGDAPYEQIVSVLSNV 64
           +++ R RG+GSAK+G  H+  QR TA+  +P +++  I   ++ G A +E   + ++N 
Sbjct: 5  ETAVSRARGLGSAKNGFHHWWHQRLTALVLVPLMMWLGIGLALQAG-ADFEAARAWVANP 63

Query: 65 AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLK 99
            A+++    I +  H  LG+QV+IEDY+H   LK
Sbjct: 64 FNATLLIAAIIMLFYHGALGVQVVIEDYVHLEGLK 98


>gi|46203231|ref|ZP_00051839.2| COG2142: Succinate dehydrogenase, hydrophobic anchor subunit
          [Magnetospirillum magnetotacticum MS-1]
          Length = 131

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%)

Query: 3  FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
            MR+   RV+G+G++  G GHF  QR T  +N   ++ F+          Y Q V+++S
Sbjct: 12 LSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALVS 71

Query: 63 NVAVASIMGLGTISISVHMQLGMQ 86
          +  VA I+ L  +S++ HM++GMQ
Sbjct: 72 HPLVAIILILAVVSVATHMRIGMQ 95


>gi|84684218|ref|ZP_01012120.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Maritimibacter alkaliphilus HTCC2654]
 gi|84667971|gb|EAQ14439.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Rhodobacterales bacterium HTCC2654]
          Length = 125

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (58%), Gaps = 6/94 (6%)

Query: 6  RSSLGRVRGMGSAKDGTGHFIKQRFTAIA---NIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
          ++   RV G+GSAK GTGHF +QR +AIA    +P  +F  A+    GD  YE + +  +
Sbjct: 4  QTDRARVEGLGSAKQGTGHFWEQRISAIALLFLVPLFVFPFAY--NLGDG-YEAVRAAYA 60

Query: 63 NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYR 96
          +   A I     ++  +H+  G+QV++EDY+H R
Sbjct: 61 HPVNAIIAIAFFLTAFLHLFQGVQVVVEDYVHGR 94


>gi|217979668|ref|YP_002363815.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylocella silvestris BL2]
 gi|217505044|gb|ACK52453.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylocella silvestris BL2]
          Length = 129

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 2/128 (1%)

Query: 1   MDFDMRSSLGRVRG--MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIV 58
           M  D  SS   VR   +GSAK G         T++A +P  I F+   +      Y  + 
Sbjct: 1   MAHDKSSSRSPVRKGFLGSAKSGASDAWSMHVTSVALLPLAIGFVWVMLSLMHKDYAGVK 60

Query: 59  SVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + L +   A ++ L  ++   HM+LGMQ II+DYIH    K   L  N CF   + +  +
Sbjct: 61  AELGHPLPAIVLLLFILAGCWHMKLGMQSIIDDYIHAPHAKEWALVGNFCFSAAIALASV 120

Query: 119 FSLLKIAI 126
           F+++K+ +
Sbjct: 121 FAVVKLGL 128


>gi|326387616|ref|ZP_08209222.1| succinate dehydrogenase subunit D [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207662|gb|EGD58473.1| succinate dehydrogenase subunit D [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 118

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           RG+GS+  G  H++  R TA+ N+  I + I       D  +  + S L+    A+ + L
Sbjct: 2   RGLGSSHQGAHHWLLTRLTAVGNLILIPYLIVSLALLPDFEWATVHSWLAKPVPATALIL 61

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
             I+   H +LG+QV++EDY+H    KI    + +        F + S+++IA+
Sbjct: 62  TFINTFYHARLGIQVMLEDYVHEEAGKIAAWLLVNIVPFAAGAFGVVSVIRIAL 115


>gi|84515884|ref|ZP_01003245.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Loktanella vestfoldensis SKA53]
 gi|84510326|gb|EAQ06782.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Loktanella vestfoldensis SKA53]
          Length = 123

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 59/116 (50%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GMGSAK GT H  +   T++A +  I  F+  F     APY ++++       A + 
Sbjct: 9   RAVGMGSAKSGTHHHWQMMVTSVALLVLIPLFVFTFGTILGAPYAEVIAYYQRPFPAVVA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L  +    H +LG+Q +IEDY+H    K   +FM  C       F +F++++IA+
Sbjct: 69  ILTMLVGFFHFRLGVQTVIEDYVHGFARKAAIIFMI-CLSYAAAGFAVFAIIRIAL 123


>gi|83943850|ref|ZP_00956307.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. EE-36]
 gi|83845097|gb|EAP82977.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. EE-36]
          Length = 123

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GMGSAK GT HF   + +++A +  I  F+  F       YE+I++  S    A + 
Sbjct: 9   RAMGMGSAKSGTAHFWAMKVSSVALLILIPLFVFTFGAALGGTYEEIIAYYSRPFPAIVA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L  I    H   G+QV+IEDY+H    K+  + M +C         +F++ +IA+
Sbjct: 69  ALTLIVGFKHFNDGVQVLIEDYVHGLSQKVAIILM-TCLSYGAAAVGVFAIARIAL 123


>gi|119385744|ref|YP_916799.1| succinate dehydrogenase, cytochrome b subunit [Paracoccus
           denitrificans PD1222]
 gi|119376339|gb|ABL71103.1| succinate dehydrogenase subunit D [Paracoccus denitrificans PD1222]
          Length = 127

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 64/117 (54%), Gaps = 5/117 (4%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R RG+G+A  GTG +  QR +A   +P +++F         A + ++V+ L+    + +M
Sbjct: 11  RARGLGAAGHGTGRWWAQRVSAAGLVPLVLWFALALAGGAAADHAKLVAWLAAPLNSGLM 70

Query: 71  GLGTISISVHMQLGMQVIIEDYIH--YRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            L  ++   H  LG+QV+ EDYIH   R +    + + +CF    ++F + S+L+IA
Sbjct: 71  ILLLMAGFHHAALGLQVLAEDYIHSGARFVAAAAIQL-ACFA--GVVFGIASVLRIA 124


>gi|304320538|ref|YP_003854181.1| hypothetical protein PB2503_04822 [Parvularcula bermudensis
          HTCC2503]
 gi|303299440|gb|ADM09039.1| hypothetical protein PB2503_04822 [Parvularcula bermudensis
          HTCC2503]
          Length = 112

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%)

Query: 18 AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
          +   T H+I QRFTA+  IP +I+ +   I +     +Q    LS    AS+M +  +S+
Sbjct: 2  SSKPTKHYIAQRFTALIQIPLVIWLVFGVIGHAGDTQDQFRVWLSEPLTASLMIIFILSV 61

Query: 78 SVHMQLGMQVIIEDYIH 94
            HM LGM  +++DYIH
Sbjct: 62 FFHMHLGMGEVVDDYIH 78


>gi|83953491|ref|ZP_00962213.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83842459|gb|EAP81627.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 123

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT HF   + +++A +  I  F+  F       YE+I++  S    A + 
Sbjct: 9   RAMGLGSAKSGTAHFWAMKVSSVALLILIPLFVFTFGSALGGTYEEIIAYYSRPFPAIVA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L  I    H   G+QV+IEDY+H    K+  + M +C         +F++ +IA+
Sbjct: 69  ALTLIVGFKHFNDGVQVLIEDYVHGLSQKVAIILM-TCLSYGAAAVGVFAIARIAL 123


>gi|91205982|ref|YP_538337.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii RML369-C]
 gi|157826654|ref|YP_001495718.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii OSU 85-389]
 gi|122425295|sp|Q1RHB6|DHSD_RICBR RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|91069526|gb|ABE05248.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii RML369-C]
 gi|157801958|gb|ABV78681.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii OSU 85-389]
          Length = 125

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 57/115 (49%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D R+ + + +  GSAK G+ H++ QR TAI  +   ++ + F +   ++    I+  
Sbjct: 1   MTYDFRAEIVKAKNTGSAKSGSHHWLLQRITAIILVLCSLWLLYFTLANKNSDVNIIIWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLII 115
           L        + +  I+   H  LGMQV+IEDYI    L+   +     F +L I+
Sbjct: 61  LKRPINLIPLLIAVITSLYHAMLGMQVVIEDYISCNKLRNTLIIAVKLFSILTIV 115


>gi|6649875|gb|AAF21610.1|AF018287_4 SdhD [papaya bunchy top disease rickettsia]
          Length = 125

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 10/124 (8%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D R+ + + +  GSAK G+ H++ QR TAI      ++ I F +   ++    I+  
Sbjct: 1   MTYDFRAEILKAKNTGSAKSGSHHWLLQRITAIILALCSVWLIYFTLANKNSDVNIIIWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +  I+   H  LGMQV+IEDYI    L+      N+    L+I+  LFS
Sbjct: 61  LKRPINLVPLLIAVITSLYHAMLGMQVVIEDYIGCNKLR------NT----LVIVVKLFS 110

Query: 121 LLKI 124
           +L I
Sbjct: 111 ILTI 114


>gi|126734840|ref|ZP_01750586.1| succinate dehydrogenase [Roseobacter sp. CCS2]
 gi|126715395|gb|EBA12260.1| succinate dehydrogenase [Roseobacter sp. CCS2]
          Length = 123

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 45/84 (53%)

Query: 11 RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
          R  GMGSAK GT H  +   T++A +  I  FI  F     APYE++++       A + 
Sbjct: 9  RASGMGSAKTGTEHHWQMMVTSVALLILIPMFIFTFGWILGAPYEEVIAYYQRPFPAVVA 68

Query: 71 GLGTISISVHMQLGMQVIIEDYIH 94
           L  +    H +LG+Q +IEDY+H
Sbjct: 69 ILTLLVGFFHYRLGVQTLIEDYVH 92


>gi|3273340|dbj|BAA31211.1| succinate dehydrogenase cytochrome b small subunit [Rhodospirillum
           rubrum]
          Length = 127

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 1/126 (0%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFI-AFFIKYGDAPYEQIVSVLS 62
            +RS LGR R          H++ +R  AIA +P  ++F+    I    A Y QI + ++
Sbjct: 2   SLRSPLGRARRGFRQGGAANHWMAERLPAIALVPLALWFVFVAIISNLGASYAQIQAFMA 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               A++M L       H  LG+ VIIEDY+    +K   +F    + L   +    S+L
Sbjct: 62  VPLNATLMLLTVFCAFFHGALGLIVIIEDYVQNHAVKNALVFGTKLYALFGAVLAAVSIL 121

Query: 123 KIAILG 128
           K+   G
Sbjct: 122 KLTFGG 127


>gi|167648794|ref|YP_001686457.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter sp. K31]
 gi|167351224|gb|ABZ73959.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter sp. K31]
          Length = 135

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 66/124 (53%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ + R RG+G+++ G  HFI +R + +A IP  ++ +   ++     ++     ++   
Sbjct: 11  RTPMSRARGLGASRHGVAHFITERVSGVALIPLALWGLFAALRLASLGFDGAAEWVAIPC 70

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            A+++ L  +   +H++  +QV+IEDYI    LK + +  N    +L  +  + ++LK+A
Sbjct: 71  NAALLCLLLVVALIHLKGAVQVVIEDYIADFTLKTVLVLANLFVCVLGGVLGVVAILKVA 130

Query: 126 ILGT 129
             G 
Sbjct: 131 FTGA 134


>gi|254486788|ref|ZP_05099993.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseobacter sp. GAI101]
 gi|214043657|gb|EEB84295.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseobacter sp. GAI101]
          Length = 123

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 62/117 (52%), Gaps = 3/117 (2%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GMGSAK GT HF   + +++A +  I  F+  F       YE+I++  +    A I 
Sbjct: 9   RAVGMGSAKSGTAHFWAMKVSSVALLILIPLFVFTFGAALGGTYEEILAYYAKPFPALIA 68

Query: 71  GLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L TI++   H   G+QV+IEDY+H    K+  + M +C         +F+++++A+
Sbjct: 69  AL-TIAVGFKHFNDGVQVLIEDYVHGLSQKVAIILM-TCLSYGAAAAGVFAIIRLAL 123


>gi|326404268|ref|YP_004284350.1| succinate dehydrogenase membrane anchor subunit [Acidiphilium
           multivorum AIU301]
 gi|325051130|dbj|BAJ81468.1| succinate dehydrogenase membrane anchor subunit [Acidiphilium
           multivorum AIU301]
          Length = 122

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS+LGR RGMG+AK G  H+  QR TA+A +P  ++ +   +    A   +++  ++  
Sbjct: 1   MRSALGRARGMGAAKSGVHHWWAQRLTALALLPLALYAVLSVLLLEGASQAEMLRYMAEP 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIH---YRLLKIMFLFMNSCFVLLLIIFCLFSL 121
               +     I++  H+QLG+QV+IEDYI     RL  ++ +   + F  LL I  +  L
Sbjct: 61  WNGVLFLALVIALFYHLQLGLQVVIEDYIRSEGKRLAVMLAMRATAGFFGLLAIISVLKL 120


>gi|148260874|ref|YP_001235001.1| succinate dehydrogenase, cytochrome b subunit [Acidiphilium cryptum
           JF-5]
 gi|146402555|gb|ABQ31082.1| succinate dehydrogenase subunit D [Acidiphilium cryptum JF-5]
          Length = 125

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS+LGR RGMG+AK G  H+  QR TA+A +P  ++ +   +    A   +++  ++  
Sbjct: 4   MRSALGRARGMGAAKSGVHHWWAQRLTALALLPLALYAVLSVLLLEGASQAEMLRYMAEP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIH---YRLLKIMFLFMNSCFVLLLIIFCLFSL 121
               +     I++  H+QLG+QV+IEDYI     RL  ++ +   + F  LL I  +  L
Sbjct: 64  WNGVLFLALVIALFYHLQLGLQVVIEDYIRSEGKRLAVMLAMRATAGFFGLLAIISVLKL 123


>gi|295687607|ref|YP_003591300.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Caulobacter segnis ATCC 21756]
 gi|295429510|gb|ADG08682.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter segnis ATCC 21756]
          Length = 139

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ L R RG+GS+  G  HFI +R + +A  P  ++ +   +K   A    + + L +  
Sbjct: 13  RTPLSRARGLGSSHHGVSHFITERVSGLALAPLSLWGVYSALKLIGADQHTVAAWLGHPL 72

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI-IFCLFSLLKI 124
            A ++ L  +S  VH+   +QV+IEDY+H R      L + + FV +L     +FS+LK+
Sbjct: 73  NAVLLLLLLLSALVHLSNAVQVVIEDYVH-RFTSKSALVIGNLFVCVLAGAIGIFSILKV 131

Query: 125 AI 126
           A+
Sbjct: 132 AL 133


>gi|56695274|ref|YP_165622.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria pomeroyi DSS-3]
 gi|56677011|gb|AAV93677.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria pomeroyi DSS-3]
          Length = 123

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GMGSAK GT HF   + +++A +  I  F+  F      P++ ++   S    A + 
Sbjct: 9   RAVGMGSAKTGTAHFWAMKVSSVALLILIPLFVFTFGPMLGEPHQAVLDYFSRPFPAIVA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L  +    H   G QV+IEDY+H  + KI+ + +  C         LF++ +IA+
Sbjct: 69  ALTLVVGFKHFADGAQVLIEDYVHGLMQKILIILVI-CLSYAAAATGLFAIARIAL 123


>gi|254463366|ref|ZP_05076782.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium HTCC2083]
 gi|206679955|gb|EDZ44442.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 123

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GMGSAK GT HF   + +++A +  +  FI  F     + Y ++++       A + 
Sbjct: 9   RATGMGSAKSGTHHFWSMKVSSVALLFLLPMFIFTFGGTLGSNYAEVMTYFGRPFPAIVA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L T+    H   G QV+IEDY+H  + K++ + + +C         +F++ K+A+
Sbjct: 69  ALTTLVGFKHFNDGAQVLIEDYVHGLMQKVLIILL-TCLSYGAAAVGIFAIAKLAL 123


>gi|163734149|ref|ZP_02141590.1| succinate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161392685|gb|EDQ17013.1| succinate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 123

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT H      ++ A +  I  F+  F     A YE++ +  +    A I 
Sbjct: 9   RAVGLGSAKSGTEHHWSMTVSSGALLILIPLFVFTFGPMLGASYEEVTAYFARPFPAVIA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           GL  I    H   G+Q ++EDY+H    K+  + M +C     + F L++++++A+
Sbjct: 69  GLTIIVTFKHFAGGVQALLEDYVHGVAQKVAIVAM-TCVSYAAMGFGLYAIVRLAL 123


>gi|163744266|ref|ZP_02151626.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanibulbus indolifex HEL-45]
 gi|161381084|gb|EDQ05493.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanibulbus indolifex HEL-45]
          Length = 120

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT HF   + +++A +  I  F+  F       YE+I++  +    A + 
Sbjct: 6   RALGLGSAKTGTAHFWAMKVSSLALLVLIPLFVFTFGSALGGTYEEILAYYARPFPAIVA 65

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
            L  I    H   G+QV+IEDY+H    KI  + M 
Sbjct: 66  ALTLIVGFKHFNDGVQVLIEDYVHGLANKIAIIVMT 101


>gi|239947121|ref|ZP_04698874.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921397|gb|EER21421.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 125

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 9/122 (7%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      I+ I F +   +     I+  
Sbjct: 1   MVYDFKAKIVKAKNSGSAKSGSHHWLLQRATGIILALCSIWLIYFTLTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           L       I  L T++IS+ H  LGM+V+IEDY+ Y  L+       +  ++++ +FC+ 
Sbjct: 61  LKK-PFNVIALLITVAISLYHAMLGMRVVIEDYVSYHKLR-------NTLIIIVQLFCIV 112

Query: 120 SL 121
           ++
Sbjct: 113 TI 114


>gi|260431520|ref|ZP_05785491.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415348|gb|EEX08607.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 123

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 3/117 (2%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT HF   + +++A +  +  F+  F      PY+ ++   S    A + 
Sbjct: 9   RALGLGSAKSGTQHFWAMKVSSVALLILVPLFVFTFGPTLGQPYDVMLDYYSRPFPAIVA 68

Query: 71  GLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L T+++   H   G QV+IEDY+H  L K++ + + +C         +F++ +IA+
Sbjct: 69  AL-TLAVGFKHFADGAQVMIEDYVHGTLEKVLIILV-TCLSYGAAAVGIFAIARIAL 123


>gi|254512425|ref|ZP_05124492.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacteraceae bacterium KLH11]
 gi|221536136|gb|EEE39124.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacteraceae bacterium KLH11]
          Length = 123

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT HF   + +++A +  +  FI  F      PY+ ++   S    A + 
Sbjct: 9   RAVGLGSAKSGTAHFWSMKVSSVALLILVPLFIFTFGPILGQPYDVVLDYYSRPFPAIVA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
            L  +    H   G QV+IEDY+H  + K++
Sbjct: 69  ALTLLVGFKHFADGAQVMIEDYVHGTMEKVL 99


>gi|126725052|ref|ZP_01740895.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium HTCC2150]
 gi|126706216|gb|EBA05306.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium HTCC2150]
          Length = 123

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 54/116 (46%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GMGSAK+GT HF     ++IA    +  FI  F    D  Y  + +  +    A + 
Sbjct: 9   RANGMGSAKEGTHHFWSMTVSSIALAILMPLFIFNFGPMLDESYADVQAHFARPYPAILT 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           GL  I    H ++G Q +IEDY+     KI  + + S      +   LF+L  IA+
Sbjct: 69  GLTLIVAFTHFKMGAQTMIEDYVKGGARKITIIAV-SLLSYAAMATGLFALASIAL 123


>gi|229586367|ref|YP_002844868.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia africae ESF-5]
 gi|228021417|gb|ACP53125.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia africae ESF-5]
          Length = 126

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 8/123 (6%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFMLTNKNNDINIIMLW 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
                   +  L T+ IS+ H  LGM+V+IEDYI Y  L+       +  ++++ +FC+ 
Sbjct: 61  ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLR-------NTLIIIVQLFCIV 113

Query: 120 SLL 122
           +++
Sbjct: 114 TIV 116


>gi|110678933|ref|YP_681940.1| hypothetical protein RD1_1627 [Roseobacter denitrificans OCh 114]
 gi|109455049|gb|ABG31254.1| suc [Roseobacter denitrificans OCh 114]
          Length = 123

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT H      ++ A +  I  F+  F     A Y+++ +  +    A I 
Sbjct: 9   RAVGLGSAKSGTEHHWSMTVSSGALLILIPLFVFTFGPMLGASYDEVTAYFARPFPAVIA 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           GL  I    H   G+Q ++EDY+H    K+  + M +C     + F L++++++A+
Sbjct: 69  GLTIIVTFKHFAGGVQALLEDYVHGVAQKVAIVAM-TCVSYAAMGFGLYAVVRLAL 123


>gi|156934785|ref|YP_001438701.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Cronobacter sakazakii ATCC BAA-894]
 gi|156533039|gb|ABU77865.1| hypothetical protein ESA_02625 [Cronobacter sakazakii ATCC BAA-894]
          Length = 115

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 54/113 (47%), Gaps = 11/113 (9%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R T+I    +II+ I FF   GD  YE      S+   
Sbjct: 6   SALGR--------NGVHDFILVRATSIVMTLYIIYMIGFFAMNGDLTYEVWTGFFSSTFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
                L  ISI VH  +GM  ++ DY+ +  L+   LF+    V+ L+++ ++
Sbjct: 58  KVFTLLTLISILVHTWIGMWQVLTDYVKHLALR---LFLQLAIVVALVVYVIY 107


>gi|34580877|ref|ZP_00142357.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia sibirica 246]
 gi|28262262|gb|EAA25766.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia sibirica 246]
          Length = 126

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 8/123 (6%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
                   +  L T+ IS+ H  LGM+V+IEDYI Y  L+       +  ++++ +FC+ 
Sbjct: 61  ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLR-------NTLIIIVQLFCIV 113

Query: 120 SLL 122
           +++
Sbjct: 114 TIV 116


>gi|15892092|ref|NP_359806.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia conorii str. Malish 7]
 gi|20137872|sp|Q92J98|DHSD_RICCN RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|15619215|gb|AAL02707.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia conorii str. Malish 7]
          Length = 126

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 8/123 (6%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
                   +  L T+ IS+ H  LGM+V+IEDYI Y  L+       +  ++++ +FC+ 
Sbjct: 61  ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLR-------NTLIIIVQLFCIV 113

Query: 120 SLL 122
           +++
Sbjct: 114 TIV 116


>gi|260597121|ref|YP_003209692.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Cronobacter turicensis z3032]
 gi|260216298|emb|CBA29265.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Cronobacter turicensis z3032]
          Length = 115

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 11/113 (9%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R T+I    +II+ I FF   GD  YE      S+   
Sbjct: 6   SALGR--------NGVHDFILVRATSIVMTLYIIYMIGFFAMNGDLTYEVWTGFFSSTFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
                L  +SI VH  +GM  ++ DY+ +  L+   LF+    V+ L+++ ++
Sbjct: 58  KVFTLLTLVSILVHTWIGMWQVLTDYVKHLALR---LFLQLAIVVALVVYVIY 107


>gi|255262499|ref|ZP_05341841.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thalassiobium sp. R2A62]
 gi|255104834|gb|EET47508.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thalassiobium sp. R2A62]
          Length = 123

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 2/96 (2%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GMGSAK GT H      ++ A +  +  FI  F       YE++++  S   V +++
Sbjct: 9   RAAGMGSAKQGTEHHWSMMVSSAALLILVPLFIFTFGAALGGTYEEVIAYYSR-PVPAVI 67

Query: 71  GLGTISIS-VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
            + T+ +  +H + G+QV+IEDY+H    KI  + M
Sbjct: 68  AVLTLWVGFMHFKSGVQVLIEDYVHGVARKIAIIAM 103


>gi|84500177|ref|ZP_00998443.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Oceanicola batsensis HTCC2597]
 gi|84392111|gb|EAQ04379.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Oceanicola batsensis HTCC2597]
          Length = 123

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%)

Query: 11 RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
          R  GMG++K GT H  + + ++IA +  +  F+  F     + YE++V+  S    A + 
Sbjct: 9  RAVGMGASKTGTAHHWQMQISSIALLILVPLFVLNFGAILGSSYEEVVAHYSRPYPAIVA 68

Query: 71 GLGTISISVHMQLGMQVIIEDYIH 94
           L  +    H + G Q+ IEDYIH
Sbjct: 69 ALTLLVGMTHFKNGAQMAIEDYIH 92


>gi|159045406|ref|YP_001534200.1| hypothetical protein Dshi_2866 [Dinoroseobacter shibae DFL 12]
 gi|157913166|gb|ABV94599.1| hypothetical protein Dshi_2866 [Dinoroseobacter shibae DFL 12]
          Length = 123

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT H    + +++  +  +  F+  F +   APYE++++ L+    A + 
Sbjct: 9   RAMGLGSAKSGTEHHWHMQVSSVGLLILVPLFLFTFGRVVGAPYEEVIAYLARPFPAIVT 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L  +    H + G+ V IEDY      K + + M +C     +   LF++ ++A+
Sbjct: 69  ALMLVVGFDHFRHGVTVAIEDYAQGTTRKALIIAM-TCVSYGAMATGLFAIARLAL 123


>gi|254464400|ref|ZP_05077811.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Rhodobacterales bacterium Y4I]
 gi|206685308|gb|EDZ45790.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Rhodobacterales bacterium Y4I]
          Length = 123

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 11 RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
          R  GMG+AK GT H    + +A+A +  +  F+  F       YE+I +  S     +++
Sbjct: 9  RAVGMGAAKSGTAHHWSMQVSAVALLILVPLFVFTFGSALGGSYEEITAYYSR-PFPALV 67

Query: 71 GLGTISISV-HMQLGMQVIIEDYIH 94
           + TI + + H + G Q++IEDY+H
Sbjct: 68 AVLTIWVGMMHFKSGAQIMIEDYVH 92


>gi|157828043|ref|YP_001494285.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932740|ref|YP_001649529.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           rickettsii str. Iowa]
 gi|157800524|gb|ABV75777.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907827|gb|ABY72123.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           rickettsii str. Iowa]
          Length = 125

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 9/123 (7%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           L       +  L T+ IS+ H  LGM+V+IEDYI    L+       +  ++++ +FC+ 
Sbjct: 61  LKK-PFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLR-------NTLIIIVQLFCIV 112

Query: 120 SLL 122
           +++
Sbjct: 113 TIV 115


>gi|189184863|ref|YP_001938648.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Ikeda]
 gi|189181634|dbj|BAG41414.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Ikeda]
          Length = 129

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 68/125 (54%), Gaps = 4/125 (3%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK--YGDAPYEQIVSVL 61
           ++++SL  ++ + + K    H+  QR +AI  +P +++ + FF K     +P E +  V 
Sbjct: 5   NLQNSLNTIKSLSTDKYCVQHWWYQRLSAILMLPLLVWLV-FFGKAIVQKSPVELVELVK 63

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
               V  I+ L  I++  H  +G++VIIEDY++   ++ + + +  CF  + ++  + S+
Sbjct: 64  YPYNVLMIILL-LITMFFHAAIGLKVIIEDYVNNLSVRYLLIVLVQCFTFVTVVAGIISI 122

Query: 122 LKIAI 126
           + + I
Sbjct: 123 ILLCI 127


>gi|148284920|ref|YP_001249010.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Boryong]
 gi|146740359|emb|CAM80792.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Boryong]
          Length = 129

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 68/125 (54%), Gaps = 4/125 (3%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK--YGDAPYEQIVSVL 61
           ++++SL  ++ + + K    H+  QR +AI  +P +++ + FF K     +P E +  V 
Sbjct: 5   NLQNSLNTIKSLSTDKYCVQHWRYQRLSAILMLPLLVWLV-FFGKAIVQKSPVELVELVK 63

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
               V  I+ L  I++  H  +G++VIIEDY++   ++ + + +  CF  + ++  + S+
Sbjct: 64  YPYNVLMIILL-LITMFFHAAIGLKVIIEDYVNNLAVRYLLIVLVQCFTFVTVVAGIISI 122

Query: 122 LKIAI 126
           + + I
Sbjct: 123 ILLCI 127


>gi|238650697|ref|YP_002916550.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           peacockii str. Rustic]
 gi|238624795|gb|ACR47501.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           peacockii str. Rustic]
          Length = 125

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 9/123 (7%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           L       +  L T+ IS+ H  LGM+V+IEDYI    L+       +  ++++ +FC+ 
Sbjct: 61  LKK-PFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLR-------NTLIIIVQLFCIV 112

Query: 120 SLL 122
           +++
Sbjct: 113 TIV 115


>gi|157803314|ref|YP_001491863.1| hypothetical protein A1E_00650 [Rickettsia canadensis str. McKiel]
 gi|157784577|gb|ABV73078.1| hypothetical protein A1E_00650 [Rickettsia canadensis str. McKiel]
          Length = 125

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D +  + + +  GSAK G+ H++ QR TAI      I+ I F +    +    I+  
Sbjct: 1   MVYDFKVEIVKAKASGSAKSGSHHWLLQRVTAIILALCSIWLIYFTLTNKSSDLSIIMWE 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           L       +  L T+ IS+ H  +G+Q++IEDYI            N     L+I+  LF
Sbjct: 61  LKK-PFNVVALLITVIISLYHAMIGVQIVIEDYIR----------CNKLLNTLIIVVKLF 109

Query: 120 SLLKIA 125
            L+ IA
Sbjct: 110 CLVTIA 115


>gi|157964194|ref|YP_001499018.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia massiliae MTU5]
 gi|157843970|gb|ABV84471.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia massiliae MTU5]
          Length = 125

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 65/124 (52%), Gaps = 11/124 (8%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++++ + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAAIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIH-YRLLKIMFLFMNSCFVLLLIIFCL 118
           L       +  L T+ IS+ H  LGM+V+IEDYI  Y+L         +  ++++ +FC+
Sbjct: 61  LKK-PFNVVALLITVVISLYHAMLGMRVVIEDYISCYKL--------RNTLIIIVQLFCI 111

Query: 119 FSLL 122
            +++
Sbjct: 112 VTIV 115


>gi|163738940|ref|ZP_02146353.1| malate dehydrogenase [Phaeobacter gallaeciensis BS107]
 gi|163741816|ref|ZP_02149206.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Phaeobacter gallaeciensis 2.10]
 gi|161384989|gb|EDQ09368.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Phaeobacter gallaeciensis 2.10]
 gi|161387745|gb|EDQ12101.1| malate dehydrogenase [Phaeobacter gallaeciensis BS107]
          Length = 123

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 11 RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
          R  GMG+AK GT H    + ++I  +  +  F+  F       YE+I +  +     +++
Sbjct: 9  RAVGMGAAKSGTAHHWSMQVSSIGLLILVPLFVFTFGSALGGSYEEITAYYAR-PFPALV 67

Query: 71 GLGTISIS-VHMQLGMQVIIEDYIH 94
           L TI +  +H + G Q++IEDY+H
Sbjct: 68 ALLTIWVGMMHFKSGAQIMIEDYVH 92


>gi|89053301|ref|YP_508752.1| succinate dehydrogenase subunit D [Jannaschia sp. CCS1]
 gi|88862850|gb|ABD53727.1| succinate dehydrogenase subunit D [Jannaschia sp. CCS1]
          Length = 123

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           RV G+GSAK GT        T++A +    FF+A       + +  +++ L     A I+
Sbjct: 9   RVSGLGSAKGGTAQHWTMTVTSVALLILTPFFLAIIGSALGSDHADVIATLGKPVPALIV 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
               +    H++ GMQ ++EDY H  L K + + + +     L    L +L++IA+
Sbjct: 69  AAYLVVGMHHLRYGMQTLLEDYTH-GLTKKVSIIVTTILSYGLAAGGLVALMQIAL 123


>gi|315126698|ref|YP_004068701.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with sdhC [Pseudoalteromonas sp. SM9913]
 gi|315015212|gb|ADT68550.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with sdhC [Pseudoalteromonas sp. SM9913]
          Length = 115

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          +DG   F+  R TA+    + IF I +F+   +  YE    + SN+A+     +  + I 
Sbjct: 10 RDGVQDFVSLRTTALIISAYAIFIIGYFLAMPEVTYEAWTGLFSNLAMKGATLITLVCIM 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          VH ++G+  ++ DY+    L+
Sbjct: 70 VHTRIGLWQVLTDYVKNAKLR 90


>gi|90021754|ref|YP_527581.1| succinate dehydrogenase subunit D [Saccharophagus degradans 2-40]
 gi|89951354|gb|ABD81369.1| succinate dehydrogenase subunit D [Saccharophagus degradans 2-40]
          Length = 122

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QRF+A+    + IF +A+ + +    YE+   +   + V     L  ISI+
Sbjct: 10  RSGLSDWVAQRFSAVVLAAYTIFIVAYLVMHPGLTYEEWSGLFQQLWVRIFTLLVLISIA 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSC 108
            H  +G+  ++ DYI  R++    LF+ + 
Sbjct: 70  AHGWIGLWGVLTDYITTRMIGSSALFLRTV 99


>gi|332535003|ref|ZP_08410819.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035570|gb|EGI72063.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Pseudoalteromonas haloplanktis ANT/505]
          Length = 115

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          +DG   F+  R TA+    + IF I +F+   +  +E    + SN+A+     +  I I 
Sbjct: 10 RDGVQDFVSLRTTALIISAYAIFIIGYFLATPEVTFEAWTGLFSNLAMKGFTLITLICIM 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          VH ++G+  ++ DY+    L+
Sbjct: 70 VHTRIGLWQVLTDYVKCSKLR 90


>gi|77360591|ref|YP_340166.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with sdhC [Pseudoalteromonas haloplanktis TAC125]
 gi|76875502|emb|CAI86723.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
          b556 with sdhC [Pseudoalteromonas haloplanktis TAC125]
          Length = 115

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 41/81 (50%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          +DG   F+  R TA+    + IF I +F+   +  +E    + SN+A+     +  + I 
Sbjct: 10 RDGVQDFVSLRTTALIISAYAIFIIGYFLATPEVTFEAWTGLFSNLAMKGFTLIALVCIM 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          VH ++G+  ++ DY+    L+
Sbjct: 70 VHTRIGLWQVLTDYVKCAKLR 90


>gi|94499005|ref|ZP_01305543.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanobacter sp. RED65]
 gi|94428637|gb|EAT13609.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanobacter sp. RED65]
          Length = 115

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F + F +   D  Y Q     S+ AV     L  IS 
Sbjct: 9   SRSGLSDWLIQRVSAVILALYTVFIVGFLLANPDLDYAQWKEFFSSNAVRIFSLLALIST 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
             H  +GM  +  DY  ++ + I F+F  +CF+ L +
Sbjct: 69  VAHAWIGMWTVATDY--FKPVSIRFVFQVACFLALFV 103


>gi|148652074|ref|YP_001279167.1| succinate dehydrogenase, hydrophobic membrane anchor [Psychrobacter
           sp. PRwf-1]
 gi|148571158|gb|ABQ93217.1| succinate dehydrogenase subunit D [Psychrobacter sp. PRwf-1]
          Length = 127

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/117 (19%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+  G     G    G+  ++ QR +A+    + +  + FF+  GD  Y+Q VS + ++ 
Sbjct: 3   RNDSGIKSATGLTGSGSRDWVMQRISAVVLAIYAVVMVGFFLINGDVSYQQWVSFIMSLP 62

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +  +  +  I+++ H  +GM  +  DY+    L+   L + +  ++ ++++  + ++
Sbjct: 63  MRLLSLVAIIALAAHAWVGMWTVFTDYVKSTGLR---LVLQAAMIIAILVYLFWGVM 116


>gi|57238922|ref|YP_180058.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58578854|ref|YP_197066.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Welgevonden]
 gi|57161001|emb|CAH57907.1| putative succinate dehydrogenase cytochrome b small subunit
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58417480|emb|CAI26684.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 116

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 64/117 (54%), Gaps = 8/117 (6%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV-LSNVAVASIMGLG 73
           MGS+     H++ QR TA   +PF ++F   F+++     + +  + LS V + +I  + 
Sbjct: 1   MGSS---VYHWLSQRLTAFIMLPFSVWFFYKFLRFLSIVCKSVSELDLSFVELNTIDVIA 57

Query: 74  TISISV----HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           ++   +    H  LG+QVI+EDY+   +L++  L +    V + ++F +F++  I++
Sbjct: 58  SVCFFIIAFYHAILGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLIFAIFNISL 114


>gi|157825306|ref|YP_001493026.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Rickettsia akari str. Hartford]
 gi|157799264|gb|ABV74518.1| Succinate dehydrogenase hydrophobic membrane anchor protein
          [Rickettsia akari str. Hartford]
          Length = 125

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 1  MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
          M +D +  + + +  GSAK G+  ++ QR T I      I+ I F +   +     I+  
Sbjct: 1  MVYDFKVEIVKAKNSGSAKSGSHRWLSQRITGIILALCSIWLIYFMLTNKNNDINIIMWE 60

Query: 61 LSNVAVASIMGLGTISISV-HMQLGMQVIIEDYI 93
          L       +  L T++IS+ H  LGM+V+IEDYI
Sbjct: 61 LKK-PFNVVALLITVAISLYHSMLGMRVVIEDYI 93


>gi|296445360|ref|ZP_06887318.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylosinus trichosporium OB3b]
 gi|296257121|gb|EFH04190.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylosinus trichosporium OB3b]
          Length = 126

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 2/117 (1%)

Query: 10  GRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASI 69
           G+     S + G+ H +  R +A A  P  +  + F        YE   + L    + +I
Sbjct: 8   GKGAAFTSDRSGSLHALAMRHSARALAPLGLLSVWFIANLSGQSYEAARAHLGR-PLPAI 66

Query: 70  MGLGTISI-SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
             +  I I S H +LGM+ I+EDY+H   LK   L +N    + +      S++ IA
Sbjct: 67  TLIAFICIASYHARLGMETIVEDYVHDEALKARALQINKWLTVAIAASWTLSIMIIA 123


>gi|58616912|ref|YP_196111.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Gardel]
 gi|58416524|emb|CAI27637.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Gardel]
          Length = 116

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 63/117 (53%), Gaps = 8/117 (6%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV-LSNVAVASIMGLG 73
           MGS+     H++ QR TA   +PF ++F   F+++       +  + LS V + +I  + 
Sbjct: 1   MGSS---VYHWLSQRVTAFIVLPFSVWFFYKFLRFLSIVCRSVSELDLSFVELNTIDVIA 57

Query: 74  TISISV----HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           ++   +    H  LG+QVI+EDY+   +L++  L +    V + ++F +F++  I++
Sbjct: 58  SVCFFIIAFYHAVLGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLVFAIFNISL 114


>gi|323976307|gb|EGB71397.1| succinate dehydrogenase [Escherichia coli TW10509]
          Length = 115

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATTGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92


>gi|331672238|ref|ZP_08373029.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA280]
 gi|331070433|gb|EGI41797.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA280]
          Length = 115

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92


>gi|331656739|ref|ZP_08357701.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA206]
 gi|331054987|gb|EGI26996.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA206]
          Length = 111

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92


>gi|218694146|ref|YP_002401813.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli 55989]
 gi|218350878|emb|CAU96576.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli 55989]
          Length = 115

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVVFFATSGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92


>gi|16128697|ref|NP_415250.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. MG1655]
 gi|24112002|ref|NP_706512.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella flexneri 2a str. 301]
 gi|26246690|ref|NP_752730.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli CFT073]
 gi|30062115|ref|NP_836286.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella flexneri 2a str. 2457T]
 gi|74311246|ref|YP_309665.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sonnei Ss046]
 gi|82543149|ref|YP_407096.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella boydii Sb227]
 gi|82775990|ref|YP_402337.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella dysenteriae Sd197]
 gi|89107580|ref|AP_001360.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. W3110]
 gi|91209756|ref|YP_539742.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli UTI89]
 gi|110640931|ref|YP_668659.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli 536]
 gi|110804650|ref|YP_688170.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella flexneri 5 str. 8401]
 gi|117622916|ref|YP_851829.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli APEC O1]
 gi|157156814|ref|YP_001461882.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli E24377A]
 gi|157160202|ref|YP_001457520.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli HS]
 gi|170020933|ref|YP_001725887.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli ATCC 8739]
 gi|170080389|ref|YP_001729709.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170684264|ref|YP_001742823.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli SMS-3-5]
 gi|188494894|ref|ZP_03002164.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 53638]
 gi|191167187|ref|ZP_03029006.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B7A]
 gi|191174074|ref|ZP_03035590.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli F11]
 gi|193065515|ref|ZP_03046583.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E22]
 gi|193070649|ref|ZP_03051586.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E110019]
 gi|194429057|ref|ZP_03061588.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B171]
 gi|194433999|ref|ZP_03066270.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1012]
 gi|194439238|ref|ZP_03071318.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 101-1]
 gi|209917973|ref|YP_002292057.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli SE11]
 gi|215485741|ref|YP_002328172.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218549713|ref|YP_002383504.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia fergusonii ATCC 35469]
 gi|218553249|ref|YP_002386162.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli IAI1]
 gi|218557638|ref|YP_002390551.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli S88]
 gi|218688516|ref|YP_002396728.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli ED1a]
 gi|218699077|ref|YP_002406706.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli IAI39]
 gi|218704039|ref|YP_002411558.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli UMN026]
 gi|227884311|ref|ZP_04002116.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli 83972]
 gi|237707316|ref|ZP_04537797.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia sp. 3_2_53FAA]
 gi|238899987|ref|YP_002925783.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli BW2952]
 gi|253774307|ref|YP_003037138.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254160792|ref|YP_003043900.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli B str. REL606]
 gi|256021204|ref|ZP_05435069.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sp. D9]
 gi|256023676|ref|ZP_05437541.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia sp. 4_1_40B]
 gi|260842929|ref|YP_003220707.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O103:H2 str. 12009]
 gi|260853957|ref|YP_003227848.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O26:H11 str. 11368]
 gi|260866853|ref|YP_003233255.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O111:H- str. 11128]
 gi|293403966|ref|ZP_06647960.1| sdhD [Escherichia coli FVEC1412]
 gi|293409096|ref|ZP_06652672.1| succinate dehydrogenase [Escherichia coli B354]
 gi|293413999|ref|ZP_06656648.1| succinate dehydrogenase [Escherichia coli B185]
 gi|293432991|ref|ZP_06661419.1| succinate dehydrogenase [Escherichia coli B088]
 gi|297521385|ref|ZP_06939771.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli OP50]
 gi|298379742|ref|ZP_06989347.1| sdhD [Escherichia coli FVEC1302]
 gi|300816370|ref|ZP_07096592.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 107-1]
 gi|300822990|ref|ZP_07103125.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 119-7]
 gi|300900717|ref|ZP_07118866.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 198-1]
 gi|300906979|ref|ZP_07124648.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 84-1]
 gi|300918381|ref|ZP_07134981.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 115-1]
 gi|300926125|ref|ZP_07141938.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 182-1]
 gi|300929474|ref|ZP_07144942.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 187-1]
 gi|300937821|ref|ZP_07152617.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 21-1]
 gi|300947199|ref|ZP_07161409.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 116-1]
 gi|300957668|ref|ZP_07169858.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 175-1]
 gi|300989868|ref|ZP_07178997.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 45-1]
 gi|300996467|ref|ZP_07181441.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 200-1]
 gi|301020817|ref|ZP_07184881.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 69-1]
 gi|301027098|ref|ZP_07190470.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 196-1]
 gi|301046046|ref|ZP_07193226.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 185-1]
 gi|301305208|ref|ZP_07211306.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 124-1]
 gi|301327914|ref|ZP_07221085.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 78-1]
 gi|301648025|ref|ZP_07247792.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 146-1]
 gi|306812869|ref|ZP_07447062.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli NC101]
 gi|307137333|ref|ZP_07496689.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli H736]
 gi|307314813|ref|ZP_07594407.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli W]
 gi|309786386|ref|ZP_07681012.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1617]
 gi|309797435|ref|ZP_07691827.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 145-7]
 gi|312965152|ref|ZP_07779389.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 2362-75]
 gi|312970799|ref|ZP_07784978.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1827-70]
 gi|331641223|ref|ZP_08342358.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H736]
 gi|331645871|ref|ZP_08346974.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M605]
 gi|331651720|ref|ZP_08352739.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M718]
 gi|331662075|ref|ZP_08362998.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA143]
 gi|331667088|ref|ZP_08367953.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA271]
 gi|331676404|ref|ZP_08377101.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H591]
 gi|331682153|ref|ZP_08382775.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H299]
 gi|332282430|ref|ZP_08394843.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sp. D9]
 gi|81175274|sp|P0AC45|DHSD_ECOL6 RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|81175275|sp|P0AC44|DHSD_ECOLI RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|81175276|sp|P0AC46|DHSD_SHIFL RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|28948821|pdb|1NEK|D Chain D, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Ubiquinone Bound
 gi|28948825|pdb|1NEN|D Chain D, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Dinitrophenol-17 Inhibitor Co-Crystallized At The
           Ubiquinone Binding Site
 gi|85544087|pdb|2ACZ|D Chain D, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Atpenin A5 Inhibitor Co-Crystallized At The Ubiquinone
           Binding Site
 gi|256599503|pdb|2WDQ|D Chain D, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599507|pdb|2WDQ|H Chain H, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599511|pdb|2WDQ|L Chain L, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599515|pdb|2WDV|D Chain D, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|256599519|pdb|2WDV|H Chain H, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|256599523|pdb|2WDV|L Chain L, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|259045636|pdb|2WDR|D Chain D, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|259045640|pdb|2WDR|H Chain H, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|259045644|pdb|2WDR|L Chain L, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|304445591|pdb|2WP9|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445595|pdb|2WP9|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445599|pdb|2WP9|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445631|pdb|2WU2|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|304445635|pdb|2WU2|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|304445639|pdb|2WU2|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|26107089|gb|AAN79273.1|AE016757_177 Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli CFT073]
 gi|42924|emb|CAA25486.1| unnamed protein product [Escherichia coli]
 gi|146198|gb|AAA23894.1| succinate dehydrogenase [Escherichia coli K-12]
 gi|1651318|dbj|BAA35389.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K12 substr. W3110]
 gi|1786941|gb|AAC73816.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. MG1655]
 gi|24050818|gb|AAN42219.1| succinate dehydrogenase, hydrophobic subunit [Shigella flexneri 2a
           str. 301]
 gi|30040360|gb|AAP16092.1| succinate dehydrogenase, hydrophobic subunit [Shigella flexneri 2a
           str. 2457T]
 gi|73854723|gb|AAZ87430.1| succinate dehydrogenase, hydrophobic subunit [Shigella sonnei
           Ss046]
 gi|81240138|gb|ABB60848.1| succinate dehydrogenase, hydrophobic subunit [Shigella dysenteriae
           Sd197]
 gi|81244560|gb|ABB65268.1| succinate dehydrogenase, hydrophobic subunit [Shigella boydii
           Sb227]
 gi|91071330|gb|ABE06211.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli
           UTI89]
 gi|110342523|gb|ABG68760.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 536]
 gi|110614198|gb|ABF02865.1| succinate dehydrogenase, hydrophobic subunit [Shigella flexneri 5
           str. 8401]
 gi|115512040|gb|ABJ00115.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli APEC O1]
 gi|157065882|gb|ABV05137.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli HS]
 gi|157078844|gb|ABV18552.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E24377A]
 gi|169755861|gb|ACA78560.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli ATCC 8739]
 gi|169888224|gb|ACB01931.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170521982|gb|ACB20160.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli SMS-3-5]
 gi|188490093|gb|EDU65196.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 53638]
 gi|190902735|gb|EDV62465.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B7A]
 gi|190905682|gb|EDV65305.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli F11]
 gi|192926804|gb|EDV81430.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E22]
 gi|192956037|gb|EDV86503.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E110019]
 gi|194412888|gb|EDX29179.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B171]
 gi|194417764|gb|EDX33862.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1012]
 gi|194421823|gb|EDX37830.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 101-1]
 gi|209911232|dbj|BAG76306.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli SE11]
 gi|215263813|emb|CAS08150.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218357254|emb|CAQ89889.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia fergusonii ATCC 35469]
 gi|218360017|emb|CAQ97564.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli IAI1]
 gi|218364407|emb|CAR02087.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli S88]
 gi|218369063|emb|CAR16817.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli IAI39]
 gi|218426080|emb|CAR06898.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli ED1a]
 gi|218431136|emb|CAR12012.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli UMN026]
 gi|222032459|emb|CAP75198.1| Succinate dehydrogenase hydrophobic membrane anchor [Escherichia
           coli LF82]
 gi|226898526|gb|EEH84785.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia sp. 3_2_53FAA]
 gi|227838397|gb|EEJ48863.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli 83972]
 gi|238863589|gb|ACR65587.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli BW2952]
 gi|242376484|emb|CAQ31188.1| succinate dehydrogenase membrane protein, subunit of succinate
           dehydrogenase [Escherichia coli BL21(DE3)]
 gi|253325351|gb|ACT29953.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972693|gb|ACT38364.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli B str. REL606]
 gi|253976887|gb|ACT42557.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli BL21(DE3)]
 gi|257752606|dbj|BAI24108.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O26:H11 str. 11368]
 gi|257758076|dbj|BAI29573.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O103:H2 str. 12009]
 gi|257763209|dbj|BAI34704.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O111:H- str. 11128]
 gi|260450124|gb|ACX40546.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli DH1]
 gi|281177865|dbj|BAI54195.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli SE15]
 gi|281599963|gb|ADA72947.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Shigella flexneri 2002017]
 gi|284920500|emb|CBG33562.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 042]
 gi|291323810|gb|EFE63232.1| succinate dehydrogenase [Escherichia coli B088]
 gi|291428552|gb|EFF01577.1| sdhD [Escherichia coli FVEC1412]
 gi|291434057|gb|EFF07030.1| succinate dehydrogenase [Escherichia coli B185]
 gi|291469564|gb|EFF12048.1| succinate dehydrogenase [Escherichia coli B354]
 gi|294490933|gb|ADE89689.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli IHE3034]
 gi|298279440|gb|EFI20948.1| sdhD [Escherichia coli FVEC1302]
 gi|299879432|gb|EFI87643.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 196-1]
 gi|300301963|gb|EFJ58348.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 185-1]
 gi|300304521|gb|EFJ59041.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 200-1]
 gi|300315613|gb|EFJ65397.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 175-1]
 gi|300355776|gb|EFJ71646.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 198-1]
 gi|300398463|gb|EFJ82001.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 69-1]
 gi|300401200|gb|EFJ84738.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 84-1]
 gi|300407271|gb|EFJ90809.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 45-1]
 gi|300414444|gb|EFJ97754.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 115-1]
 gi|300417824|gb|EFK01135.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 182-1]
 gi|300453185|gb|EFK16805.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 116-1]
 gi|300457186|gb|EFK20679.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 21-1]
 gi|300462583|gb|EFK26076.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 187-1]
 gi|300524531|gb|EFK45600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 119-7]
 gi|300531060|gb|EFK52122.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 107-1]
 gi|300839520|gb|EFK67280.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 124-1]
 gi|300845557|gb|EFK73317.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 78-1]
 gi|301073851|gb|EFK88657.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 146-1]
 gi|305853632|gb|EFM54071.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli NC101]
 gi|306905711|gb|EFN36239.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli W]
 gi|307552574|gb|ADN45349.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Escherichia coli ABU 83972]
 gi|307627863|gb|ADN72167.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli UM146]
 gi|308118959|gb|EFO56221.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 145-7]
 gi|308925780|gb|EFP71261.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1617]
 gi|309700944|emb|CBJ00241.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli ETEC H10407]
 gi|310336560|gb|EFQ01727.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1827-70]
 gi|312290243|gb|EFR18126.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 2362-75]
 gi|312945247|gb|ADR26074.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|313649637|gb|EFS14061.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 2a str. 2457T]
 gi|315059965|gb|ADT74292.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli W]
 gi|315135378|dbj|BAJ42537.1| sdhD [Escherichia coli DH1]
 gi|315257639|gb|EFU37607.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 85-1]
 gi|315287164|gb|EFU46576.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 110-3]
 gi|315292035|gb|EFU51387.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 153-1]
 gi|315299239|gb|EFU58493.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 16-3]
 gi|315614596|gb|EFU95238.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 3431]
 gi|320177265|gb|EFW52271.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Shigella dysenteriae CDC 74-1112]
 gi|320179438|gb|EFW54395.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Shigella boydii ATCC 9905]
 gi|320182927|gb|EFW57796.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Shigella flexneri CDC 796-83]
 gi|320194120|gb|EFW68752.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli WV_060327]
 gi|320198159|gb|EFW72763.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli EC4100B]
 gi|323153765|gb|EFZ40012.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli EPECa14]
 gi|323158772|gb|EFZ44785.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E128010]
 gi|323163880|gb|EFZ49690.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella sonnei 53G]
 gi|323170841|gb|EFZ56491.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli LT-68]
 gi|323180040|gb|EFZ65596.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1180]
 gi|323185119|gb|EFZ70485.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1357]
 gi|323191067|gb|EFZ76332.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli RN587/1]
 gi|323379475|gb|ADX51743.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli KO11]
 gi|323938300|gb|EGB34557.1| succinate dehydrogenase [Escherichia coli E1520]
 gi|323942944|gb|EGB39108.1| succinate dehydrogenase [Escherichia coli E482]
 gi|323947013|gb|EGB43027.1| succinate dehydrogenase [Escherichia coli H120]
 gi|323952719|gb|EGB48587.1| succinate dehydrogenase [Escherichia coli H252]
 gi|323958466|gb|EGB54172.1| succinate dehydrogenase [Escherichia coli H263]
 gi|323963103|gb|EGB58673.1| succinate dehydrogenase [Escherichia coli H489]
 gi|323967429|gb|EGB62849.1| succinate dehydrogenase [Escherichia coli M863]
 gi|323972007|gb|EGB67227.1| succinate dehydrogenase [Escherichia coli TA007]
 gi|324006246|gb|EGB75465.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 57-2]
 gi|324010443|gb|EGB79662.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 60-1]
 gi|324020371|gb|EGB89590.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 117-3]
 gi|324114832|gb|EGC08800.1| succinate dehydrogenase [Escherichia fergusonii B253]
 gi|324116263|gb|EGC10184.1| succinate dehydrogenase [Escherichia coli E1167]
 gi|325498103|gb|EGC95962.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia fergusonii ECD227]
 gi|327254401|gb|EGE66023.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli STEC_7v]
 gi|330910471|gb|EGH38981.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli AA86]
 gi|331038021|gb|EGI10241.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H736]
 gi|331044623|gb|EGI16750.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M605]
 gi|331049998|gb|EGI22056.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M718]
 gi|331060497|gb|EGI32461.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA143]
 gi|331065444|gb|EGI37337.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA271]
 gi|331075897|gb|EGI47194.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H591]
 gi|331080577|gb|EGI51753.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H299]
 gi|332093782|gb|EGI98836.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella boydii 5216-82]
 gi|332096512|gb|EGJ01508.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 155-74]
 gi|332097688|gb|EGJ02663.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella boydii 3594-74]
 gi|332104782|gb|EGJ08128.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sp. D9]
 gi|332342057|gb|AEE55391.1| succinate dehydrogenase, hydrophobic membrane anchor protein SdhD
           [Escherichia coli UMNK88]
 gi|332760913|gb|EGJ91201.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 4343-70]
 gi|332761362|gb|EGJ91648.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 2747-71]
 gi|332763960|gb|EGJ94198.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-671]
 gi|332768181|gb|EGJ98366.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 2930-71]
 gi|333007369|gb|EGK26849.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri VA-6]
 gi|333008010|gb|EGK27486.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-218]
 gi|333010163|gb|EGK29598.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-272]
 gi|333021433|gb|EGK40683.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-304]
          Length = 115

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92


>gi|15800426|ref|NP_286438.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 EDL933]
 gi|15830001|ref|NP_308774.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. Sakai]
 gi|168750653|ref|ZP_02775675.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|168757175|ref|ZP_02782182.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|168764003|ref|ZP_02789010.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|168767162|ref|ZP_02792169.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|168779205|ref|ZP_02804212.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|168786875|ref|ZP_02811882.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC869]
 gi|168801369|ref|ZP_02826376.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC508]
 gi|195939063|ref|ZP_03084445.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. EC4024]
 gi|208807233|ref|ZP_03249570.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208815555|ref|ZP_03256734.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208823090|ref|ZP_03263408.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209398560|ref|YP_002269345.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|217325246|ref|ZP_03441330.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254791868|ref|YP_003076705.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. TW14359]
 gi|261224423|ref|ZP_05938704.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254586|ref|ZP_05947119.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291281654|ref|YP_003498472.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Escherichia coli O55:H7 str. CB9615]
 gi|81170423|sp|Q8X9A9|DHSD_ECO57 RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|12513637|gb|AAG55046.1|AE005250_5 succinate dehydrogenase, hydrophobic subunit [Escherichia coli
           O157:H7 str. EDL933]
 gi|13360205|dbj|BAB34170.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli
           O157:H7 str. Sakai]
 gi|188015182|gb|EDU53304.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|189002984|gb|EDU71970.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|189355801|gb|EDU74220.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|189363457|gb|EDU81876.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|189365920|gb|EDU84336.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373110|gb|EDU91526.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC869]
 gi|189376492|gb|EDU94908.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC508]
 gi|208727034|gb|EDZ76635.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208732203|gb|EDZ80891.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208737283|gb|EDZ84967.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209159960|gb|ACI37393.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|209776528|gb|ACI86576.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776530|gb|ACI86577.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776532|gb|ACI86578.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776534|gb|ACI86579.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776536|gb|ACI86580.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|217321467|gb|EEC29891.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254591268|gb|ACT70629.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O157:H7 str. TW14359]
 gi|290761527|gb|ADD55488.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Escherichia coli O55:H7 str. CB9615]
 gi|320193116|gb|EFW67756.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC1212]
 gi|320637969|gb|EFX07738.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. G5101]
 gi|320643364|gb|EFX12544.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H- str. 493-89]
 gi|320648713|gb|EFX17346.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H- str. H 2687]
 gi|320654297|gb|EFX22350.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320659930|gb|EFX27472.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664754|gb|EFX31892.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. LSU-61]
 gi|326341540|gb|EGD65330.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. 1044]
 gi|326345758|gb|EGD69497.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. 1125]
          Length = 115

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92


>gi|119472930|ref|ZP_01614803.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
          b556 with sdhC [Alteromonadales bacterium TW-7]
 gi|119444648|gb|EAW25957.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
          b556 with sdhC [Alteromonadales bacterium TW-7]
          Length = 115

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 41/81 (50%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          +DG   ++  R TA+    + IF I +F+   +  +E    + SN+A+     +  + I 
Sbjct: 10 RDGVQDYVSLRTTALIISAYAIFIIGYFLATPEVTFEAWTGLFSNLAMKGFTLVTLVCIM 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          VH ++G+  ++ DY+    L+
Sbjct: 70 VHTRIGLWQVLTDYVKNSKLR 90


>gi|329847591|ref|ZP_08262619.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Asticcacaulis biprosthecum C19]
 gi|328842654|gb|EGF92223.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Asticcacaulis biprosthecum C19]
          Length = 127

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 8/81 (9%)

Query: 17 SAKDGTGHFIKQRFTAIANIPFIIF--FIAFFIKYG--DAPYEQIVSVLSNVAVASIMGL 72
          S K G G ++ +RFT+IA IP  ++  + AF I     D     +    + +A+A+ M  
Sbjct: 16 SEKHGAGEWLAERFTSIALIPLTLWAAYAAFTIAGTGYDGALAFVAKPFNILAIAATM-- 73

Query: 73 GTISISVHMQLGMQVIIEDYI 93
            +  + HM +G++VII+DYI
Sbjct: 74 --LITAWHMYMGVKVIIDDYI 92


>gi|254449958|ref|ZP_05063395.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Octadecabacter antarcticus 238]
 gi|198264364|gb|EDY88634.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Octadecabacter antarcticus 238]
          Length = 123

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 11 RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA---PYEQIVSVLSNVAVA 67
          R  GMGSAK GT H  +   +++A    I  F+     YG A    YE   +  +     
Sbjct: 9  RAVGMGSAKSGTEHHWQMIVSSVALTGLIPLFV---FTYGAALGMSYEDAAAYYAR-PFP 64

Query: 68 SIMGLGTISIS-VHMQLGMQVIIEDYIH 94
          SI+G+ T+ +  +H + G+Q +IEDY H
Sbjct: 65 SIVGILTLLVGFLHFKGGVQTLIEDYFH 92


>gi|170769071|ref|ZP_02903524.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia albertii TW07627]
 gi|170122143|gb|EDS91074.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia albertii TW07627]
          Length = 115

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ ++FF   G+  Y+  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVSFFATSGELTYDVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92


>gi|254475941|ref|ZP_05089327.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria sp. R11]
 gi|214030184|gb|EEB71019.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria sp. R11]
          Length = 123

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYG-DAPYEQIVSVLSNVAVASI 69
           R +G+GS + GT        T+   +P +  F+ F +  G    YE++++  S    A +
Sbjct: 9   RAQGLGSGRTGTKTHWNAIVTSTLLVPAVPVFV-FTVGAGLGGTYEEVLAYFSRPVPAIL 67

Query: 70  MGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
             L  I I +H    ++  IEDY+H  + + M     + F   LI   L +L+K+A+
Sbjct: 68  TALSMIVIVLHTLHEVREAIEDYMH-GVSERMATIAATAFAYSLIAAGLLALIKLAL 123


>gi|187733765|ref|YP_001879377.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella boydii CDC 3083-94]
 gi|187430757|gb|ACD10031.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella boydii CDC 3083-94]
          Length = 115

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ DY     L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYAKPLALRLM 92


>gi|262277892|ref|ZP_06055685.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [alpha proteobacterium HIMB114]
 gi|262224995|gb|EEY75454.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [alpha proteobacterium HIMB114]
          Length = 109

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%)

Query: 25 FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
          ++ QR  A+  +PF+++F+  F       Y   V  L+N     I+ L  +    HM++G
Sbjct: 8  WLLQRVAAVILLPFLVWFLFHFDNLMTFSYSDAVMFLNNKIYVGILSLVFLLAFFHMRIG 67

Query: 85 MQVIIEDYIHYRLLK 99
          M  I EDYIH   +K
Sbjct: 68 MGEIFEDYIHNEKVK 82


>gi|304445615|pdb|2WS3|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
 gi|304445619|pdb|2WS3|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
 gi|304445623|pdb|2WS3|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
          Length = 115

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +H  +GM  ++ D++    L++M
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDFVKPLALRLM 92


>gi|149913138|ref|ZP_01901672.1| malate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813544|gb|EDM73370.1| malate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 123

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 61/117 (52%), Gaps = 3/117 (2%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+G+A  GT H      +A+     +  F+ FF +     ++++++  S+ A+A I+
Sbjct: 9   RAEGLGAAHSGTEHHWYMTVSAVGLALIVPLFLFFFGRALGGTHDEVMATFSHPAMA-IL 67

Query: 71  GLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L  I + + H + G Q +IEDY      K++ + + +     LI   +F++LKIA+
Sbjct: 68  TLLVIFVGLQHFRKGAQTMIEDYARGMTRKVLIIAV-TVLSYGLIATGVFAVLKIAL 123


>gi|15604004|ref|NP_220519.1| succinate dehydrogenase hydrophobic membrane anchor protein (sdhD)
           [Rickettsia prowazekii str. Madrid E]
 gi|729337|sp|P41086|DHSD_RICPR RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|409935|gb|AAA18326.1| putative hydrophobic subunit of succinate dehydrogenase [Rickettsia
           prowazekii]
 gi|3860695|emb|CAA14596.1| SUCCINATE DEHYDROGENASE HYDROPHOBIC MEMBRANE ANCHOR PROTEIN (sdhD)
           [Rickettsia prowazekii]
 gi|292571720|gb|ADE29635.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia prowazekii Rp22]
          Length = 125

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 6/118 (5%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAI--ANIPFIIFFIAFFIKYGDAPYEQIV 58
           M +D ++ + + +    +K G+ H++ QR T +  A   F + +  F  K  D     I+
Sbjct: 1   MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDI---NII 57

Query: 59  SVLSNVAVASIMGLGTISISV-HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLII 115
                     ++ L T++IS+ H  LGM+V+IEDYI+   L+   + +   F +L I+
Sbjct: 58  MWEFKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIV 115


>gi|237730686|ref|ZP_04561167.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Citrobacter sp. 30_2]
 gi|226906225|gb|EEH92143.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Citrobacter sp. 30_2]
          Length = 115

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE      S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWTGFFSSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|161504117|ref|YP_001571229.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. arizonae serovar
          62:z4,z23:-- str. RSK2980]
 gi|160865464|gb|ABX22087.1| hypothetical protein SARI_02215 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
          Length = 115

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E   S  S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEVWTSFFSSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|149201369|ref|ZP_01878344.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Roseovarius sp. TM1035]
 gi|149145702|gb|EDM33728.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Roseovarius sp. TM1035]
          Length = 123

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G G+A  GT HF   + + +     I  F+  F +       ++++  S+ A+A + 
Sbjct: 9   RAEGKGAAGTGTEHFWYMKLSGVGLALIIPVFLVAFGRALGGDRAEVLAAFSHPAMAILT 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           GL       H   G Q +IEDY H    + + + + +     LI   LF+L KIA+
Sbjct: 69  GLVIFFGLRHYASGAQTMIEDYSHGSTRRGLIIAV-TVLSYGLIATGLFALAKIAL 123


>gi|88860186|ref|ZP_01134825.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Pseudoalteromonas tunicata D2]
 gi|88818180|gb|EAR27996.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Pseudoalteromonas tunicata D2]
          Length = 117

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 43/87 (49%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   F+  R TA+    + +F + +FI   +  +E    + +N+A+        + + 
Sbjct: 12  RDGVQDFVSLRATALVLAAYALFILGYFIATPEVTFEAWQGLFANLAMKVFTLAALVCMM 71

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           +H ++G+  ++ DYI    L+ +  F+
Sbjct: 72  IHTRIGLWQVLTDYIKCAKLRAILSFV 98


>gi|205351997|ref|YP_002225798.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Gallinarum
          str. 287/91]
 gi|205271778|emb|CAR36612.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Gallinarum
          str. 287/91]
 gi|326627037|gb|EGE33380.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Gallinarum
          str. 9]
          Length = 115

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E      S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFAASGELTFEAWTGFFSSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DYI
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYI 84


>gi|283784478|ref|YP_003364343.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Citrobacter rodentium ICC168]
 gi|282947932|emb|CBG87496.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Citrobacter rodentium ICC168]
          Length = 115

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E      S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGNLTWEAWTGFFSSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|270157996|ref|ZP_06186653.1| succinate dehydrogenase [Legionella longbeachae D-4968]
 gi|289163738|ref|YP_003453876.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella longbeachae NSW150]
 gi|269990021|gb|EEZ96275.1| succinate dehydrogenase [Legionella longbeachae D-4968]
 gi|288856911|emb|CBJ10725.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella longbeachae NSW150]
          Length = 115

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV--ASIMGLGTISI 77
           +G   ++ QR TA+    + IF I F + +    + Q  ++ SN+ V  ASI+ L   ++
Sbjct: 11  NGLKDWLIQRVTAVYFAVYTIFIIGFLLSHPGLSFAQWHALFSNIVVQIASIIAL--FAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLK-----IMFLFMNSCFVLLLII 115
           S+H  +G+  +  DY+   +L+     I+ L++ S FV  L+I
Sbjct: 69  SLHAWIGLWTVTTDYMKCTVLRVSVQMIVVLWLLSQFVWGLMI 111


>gi|213023775|ref|ZP_03338222.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          404ty]
          Length = 110

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E      S+   
Sbjct: 1  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFT 52

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 53 KVFTLLALFSILIHAWIGMWQVLTDYV 79


>gi|16759672|ref|NP_455289.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          CT18]
 gi|16764103|ref|NP_459718.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. LT2]
 gi|29142555|ref|NP_805897.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          Ty2]
 gi|56414150|ref|YP_151225.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Paratyphi
          A str. ATCC 9150]
 gi|161615041|ref|YP_001589006.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Paratyphi
          B str. SPB7]
 gi|167552849|ref|ZP_02346600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Saintpaul
          str. SARA29]
 gi|167993009|ref|ZP_02574104.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|168230611|ref|ZP_02655669.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Kentucky
          str. CDC 191]
 gi|168238876|ref|ZP_02663934.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|168240584|ref|ZP_02665516.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Heidelberg
          str. SL486]
 gi|168264336|ref|ZP_02686309.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Hadar str.
          RI_05P066]
 gi|168467711|ref|ZP_02701548.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Newport
          str. SL317]
 gi|168820139|ref|ZP_02832139.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|194443367|ref|YP_002039970.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Newport
          str. SL254]
 gi|194447545|ref|YP_002044763.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Heidelberg
          str. SL476]
 gi|194471846|ref|ZP_03077830.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Kentucky
          str. CVM29188]
 gi|194733964|ref|YP_002113839.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|197247879|ref|YP_002145691.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Agona str.
          SL483]
 gi|197265977|ref|ZP_03166051.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Saintpaul
          str. SARA23]
 gi|197363072|ref|YP_002142709.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Paratyphi
          A str. AKU_12601]
 gi|198246230|ref|YP_002214701.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Dublin
          str. CT_02021853]
 gi|200389482|ref|ZP_03216093.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204930109|ref|ZP_03221130.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Javiana
          str. GA_MM04042433]
 gi|207856177|ref|YP_002242828.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Enteritidis str. P125109]
 gi|213053348|ref|ZP_03346226.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          E00-7866]
 gi|213425382|ref|ZP_03358132.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          E02-1180]
 gi|213581388|ref|ZP_03363214.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          E98-0664]
 gi|213615565|ref|ZP_03371391.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          E98-2068]
 gi|213646452|ref|ZP_03376505.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          J185]
 gi|213851936|ref|ZP_03381468.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          M223]
 gi|224582548|ref|YP_002636346.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Paratyphi
          C strain RKS4594]
 gi|289824380|ref|ZP_06543973.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Typhi str.
          E98-3139]
 gi|25284587|pir||AI0590 succinate dehydrogenase hydrophobic membrane anchor protein
          [imported] - Salmonella enterica subsp. enterica
          serovar Typhi (strain CT18)
 gi|16419243|gb|AAL19677.1| succinate dehydrogenase, hydrophobic subunit [Salmonella enterica
          subsp. enterica serovar Typhimurium str. LT2]
 gi|16501965|emb|CAD05195.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138186|gb|AAO69757.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Typhi str.
          Ty2]
 gi|56128407|gb|AAV77913.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Paratyphi
          A str. ATCC 9150]
 gi|161364405|gb|ABX68173.1| hypothetical protein SPAB_02801 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|194402030|gb|ACF62252.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Newport
          str. SL254]
 gi|194405849|gb|ACF66068.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Heidelberg
          str. SL476]
 gi|194458210|gb|EDX47049.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Kentucky
          str. CVM29188]
 gi|194709466|gb|ACF88687.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|195629226|gb|EDX48594.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Newport
          str. SL317]
 gi|197094549|emb|CAR60069.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Paratyphi
          A str. AKU_12601]
 gi|197211582|gb|ACH48979.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Agona str.
          SL483]
 gi|197244232|gb|EDY26852.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Saintpaul
          str. SARA23]
 gi|197288373|gb|EDY27754.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|197940746|gb|ACH78079.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Dublin
          str. CT_02021853]
 gi|199601927|gb|EDZ00473.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204321103|gb|EDZ06304.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Javiana
          str. GA_MM04042433]
 gi|205322595|gb|EDZ10434.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Saintpaul
          str. SARA29]
 gi|205328887|gb|EDZ15651.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|205334665|gb|EDZ21429.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Kentucky
          str. CDC 191]
 gi|205340151|gb|EDZ26915.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Heidelberg
          str. SL486]
 gi|205343043|gb|EDZ29807.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|205347147|gb|EDZ33778.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar Hadar str.
          RI_05P066]
 gi|206707980|emb|CAR32269.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Enteritidis str. P125109]
 gi|224467075|gb|ACN44905.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Paratyphi
          C strain RKS4594]
 gi|261245996|emb|CBG23798.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. D23580]
 gi|267992471|gb|ACY87356.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. 14028S]
 gi|301157324|emb|CBW16813.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. SL1344]
 gi|312911759|dbj|BAJ35733.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. T000240]
 gi|320085001|emb|CBY94790.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Weltevreden str. 2007-60-3289-1]
 gi|321226308|gb|EFX51359.1| Succinate dehydrogenase hydrophobic membrane anchor protein
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. TN061786]
 gi|322615834|gb|EFY12752.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 315996572]
 gi|322621230|gb|EFY18087.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 495297-1]
 gi|322623650|gb|EFY20488.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 495297-3]
 gi|322628922|gb|EFY25702.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 495297-4]
 gi|322634902|gb|EFY31632.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 515920-1]
 gi|322636570|gb|EFY33274.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 515920-2]
 gi|322641779|gb|EFY38412.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 531954]
 gi|322647811|gb|EFY44291.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. NC_MB110209-0054]
 gi|322651859|gb|EFY48228.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. OH_2009072675]
 gi|322652644|gb|EFY48993.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. CASC_09SCPH15965]
 gi|322658452|gb|EFY54715.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 19N]
 gi|322664945|gb|EFY61136.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 81038-01]
 gi|322668385|gb|EFY64541.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. MD_MDA09249507]
 gi|322670527|gb|EFY66660.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 414877]
 gi|322675267|gb|EFY71343.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 366867]
 gi|322679693|gb|EFY75734.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 413180]
 gi|322684831|gb|EFY80830.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 446600]
 gi|322713776|gb|EFZ05347.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Choleraesuis str. A50]
 gi|323129043|gb|ADX16473.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. 4/74]
 gi|323193149|gb|EFZ78368.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 609458-1]
 gi|323200600|gb|EFZ85675.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 556150-1]
 gi|323202272|gb|EFZ87320.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 609460]
 gi|323205461|gb|EFZ90427.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 507440-20]
 gi|323213500|gb|EFZ98293.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 556152]
 gi|323215334|gb|EGA00079.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. MB101509-0077]
 gi|323220912|gb|EGA05346.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. MB102109-0047]
 gi|323228079|gb|EGA12215.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. MB110209-0055]
 gi|323231015|gb|EGA15131.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. MB111609-0052]
 gi|323234152|gb|EGA18241.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 2009083312]
 gi|323238153|gb|EGA22211.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 2009085258]
 gi|323243588|gb|EGA27606.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. 315731156]
 gi|323247388|gb|EGA31347.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. IA_2009159199]
 gi|323251376|gb|EGA35248.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. IA_2010008282]
 gi|323258485|gb|EGA42157.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. IA_2010008283]
 gi|323260639|gb|EGA44248.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. IA_2010008284]
 gi|323264711|gb|EGA48213.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. IA_2010008285]
 gi|323270975|gb|EGA54410.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Montevideo
          str. IA_2010008287]
 gi|326622457|gb|EGE28802.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Dublin
          str. 3246]
 gi|332987670|gb|AEF06653.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. UK-1]
          Length = 115

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E      S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|238911663|ref|ZP_04655500.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. enterica serovar Tennessee
          str. CDC07-0191]
          Length = 115

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E      S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|85711266|ref|ZP_01042325.1| Succinate dehydrogenase, hydrophobic anchor subunit [Idiomarina
           baltica OS145]
 gi|85694767|gb|EAQ32706.1| Succinate dehydrogenase, hydrophobic anchor subunit [Idiomarina
           baltica OS145]
          Length = 115

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 53/114 (46%), Gaps = 1/114 (0%)

Query: 12  VRGMGS-AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           VR  G+  + G   FI  R +A+  + +++F + FF    D  Y     + SN+ +    
Sbjct: 2   VREAGTFGRSGPHDFILLRASAVVMLLYVLFMVGFFASTADVTYANWTGLFSNLWMKVFT 61

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            L    + VH  +G+  ++ DY+    ++    F+ S  ++++ +  LF L  +
Sbjct: 62  LLALTGVLVHGWIGIWQVLTDYVKASGVRAFIQFVFSVGLIIVWLTGLFVLWGV 115


>gi|89068122|ref|ZP_01155539.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanicola granulosus HTCC2516]
 gi|89046361|gb|EAR52418.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanicola granulosus HTCC2516]
          Length = 123

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 59/117 (50%), Gaps = 3/117 (2%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G+GSAK GT    +   ++ A +  ++ FI  F       YE+ V V  +    +I+
Sbjct: 9   RASGLGSAKRGTEKHWQMSLSSAALVVLVVLFIFTFGGALGMGYEEAV-VYYHRPFPAIV 67

Query: 71  GLGTISIS-VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L TI++  +H + G+Q++I+DY    L +   +   +C     +   +F++ ++A+
Sbjct: 68  ALLTIAVGLLHFRGGVQILIDDYTR-GLTRKALIVGTACLSYAALAAGVFAIARLAL 123


>gi|126730328|ref|ZP_01746139.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sagittula stellata E-37]
 gi|126709061|gb|EBA08116.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sagittula stellata E-37]
          Length = 123

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 56/116 (48%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R +G+GS + GT    +   T++A +  +  F+  F       YE + +  +    A I 
Sbjct: 9   RAQGLGSGRTGTQFHKRMLVTSMALVVLVPLFVFSFGSGFGGSYEDVQAFFARPFPAIIT 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            L  +   +H     Q  IEDY+H    K++ + + + F  +LI   LF+L+++A+
Sbjct: 69  ALMLVVGVIHFNGEAQEAIEDYVHGTTGKLLAVAV-TAFSYVLIAAGLFALVRLAL 123


>gi|152969293|ref|YP_001334402.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206580925|ref|YP_002239653.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella pneumoniae 342]
 gi|238893760|ref|YP_002918494.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Klebsiella pneumoniae NTUH-K2044]
 gi|262041215|ref|ZP_06014427.1| succinate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936495|ref|YP_003440554.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella variicola At-22]
 gi|290510450|ref|ZP_06549820.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. 1_1_55]
 gi|329998779|ref|ZP_08303214.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. MS 92-3]
 gi|150954142|gb|ABR76172.1| hypothetical protein KPN_00729 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206569983|gb|ACI11759.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella pneumoniae 342]
 gi|238546076|dbj|BAH62427.1| succinate dehydrogenase hydrophobic subunit [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259041444|gb|EEW42503.1| succinate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891204|gb|ADC59522.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella variicola At-22]
 gi|289777166|gb|EFD85164.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. 1_1_55]
 gi|328538565|gb|EGF64670.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. MS 92-3]
          Length = 115

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 11/113 (9%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E      ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFASGFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
                L  +SI +H  +GM  ++ DY+    L+   L +    V+ L+ + L+
Sbjct: 58  KVFTLLALVSILIHAWIGMWQVLTDYVKPLALR---LVLQLAIVVALVAYVLY 107


>gi|304445643|pdb|2WU5|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
 gi|304445647|pdb|2WU5|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
 gi|304445651|pdb|2WU5|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
          Length = 115

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 8/95 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +II+ + FF   G+  YE  +   ++   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
                L   SI +   +GM  ++ DY+    L++M
Sbjct: 58  KVFTLLALFSILIMAWIGMWQVLTDYVKPLALRLM 92


>gi|283833992|ref|ZP_06353733.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Citrobacter youngae ATCC 29220]
 gi|291070126|gb|EFE08235.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Citrobacter youngae ATCC 29220]
          Length = 115

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G+  +E      S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEVWTGFFSSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|85706757|ref|ZP_01037849.1| putative succinate dehydrogenase, hydrophobic membrane
           anchorprotein [Roseovarius sp. 217]
 gi|85668815|gb|EAQ23684.1| putative succinate dehydrogenase, hydrophobic membrane
           anchorprotein [Roseovarius sp. 217]
          Length = 123

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 1/116 (0%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  G G+A  GT HF   + + +     I  F+  F +       ++++  ++  +A + 
Sbjct: 9   RAEGKGAAGTGTEHFWYMKLSGVGLALIIPVFLVAFGRALGGDRTEVMAAFAHPGMAILT 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           GL       H   G Q +IEDY H  + + + + + +     LI   LF+L KIA+
Sbjct: 69  GLVIFFGLRHYASGAQTMIEDYSHGSMRRGLIIAV-TVLSYGLIATGLFALAKIAL 123


>gi|254438569|ref|ZP_05052063.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Octadecabacter antarcticus 307]
 gi|198254015|gb|EDY78329.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Octadecabacter antarcticus 307]
          Length = 123

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 22/95 (23%)

Query: 11 RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFI-----AFFIKYGDA------PYEQIVS 59
          R  GMGSAK GT H  +   +++A    I  F+     A  + Y DA      P+  IV 
Sbjct: 9  RAVGMGSAKSGTEHHWQMIVSSVALTGLIPLFVFTYGAALGMSYADASAYYARPFPSIVG 68

Query: 60 VLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIH 94
          +L+      ++G       +H + G+Q +IEDY+ 
Sbjct: 69 ILTL-----LVGF------LHFKGGVQTLIEDYVQ 92


>gi|145588944|ref|YP_001155541.1| succinate dehydrogenase, cytochrome b subunit [Polynucleobacter
          necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047350|gb|ABP33977.1| succinate dehydrogenase subunit D [Polynucleobacter necessarius
          subsp. asymbioticus QLW-P1DMWA-1]
          Length = 121

 Score = 37.7 bits (86), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%)

Query: 8  SLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVA 67
           +G  R +  A  G   +I QR TAI  + F I  +  +   G A YE   S+ SN  + 
Sbjct: 5  QIGPKRLVVGAHYGLKEWIIQRVTAIVMVVFTIVLLVDYCITGSATYEGWSSLFSNQFMK 64

Query: 68 SIMGLGTISISVHMQLGMQVIIEDYI 93
           +  L  IS+  H  +G++ I  DYI
Sbjct: 65 LLTLLAFISLFYHAWIGIRDIWMDYI 90


>gi|332977197|gb|EGK13994.1| succinate dehydrogenase cytochrome b small subunit [Psychrobacter
           sp. 1501(2011)]
          Length = 128

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 61/121 (50%), Gaps = 3/121 (2%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           D  MR+  G     G    G+  ++ QR +A+    + +  ++FF+  G   YEQ V  +
Sbjct: 3   DVLMRNDSGIKSATGLTGSGSRDWVMQRISAVVLAVYAVVIVSFFLFNGHIGYEQWVMFI 62

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            ++ +  +  L  ++++VH  +GM  +  DY+    L+I+   + +  ++ ++++  + +
Sbjct: 63  MSMPMRLLSLLAIVALAVHAWVGMWTVFTDYVKSTGLRIV---LQAAMIIAILVYLFWGV 119

Query: 122 L 122
           +
Sbjct: 120 M 120


>gi|311280403|ref|YP_003942634.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Enterobacter cloacae SCF1]
 gi|308749598|gb|ADO49350.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Enterobacter cloacae SCF1]
          Length = 115

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ + FF   G   +E      S+   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATTGTVTWEVWTGFFSSSFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|91208852|ref|YP_539013.1| succinate dehydrogenase subunit 4 [Physcomitrella patens]
 gi|90991392|dbj|BAE93084.1| succinate dehydrogenase subunit 4 [Physcomitrella patens]
 gi|328775201|gb|AEB39996.1| succinate dehydrogenase subunit 4 [Funaria hygrometrica]
          Length = 86

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 25/107 (23%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGT 74
           M + ++  GH++ QR TA + IP I+                    +SNV   S + L  
Sbjct: 1   MKAHRETLGHWLLQRMTAASLIPTIL--------------------ISNV---STLILLN 37

Query: 75  ISISVHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFVLLLIIFCLF 119
           I +  H+ +G++ I+ DY+H+ + +  I+ LF   C +++  +F  F
Sbjct: 38  ILLFWHIHVGIEEILTDYVHHEITRNWILILFRVFCLIIIKYVFLFF 84


>gi|325275375|ref|ZP_08141321.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas sp. TJI-51]
 gi|324099492|gb|EGB97392.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas sp. TJI-51]
          Length = 122

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYVVAHPGIDYTQWHGLFSNNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIH-----YRLLKIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+           I FLF   C V +   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYF 112


>gi|229589334|ref|YP_002871453.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Pseudomonas fluorescens SBW25]
 gi|312959840|ref|ZP_07774356.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens WH6]
 gi|229361200|emb|CAY48064.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Pseudomonas fluorescens SBW25]
 gi|311286006|gb|EFQ64571.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens WH6]
          Length = 122

 Score = 37.0 bits (84), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + +      YEQ   + S+ A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYLVANPGIGYEQWHGLFSHNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLL-----KIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+    L      + FLF   C V +   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVAMFAYF 112


>gi|146307529|ref|YP_001187994.1| succinate dehydrogenase subunit D [Pseudomonas mendocina ymp]
 gi|145575730|gb|ABP85262.1| succinate dehydrogenase subunit D [Pseudomonas mendocina ymp]
          Length = 122

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F + + I      Y +   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYTLFLLGYVICNPGMGYAEWHGLFSNTAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLL-----KIMFLFMNSCFVLLLIIF 116
           SVH  +GM  I  DY+    L      + FLF   C + +  +F
Sbjct: 69  SVHAWVGMWTISTDYLTPMALGKWATGVRFLFQAVCGIAMFAMF 112


>gi|114764871|ref|ZP_01444053.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114542757|gb|EAU45780.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseovarius sp. HTCC2601]
          Length = 123

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 7/119 (5%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA---PYEQIVSVLSNVAVA 67
           R  G GSA  G  H     F  ++++        + I +G A    Y+  +  +S    A
Sbjct: 9   RAVGKGSAHAGAEH---HWFMIVSSVALAFMLPTWLIVFGRALGSGYDAALDTMSRPFPA 65

Query: 68  SIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            +  L  I   VH Q G + +IEDY      K++ +   + F  L+I   +F+L+KIA+
Sbjct: 66  ILTALVLIVGMVHFQKGARTMIEDYTGGTTRKLLIMAF-AGFAYLMIACGIFALVKIAL 123


>gi|94311421|ref|YP_584631.1| succinate dehydrogenase subunit D [Cupriavidus metallidurans
          CH34]
 gi|93355273|gb|ABF09362.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
          [Cupriavidus metallidurans CH34]
          Length = 121

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 44/88 (50%)

Query: 6  RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           +++G  R +  A  G   ++ QR TA+  + F +   A ++ +G+  YE    + +N  
Sbjct: 3  NNNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTVVLAAVYLAFGNPSYEGWSGLFANQW 62

Query: 66 VASIMGLGTISISVHMQLGMQVIIEDYI 93
          +  +  L  +S+  H  +G++ I  DY+
Sbjct: 63 MKILTFLTILSLLFHAWIGVRDIWMDYV 90


>gi|304310234|ref|YP_003809832.1| Succinate dehydrogenase, membrane anchor subunit [gamma
          proteobacterium HdN1]
 gi|301795967|emb|CBL44168.1| Succinate dehydrogenase, membrane anchor subunit [gamma
          proteobacterium HdN1]
          Length = 122

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 18 AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAP-YEQIVSVLSNVAVASIMGLGTIS 76
          A+ G   ++ QR +A+    + +F + +   +G  P Y    ++ S   +     L  IS
Sbjct: 9  ARSGLYDWMAQRVSAVVIAAYSLFLMGYLF-FGATPDYAAWHALFSQTWMRIFSLLALIS 67

Query: 77 ISVHMQLGMQVIIEDYIHYRLL 98
          I+VH  +GM  I  DY+  RLL
Sbjct: 68 IAVHAWVGMWTITTDYLTTRLL 89


>gi|71064680|ref|YP_263407.1| succinate dehydrogenase subunit D [Psychrobacter arcticus 273-4]
 gi|71037665|gb|AAZ17973.1| succinate dehydrogenase subunit D [Psychrobacter arcticus 273-4]
          Length = 134

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 39/74 (52%)

Query: 20 DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
           G+  +I QR +A+    + +  + FF+ +GD  Y +  + ++++ +     +  ++++ 
Sbjct: 16 SGSRDWIVQRISAVVLAVYSVVLLGFFLTHGDVTYTEWSNFMTSLPMRLFSLVAVLALAG 75

Query: 80 HMQLGMQVIIEDYI 93
          H  +GM  +  DYI
Sbjct: 76 HAWIGMWTVFTDYI 89


>gi|104782664|ref|YP_609162.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas entomophila L48]
 gi|95111651|emb|CAK16372.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas entomophila L48]
          Length = 122

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I +   +    Y Q   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYLAAHPGIDYAQWHGLFSNNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIH-----YRLLKIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+           I FLF   C V +   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYF 112


>gi|328789605|ref|XP_001121743.2| PREDICTED: protein Kr-h2 [Apis mellifera]
          Length = 267

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 13/131 (9%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTA---IANIPFIIFFIAFFIKYGDAPYEQIV 58
           D    +S+   +G G+ +    H I  +  A   +  +  IIF I + I+    PY    
Sbjct: 5   DTASSNSVHMEKGWGALRQ---HIIDNKIKAALWVTRLFTIIFTIGYIIQIFGNPYNIYY 61

Query: 59  SVLSNVAVASIMGLGTISISVHMQLGMQVI----IEDYIHYRLLKIMFLFMNSCFVLLLI 114
            +L N A  S + L       H+QL  Q +    +ED  HY L  ++FL+     ++L  
Sbjct: 62  KILMNNAATSALRLH--QRVPHVQLNRQFLERLFVEDSCHYLLYSLIFLYTAPVTLVLTP 119

Query: 115 IFCLFSLLKIA 125
           IF LF+L+  A
Sbjct: 120 IF-LFALMHFA 129


>gi|109898116|ref|YP_661371.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
          b556 with SdhC [Pseudoalteromonas atlantica T6c]
 gi|109700397|gb|ABG40317.1| succinate dehydrogenase subunit D [Pseudoalteromonas atlantica
          T6c]
          Length = 115

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 39/81 (48%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          +DG   ++  R TAI    F ++ + FF+      YE    + S++ +        +S+ 
Sbjct: 10 RDGVQDYVTVRATAIIMTAFTLYMLWFFLSTPTVTYEIWHELFSSLGMKVFTFAALVSVM 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          +H+++G   ++ DY+    L+
Sbjct: 70 LHIRIGFWQVLTDYVKSTALR 90


>gi|93004939|ref|YP_579376.1| succinate dehydrogenase hydrophobic membrane anchor subunit
          [Psychrobacter cryohalolentis K5]
 gi|92392617|gb|ABE73892.1| succinate dehydrogenase subunit D [Psychrobacter cryohalolentis
          K5]
          Length = 134

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 39/74 (52%)

Query: 20 DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
           G+  +I QR +A+    + +  + FF+ +GD  Y +  + ++++ +     +  ++++ 
Sbjct: 16 SGSRDWIVQRISAVVLAVYSVVLLGFFLTHGDVSYTEWSNFMTSLPMRLFSLVAVLALAG 75

Query: 80 HMQLGMQVIIEDYI 93
          H  +GM  +  DYI
Sbjct: 76 HAWIGMWTVFTDYI 89


>gi|289209040|ref|YP_003461106.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thioalkalivibrio sp. K90mix]
 gi|288944671|gb|ADC72370.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thioalkalivibrio sp. K90mix]
          Length = 112

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 47/88 (53%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G G ++ QR TA+    F+I  + +F+    + +   V+V+++ AVA    L  + + +
Sbjct: 5   SGQGAWLLQRITAVYVGLFVILVLGYFLIAPPSDHAAWVAVIAHPAVALGSALFVVLLLL 64

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNS 107
           H  +G++ ++ DY+    L++  L + +
Sbjct: 65  HAWIGLRDVVLDYVKPLALRLTVLTLGA 92


>gi|26990884|ref|NP_746309.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida KT2440]
 gi|148546900|ref|YP_001267002.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida F1]
 gi|167034758|ref|YP_001669989.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida GB-1]
 gi|170722679|ref|YP_001750367.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida W619]
 gi|24985897|gb|AAN69773.1|AE016613_8 succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida KT2440]
 gi|148510958|gb|ABQ77818.1| succinate dehydrogenase subunit D [Pseudomonas putida F1]
 gi|166861246|gb|ABY99653.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida GB-1]
 gi|169760682|gb|ACA73998.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida W619]
 gi|313497962|gb|ADR59328.1| SdhD [Pseudomonas putida BIRD-1]
          Length = 122

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F I + + +    Y Q   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIH-----YRLLKIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+           I FLF   C V +   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYF 112


>gi|146310881|ref|YP_001175955.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Enterobacter sp. 638]
 gi|145317757|gb|ABP59904.1| succinate dehydrogenase subunit D [Enterobacter sp. 638]
          Length = 115

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ I FF   G+  +E       +   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMIGFFATSGELTWEIWSGFFGSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|68171572|ref|ZP_00544947.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658456|ref|YP_507708.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Ehrlichia chaffeensis str. Arkansas]
 gi|67999013|gb|EAM85689.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599913|gb|ABD45382.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 118

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 13/114 (11%)

Query: 24  HFIKQRFTAIANIPFIIFF-------IAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           H++ QR TA   IP  ++F       I+  +K     + ++   +SN++   ++ L    
Sbjct: 8   HWLIQRVTAFVLIPLSLWFLFKVLGVISIILK----SFPELHLSISNISNTDLIILLCFF 63

Query: 77  ISV--HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILG 128
           IS   H  LG+QVI+EDYIH  +L+     +    V+L ++F  F +L   +LG
Sbjct: 64  ISAFYHAVLGVQVILEDYIHSVVLRASVFLVIKGIVILTVLFLTFIILYSVLLG 117


>gi|259415142|ref|ZP_05739064.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter sp. TrichCH4B]
 gi|259349052|gb|EEW60806.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter sp. TrichCH4B]
          Length = 123

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 33  IANIPFIIFFIAFFIKYG---DAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVII 89
           +++I  +    AF I +G      YE++++       A I GL  +   +H+    QV +
Sbjct: 28  VSSILLVFLVPAFVITFGLGLGGTYEEVLAYYGRPVPAIITGLTLVVGIIHLMREAQVAV 87

Query: 90  EDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           EDY+H  L + + L   + F   +I   LF+L+K+A+
Sbjct: 88  EDYMH-GLAEKLTLIAVAAFSYTMIAAGLFALVKLAL 123


>gi|89073517|ref|ZP_01160040.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium sp. SKA34]
 gi|89050781|gb|EAR56262.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium sp. SKA34]
          Length = 115

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 8/94 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           SS+GR        +G   FI  R TAI    + ++ + FF    +  +E   +  S ++ 
Sbjct: 6   SSVGR--------NGIHDFILIRATAIILTLYTVYMVGFFAFGPELTFETWSAFFSQIST 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKI 100
                L  +SI VH  +G+  ++ DYI   +L++
Sbjct: 58  KVFTMLALVSILVHAWIGLWQVLTDYIKPAVLRV 91


>gi|253687627|ref|YP_003016817.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754205|gb|ACT12281.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 115

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 13/114 (11%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   ++  R +AI  + ++I+ I F    GD  YE I     ++A+
Sbjct: 6   SALGR--------NGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYE-IWRGFFSMAL 56

Query: 67  ASIMGLGTI-SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             +  L T+ SI VH  +GM  ++ DYI    L+   L +    V+ L+++ ++
Sbjct: 57  TKVFTLLTLFSILVHAWIGMWQVLTDYIKPLALR---LTLQLAIVVALLVYVIY 107


>gi|326794792|ref|YP_004312612.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas mediterranea MMB-1]
 gi|326545556|gb|ADZ90776.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas mediterranea MMB-1]
          Length = 115

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 6/93 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA--VASIMGLGTI 75
            + G   ++ QR +AI    + +F I + +   D  YEQ   +       + S+M L  +
Sbjct: 9   GRSGLYDWMMQRISAIVLALYSVFIIGYLVLNPDLTYEQWSGLFETTWMRIFSLMTL--L 66

Query: 76  SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSC 108
           SI +H  +G+  +  DYI  +   + FLF   C
Sbjct: 67  SIGIHSWIGLWSVSTDYI--KATGVRFLFQAVC 97


>gi|226945048|ref|YP_002800121.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Azotobacter vinelandii DJ]
 gi|226719975|gb|ACO79146.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Azotobacter vinelandii DJ]
          Length = 122

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F + +     D  Y +   + S+  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVILAAYTLFLLGYLFFSSDLSYAEWHGLFSSTGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLK-----IMFLFMNSC 108
           SVH  +GM  I  DY+    L      + FLF  +C
Sbjct: 69  SVHAWVGMWTISTDYLTPMALGKLATVVRFLFQAAC 104


>gi|11466548|ref|NP_044797.1| succinate:ubiquinone oxidoreductase subunit 4 [Reclinomonas
           americana]
 gi|1706431|sp|P80482|DHSD_RECAM RecName: Full=Succinate dehydrogenase membrane anchor subunit;
           AltName: Full=Succinate dehydrogenase, subunit IV
 gi|2258378|gb|AAD11912.1| succinate:ubiquinone oxidoreductase subunit 4 [Reclinomonas
           americana]
          Length = 120

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 51/93 (54%), Gaps = 7/93 (7%)

Query: 18  AKDGTGHFIKQRFTAIANIP---FIIFFIAFFIKYGDAPYEQIVSVLSNV--AVASIMGL 72
            K G+ H+  QRF AI   P   +++F +A +I     P   ++  L+ +    +  + +
Sbjct: 11  TKSGSMHWWLQRFLAILLAPIILYLLFDVAIYIGQQSDP--TVMMFLNRIFNHNSIFIFI 68

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFM 105
            ++ +  H++ GM+VIIEDY+H    +I+ +F+
Sbjct: 69  TSVILIWHVRGGMEVIIEDYVHGEKTRIVSIFL 101


>gi|261341309|ref|ZP_05969167.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Enterobacter cancerogenus ATCC 35316]
 gi|288316613|gb|EFC55551.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Enterobacter cancerogenus ATCC 35316]
          Length = 115

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ I FF   G   +E       +   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWELWSGFFGSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|330813448|ref|YP_004357687.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486543|gb|AEA80948.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Candidatus Pelagibacter sp. IMCC9063]
          Length = 111

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%)

Query: 21 GTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
              +I QR TA+  +P +I+F++ FI      +  ++    N    S   +  + +  H
Sbjct: 5  AVTKWILQRVTAVILLPLLIWFLSVFIGLVQKDFTTVIIFFENNINFSFSVVFLVLVFSH 64

Query: 81 MQLGMQVIIEDYIH 94
          M++GM  I EDYI 
Sbjct: 65 MKIGMGEIFEDYIQ 78


>gi|50120297|ref|YP_049464.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium atrosepticum SCRI1043]
 gi|49610823|emb|CAG74268.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Pectobacterium atrosepticum SCRI1043]
          Length = 115

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 13/114 (11%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   ++  R +AI  + ++I+ I F    GD  YE I      +A+
Sbjct: 6   SALGR--------NGVHDWLLIRASAIVIVLYVIYLIGFIATAGDITYE-IWRGFFAMAL 56

Query: 67  ASIMGLGTI-SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             +  L T+ SI VH  +GM  ++ DYI    L+   L +    V+ L+++ ++
Sbjct: 57  TKVFTLLTLFSILVHAWIGMWQVLTDYIKPLALR---LTLQLAIVIALLVYVIY 107


>gi|73542010|ref|YP_296530.1| succinate dehydrogenase subunit D [Ralstonia eutropha JMP134]
 gi|72119423|gb|AAZ61686.1| succinate dehydrogenase subunit D [Ralstonia eutropha JMP134]
          Length = 121

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 6  RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPF-IIFFIAFFIKYGDAPYEQIVSVLSNV 64
           +++G  R +  A  G   ++ QR TA+  + F +I  IAF +  G A YE    + SN 
Sbjct: 3  NNNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTVILAIAFLLSNG-ASYEAWAGLFSNQ 61

Query: 65 AVASIMGLGTISISVHMQLGMQVIIEDYI 93
           +  I  L  +S+  H  +G++ I  DY+
Sbjct: 62 WMKIITFLTILSLLYHAWIGVRDIWMDYV 90


>gi|52840773|ref|YP_094572.1| succinate dehydrogenase hydrophobic membrane anchor protein
          subunit D [Legionella pneumophila subsp. pneumophila
          str. Philadelphia 1]
 gi|52627884|gb|AAU26625.1| succinate dehydrogenase hydrophobic membrane anchor protein
          subunit D [Legionella pneumophila subsp. pneumophila
          str. Philadelphia 1]
          Length = 115

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 40/80 (50%)

Query: 20 DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
          +G   ++ QR TA+    ++IF   F +   D  + Q   + +N A      +G +++++
Sbjct: 11 NGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLSFSQWHLLFTNKAFQIATTIGLMALTL 70

Query: 80 HMQLGMQVIIEDYIHYRLLK 99
          H  +G+  +  DY+   +++
Sbjct: 71 HAWIGIWTVTTDYMKCTVIR 90


>gi|99078502|ref|YP_611760.1| succinate dehydrogenase subunit D [Ruegeria sp. TM1040]
 gi|99035640|gb|ABF62498.1| succinate dehydrogenase subunit D [Ruegeria sp. TM1040]
          Length = 123

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 33  IANIPFIIFFIAFFIKYG---DAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVII 89
           +++I  ++   AF I +G      YE++++       A I GL  +   +H+    QV +
Sbjct: 28  VSSILLVVLVPAFVITFGLGLGGTYEEVLAYYGRPVPAIITGLTLVVGIIHLMREAQVAV 87

Query: 90  EDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           EDY+H  L + + L   +     +I   LF+L+K+A+
Sbjct: 88  EDYMH-GLAEKLTLIAVAALSYTMIAAGLFALVKLAL 123


>gi|294676289|ref|YP_003576904.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter capsulatus SB 1003]
 gi|294475109|gb|ADE84497.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter capsulatus SB 1003]
          Length = 133

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 8/120 (6%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIA---NIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVA 67
           R  G G++  GT HF     +++A    +P  IF     I    A   Q+ +  +    A
Sbjct: 9   RAVGKGASGSGTEHFWWMTMSSVALAFLVPAFIFVFGHAIGMDQA---QLQAYFARPFPA 65

Query: 68  SIMGLGTISISVHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFVLLLIIFCLFSLLKIA 125
            +  L TI    H   G QV++EDY    L K  ++F++  S  +  L+++ L  ++ +A
Sbjct: 66  ILTALVTIVGMRHFAKGAQVMLEDYTQGSLRKGLVIFVYSLSWLISALVLYALAKMMFLA 125


>gi|295096571|emb|CBK85661.1| succinate dehydrogenase subunit D [Enterobacter cloacae subsp.
          cloacae NCTC 9394]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ I FF   G   +E       +   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWEIWSGFFGSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|54308238|ref|YP_129258.1| putative succinate dehydrogenase, hydrophobic membrane anchor
          protein [Photobacterium profundum SS9]
 gi|46912666|emb|CAG19456.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
          protein [Photobacterium profundum SS9]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%)

Query: 18 AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++G   FI  R TAI    + I+ + FF    D  +E   +    ++      L  +SI
Sbjct: 9  GRNGIHDFILIRATAIILTLYTIYMVGFFAFGPDLSFETWTAFWGQLSTKVFTMLALVSI 68

Query: 78 SVHMQLGMQVIIEDYIHYRLLK 99
           VH  +G+  ++ DYI    L+
Sbjct: 69 LVHAWIGLWQVLTDYIKCAALR 90


>gi|313106595|ref|ZP_07792822.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 39016]
 gi|310879324|gb|EFQ37918.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 39016]
          Length = 124

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 11  SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 70

Query: 78  SVHMQLGMQVIIEDYIHYRLLK-----IMFLFMNSC 108
           SVH  +GM  I  DY+    L      + FLF   C
Sbjct: 71  SVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVC 106


>gi|54293524|ref|YP_125939.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella pneumophila str. Lens]
 gi|53753356|emb|CAH14806.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella pneumophila str. Lens]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
           +G   ++ QR TA+    ++IF   F +   D  + Q   + +N        +G I++++
Sbjct: 11  NGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKVFQIATTIGLIALTL 70

Query: 80  HMQLGMQVIIEDY-------IHYRLLKIMFLF 104
           H  +G+  +  DY       +  +LL +++LF
Sbjct: 71  HAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLF 102


>gi|296390044|ref|ZP_06879519.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas aeruginosa PAb1]
          Length = 122

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYVIFLLGYLITHPNISYADWHGLFSQGWMRIFSLLTLVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLK-----IMFLFMNSC 108
           SVH  +GM  I  DY+    L      + FLF   C
Sbjct: 69  SVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVC 104


>gi|113868592|ref|YP_727081.1| succinate dehydrogenase (hydrophobic anchor subunit) [Ralstonia
          eutropha H16]
 gi|33320237|gb|AAQ05855.1| SdhD protein [Cupriavidus necator]
 gi|113527368|emb|CAJ93713.1| succinate dehydrogenase (hydrophobic anchor subunit) [Ralstonia
          eutropha H16]
          Length = 121

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPF-IIFFIAFFIKYGDAPYEQIVSVLSNVA 65
          +++G  R +  A  G   ++ QR TA+  + F ++  IAF +  G A YE    + SN  
Sbjct: 4  NNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTVVLAIAFLLSNG-ASYEAWAGLFSNQW 62

Query: 66 VASIMGLGTISISVHMQLGMQVIIEDYIH 94
          +  I  L  +S+  H  +G++ I  DY+ 
Sbjct: 63 MKIITFLTILSLLYHAWIGVRDIWMDYVR 91


>gi|15596779|ref|NP_250273.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa PAO1]
 gi|116049527|ref|YP_791669.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892461|ref|YP_002441328.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa LESB58]
 gi|254234683|ref|ZP_04928006.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa C3719]
 gi|254239931|ref|ZP_04933253.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 2192]
 gi|9947545|gb|AAG04971.1|AE004586_9 succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa PAO1]
 gi|115584748|gb|ABJ10763.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166614|gb|EAZ52125.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa C3719]
 gi|126193309|gb|EAZ57372.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 2192]
 gi|218772687|emb|CAW28472.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa LESB58]
          Length = 122

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLK-----IMFLFMNSC 108
           SVH  +GM  I  DY+    L      + FLF   C
Sbjct: 69  SVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVC 104


>gi|330973470|gb|EGH73536.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 122

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPSRSYAQWHGLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLL-----KIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+    L      + FLF   C VL+   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYF 112


>gi|296103349|ref|YP_003613495.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|29418060|gb|AAO39686.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Enterobacter cloacae]
 gi|295057808|gb|ADF62546.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 8/87 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR        +G   FI  R TAI    +II+ I FF   G   +E       +   
Sbjct: 6  SALGR--------NGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWEIWSGFFGSAFT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYI 93
               L   SI +H  +GM  ++ DY+
Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYV 84


>gi|330445466|ref|ZP_08309118.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Photobacterium leiognathi subsp. mandapamensis
          svers.1.1.]
 gi|328489657|dbj|GAA03615.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Photobacterium leiognathi subsp. mandapamensis
          svers.1.1.]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          SS+GR        +G   FI  R TAI    + ++ + FF    +  +E   +  S ++ 
Sbjct: 6  SSVGR--------NGIHDFILIRATAIILTLYTVYMVGFFAFGPELTFETWSAFFSQIST 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLK 99
               L  +SI VH  +G+  ++ DYI   +L+
Sbjct: 58 KVFTMLALVSILVHAWIGLWQVLTDYIKPAVLR 90


>gi|194290223|ref|YP_002006130.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with sdhc [Cupriavidus taiwanensis LMG 19424]
 gi|193224058|emb|CAQ70067.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with SdhC [Cupriavidus taiwanensis LMG 19424]
          Length = 121

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 6  RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPF-IIFFIAFFIKYGDAPYEQIVSVLSNV 64
           +++G  R +  A  G   ++ QR TA+  + F +I  IAF +  G A YE    + +N 
Sbjct: 3  NNNIGPKRLVVGAHYGLKDWLAQRVTAVVMVVFTVILAIAFLLSNG-ASYEAWAGLFANQ 61

Query: 65 AVASIMGLGTISISVHMQLGMQVIIEDYI 93
           +  I  L  +S+  H  +G++ I  DY+
Sbjct: 62 WMKIITFLTILSLLYHAWIGVRDIWMDYV 90


>gi|290474114|ref|YP_003466991.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with SdhC [Xenorhabdus bovienii SS-2004]
 gi|289173424|emb|CBJ80201.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with SdhC [Xenorhabdus bovienii SS-2004]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 8/88 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR         G   ++  R +AI  + ++++ + F     D  YE   S  S+   
Sbjct: 6  SALGR--------TGIQDWLLLRASAIVIVLYVLYLVGFVATTSDITYEVWRSFFSSSLT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYIH 94
               L  +SI VH  +GM  ++ DY+ 
Sbjct: 58 KVFTVLALLSILVHAWIGMWQVLTDYVK 85


>gi|157146671|ref|YP_001453990.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Citrobacter koseri ATCC BAA-895]
 gi|157083876|gb|ABV13554.1| hypothetical protein CKO_02437 [Citrobacter koseri ATCC BAA-895]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 51/113 (45%), Gaps = 11/113 (9%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   FI  R TAI    +I++ + FF   G+  ++      S+   
Sbjct: 6   SALGR--------NGVHDFILVRATAIVLTLYIVYMVGFFAISGELTFDVWSGFFSSAFT 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
                L   SI +H  +GM  ++ DY+    L+   L +    V+ L+++ ++
Sbjct: 58  KVFTLLALFSILIHAWIGMWQVLTDYVKPLALR---LVLQLAIVVALVVYVIY 107


>gi|227114760|ref|ZP_03828416.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
 gi|227327542|ref|ZP_03831566.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 13/114 (11%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   ++  R +AI  + ++I+ I F    GD  YE I      +A+
Sbjct: 6   SALGR--------NGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYE-IWRGFFAMAL 56

Query: 67  ASIMGLGTI-SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             +  L T+ SI VH  +GM  ++ DYI    L+   L +    V+ L+++ ++
Sbjct: 57  TKVFTLLTLFSILVHAWIGMWQVLTDYIKPLALR---LTLQLAIVVALLVYVIY 107


>gi|261822346|ref|YP_003260452.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium wasabiae WPP163]
 gi|261606359|gb|ACX88845.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pectobacterium wasabiae WPP163]
          Length = 115

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 13/114 (11%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           S+LGR        +G   ++  R +AI  + ++I+ I F    GD  YE I      +A+
Sbjct: 6   SALGR--------NGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYE-IWRGFFAMAL 56

Query: 67  ASIMGLGTI-SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             +  L T+ SI VH  +GM  ++ DYI    L+   L +    V+ L+++ ++
Sbjct: 57  TKVFTLLTLFSILVHAWIGMWQVLTDYIKPLALR---LTLQLAIVVALLVYVIY 107


>gi|49077572|gb|AAT49694.1| PA1582 [synthetic construct]
          Length = 123

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 37/76 (48%)

Query: 18 AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
          ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 9  SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 68

Query: 78 SVHMQLGMQVIIEDYI 93
          SVH  +GM  I  DY+
Sbjct: 69 SVHAWVGMWTISTDYL 84


>gi|152984268|ref|YP_001349046.1| succinate dehydrogenase subunit D [Pseudomonas aeruginosa PA7]
 gi|150959426|gb|ABR81451.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas aeruginosa PA7]
          Length = 124

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 11  SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 70

Query: 78  SVHMQLGMQVIIEDYIHYRLLK-----IMFLFMNSC 108
           SVH  +GM  I  DY+    L      + FLF   C
Sbjct: 71  SVHAWVGMWTISTDYLTPMALGKAATVVRFLFQAVC 106


>gi|145537153|ref|XP_001454293.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124422048|emb|CAK86896.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1560

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 8/88 (9%)

Query: 24  HFIKQR----FTAIANIPFIIFFIAFFIKYGDAPYEQIV--SVLSNVAVASIMGLGTISI 77
           HFI Q     F  I +IP  I    F +   +  Y  +V  + ++NVA  S   L T S 
Sbjct: 479 HFILQNLLIVFQMIPSIPLSIVLDPFIVNLQEKTYPSLVVFNFIANVANNS--NLTTKSQ 536

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFM 105
              M L  ++ I D +HYR+   +FL M
Sbjct: 537 IQIMDLLSKIAIYDTLHYRIASQIFLQM 564


>gi|300722383|ref|YP_003711669.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with SdhC [Xenorhabdus nematophila ATCC 19061]
 gi|297628886|emb|CBJ89469.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with SdhC [Xenorhabdus nematophila ATCC 19061]
          Length = 115

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 8/88 (9%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          S+LGR         G   ++  R +AI  + ++++ + F     D  YE   S  S+   
Sbjct: 6  SALGR--------TGIQDWLLLRASAIIIVLYVLYLVGFVATTSDMTYEVWRSFFSSSLT 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYIH 94
               L  ISI VH  +GM  ++ DY+ 
Sbjct: 58 KVFTVLTLISILVHAWIGMWQVLTDYVK 85


>gi|260576580|ref|ZP_05844568.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter sp. SW2]
 gi|259021184|gb|EEW24492.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter sp. SW2]
          Length = 123

 Score = 34.3 bits (77), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 1/112 (0%)

Query: 14  GMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLG 73
           G GSA  GT        T+I     +  F+  F +    P+E +V+       A + GL 
Sbjct: 12  GKGSAHSGTHEHKDMALTSIGLAFLMPTFLFIFGRTLGQPHEVVVATFGRPIPAIVTGLM 71

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
                 HM  G+  ++ DY      +++ +F+N+    L+    L++L+++A
Sbjct: 72  VFLAMRHMMHGVGSVLADYTRGTARRLLTIFVNA-LAYLITAAVLYALIRMA 122


>gi|261856936|ref|YP_003264219.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Halothiobacillus neapolitanus c2]
 gi|261837405|gb|ACX97172.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Halothiobacillus neapolitanus c2]
          Length = 116

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R    A+ G   ++ QR TA+  + + +F   + + +  + +     +  ++ V     +
Sbjct: 4   RVPSGARYGIKDWLVQRLTAVVMVIYTLFITGYLLWHPVSNFADWQMMFHSLPVRLFSLI 63

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
             +S+ VH  LGM+ I  DYIH  L++   L +++  +L L+ +  +++
Sbjct: 64  FLLSLFVHAWLGMRDIFMDYIHPTLIR---LGLHALVILALVAYTAWAV 109


>gi|28869398|ref|NP_792017.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|71734632|ref|YP_274201.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213968187|ref|ZP_03396332.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato T1]
 gi|237803490|ref|ZP_04591075.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|257485478|ref|ZP_05639519.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289624404|ref|ZP_06457358.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289646682|ref|ZP_06478025.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|301383808|ref|ZP_07232226.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302059586|ref|ZP_07251127.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302133375|ref|ZP_07259365.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28852639|gb|AAO55712.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|71555185|gb|AAZ34396.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213927167|gb|EEB60717.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato T1]
 gi|320324893|gb|EFW80965.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329259|gb|EFW85256.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330867442|gb|EGH02151.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330875699|gb|EGH09848.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330880845|gb|EGH14994.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330888151|gb|EGH20812.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330967013|gb|EGH67273.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|330987438|gb|EGH85541.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331010659|gb|EGH90715.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331018600|gb|EGH98656.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
 gi|331025472|gb|EGI05528.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 122

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLL-----KIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+    L      + FLF   C VL+   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYF 112


>gi|11467130|ref|NP_054431.1| succinate dehydrogenase subunit 4 [Marchantia polymorpha]
 gi|262186732|ref|YP_003275991.1| succinate dehydrogenase subunit 4 [Pleurozia purpurea]
 gi|586765|sp|P38460|YMF17_MARPO RecName: Full=Uncharacterized mitochondrial protein ymf17; AltName:
           Full=ORF86A
 gi|786215|gb|AAC09428.1| ORF86a [Marchantia polymorpha]
 gi|237780729|gb|ACR19375.1| succinate dehydrogenase subunit 4 [Pleurozia purpurea]
          Length = 86

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 30/104 (28%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGT 74
           M + ++  GH++ QR TA   IP I+                       +A  S + L  
Sbjct: 1   MKTHRETLGHWLLQRITAAFLIPTIL-----------------------IANVSTLILLN 37

Query: 75  ISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           I +  H+ +G++ I+ DY+H+ + +       +  ++LL +FCL
Sbjct: 38  ILLFWHIHVGIEEILADYVHHEVTR-------NWILILLRVFCL 74


>gi|66045246|ref|YP_235087.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae B728a]
 gi|289679939|ref|ZP_06500829.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae FF5]
 gi|302187423|ref|ZP_07264096.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae 642]
 gi|63255953|gb|AAY37049.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae B728a]
 gi|330899181|gb|EGH30600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330940368|gb|EGH43473.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330951680|gb|EGH51940.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae Cit 7]
 gi|330980728|gb|EGH78831.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 122

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHGLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLL-----KIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+    L      + FLF   C VL+   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYF 112


>gi|38638303|ref|NP_943706.1| succinate:cytochrome c oxidoreductase subunit 4 [Chara vulgaris]
 gi|32966617|gb|AAP92200.1| succinate:cytochrome c oxidoreductase subunit 4 [Chara vulgaris]
          Length = 92

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 27/107 (25%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGT 74
           M + ++   H++ QR TA   IP I+                    L+NV   S + L  
Sbjct: 1   MKANRERLAHWLLQRITAAFLIPTIL--------------------LANV---STLILLN 37

Query: 75  ISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI----IFC 117
           I +  HM +G++ I+ DYIH+ + +         FVL++I    +FC
Sbjct: 38  ILLFWHMHVGIEEILADYIHHEVTRNFICLFLRVFVLIIIKYVFVFC 84


>gi|66816323|ref|XP_642171.1| succinate dehydrogenase [Dictyostelium discoideum AX4]
 gi|60470271|gb|EAL68251.1| succinate dehydrogenase [Dictyostelium discoideum AX4]
          Length = 179

 Score = 33.9 bits (76), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLK 99
           +N+A+ S + LG IS+  H+ LGM+ +I DYI+   L+
Sbjct: 107 TNLALVSDIALG-ISLPAHLYLGMEAVINDYIYRPALR 143


>gi|90580051|ref|ZP_01235859.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Vibrio angustum S14]
 gi|90438936|gb|EAS64119.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Vibrio angustum S14]
          Length = 115

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 8/94 (8%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           SS+GR        +G   FI  R TAI    + ++ + FF    +  +E      + ++ 
Sbjct: 6   SSVGR--------NGIHDFILIRATAIILTLYTVYMVGFFAFGSELTFETWSVFFNQIST 57

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKI 100
                L  +SI VH  +G+  ++ DYI   +L++
Sbjct: 58  KVFTMLALVSILVHAWIGLWQVLTDYIKPAVLRV 91


>gi|119945915|ref|YP_943595.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Psychromonas ingrahamii 37]
 gi|119864519|gb|ABM03996.1| succinate dehydrogenase subunit D [Psychromonas ingrahamii 37]
          Length = 114

 Score = 33.9 bits (76), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++++ + F + + D  Y   V   S            I++ 
Sbjct: 10  RNGVHDYVLTRASAIIILAYVLYLVGF-VTFADIDYFTWVDFFSLTLTKVFTLFALIAML 68

Query: 79  VHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFV 110
           VH  +G+  ++ DY+   LL+  + FL  ++ FV
Sbjct: 69  VHSWIGLWQVLTDYVKNALLRAALQFLLTSTAFV 102


>gi|330959059|gb|EGH59319.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 122

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLK-----IMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+    L      + FLF   C VL+   F
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSATVVRFLFQAVCGVLMFAYF 112


>gi|90416068|ref|ZP_01224001.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [marine gamma proteobacterium HTCC2207]
 gi|90332442|gb|EAS47639.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [marine gamma proteobacterium HTCC2207]
          Length = 122

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 7  SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
          +SLGR         G   ++  R +A     ++IF + + +   +  Y    ++ S++ +
Sbjct: 6  TSLGR--------SGLSDWLIARVSAYVMSAYLIFIVGYLMLTPELNYADWAALNSSLPM 57

Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYIHYRLL 98
               L  +SI+ H  +GM  ++ DY+  RL+
Sbjct: 58 RMFSLLTILSIAAHAWIGMWCVLTDYVTVRLI 89


>gi|149911924|ref|ZP_01900523.1| hypothetical succinate dehydrogenase, hydrophobic subunit
           [Moritella sp. PE36]
 gi|149805017|gb|EDM65045.1| hypothetical succinate dehydrogenase, hydrophobic subunit
           [Moritella sp. PE36]
          Length = 114

 Score = 33.5 bits (75), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 3/102 (2%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + GT  FI  R TAI    +  +F+  F+ + D  Y+      ++        L  I+I 
Sbjct: 10  RSGTHDFIMIRATAIIMALYTFYFVG-FVAFNDLTYQVWSDFFASTGNKVFTLLTLIAIV 68

Query: 79  VHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFVLLLIIFCL 118
           +H  +G+  ++ DY+    L+  + F+   + F+  L+ F +
Sbjct: 69  IHAWIGVWQVLTDYVKSTGLRGALQFILTTTAFIYALVGFVV 110


>gi|332306146|ref|YP_004433997.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173475|gb|AEE22729.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 115

 Score = 33.5 bits (75), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 36/76 (47%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          +DG   ++  R TAI    F ++   FF+      YE    + S++ +        +S+ 
Sbjct: 10 RDGVQDYVTVRATAIIMTVFSLYMAWFFLSTETVTYEIWRGLFSSLGMKVFTFAALVSVM 69

Query: 79 VHMQLGMQVIIEDYIH 94
          +H+++G   ++ DY+ 
Sbjct: 70 LHIRIGFWQVLTDYVK 85


>gi|70729105|ref|YP_258841.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens Pf-5]
 gi|68343404|gb|AAY91010.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens Pf-5]
          Length = 122

 Score = 33.5 bits (75), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 5/104 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + +      Y Q   + +N  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYLVANPGIDYTQWHGLFANNWMRIFSLLAMVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLL-----KIMFLFMNSCFVLLLIIF 116
             H  +GM  I  DY+    L      + FLF   C V +   F
Sbjct: 69  GAHAWVGMWTISTDYLTPMALGKSATAVRFLFQAVCGVAMFAYF 112


Searching..................................................done


Results from round 2




>gi|148559156|ref|YP_001259727.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ovis ATCC 25840]
 gi|161619820|ref|YP_001593707.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella canis ATCC 23365]
 gi|163843926|ref|YP_001628330.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis ATCC 23445]
 gi|225628103|ref|ZP_03786138.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti str. Cudo]
 gi|225853340|ref|YP_002733573.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis ATCC 23457]
 gi|254704917|ref|ZP_05166745.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis bv. 3 str. 686]
 gi|254707569|ref|ZP_05169397.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella pinnipedialis M163/99/10]
 gi|254708894|ref|ZP_05170705.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella pinnipedialis B2/94]
 gi|254717970|ref|ZP_05179781.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. 83/13]
 gi|256030420|ref|ZP_05444034.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella pinnipedialis M292/94/1]
 gi|256045511|ref|ZP_05448394.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059879|ref|ZP_05450066.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella neotomae 5K33]
 gi|256112238|ref|ZP_05453159.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis bv. 3 str. Ether]
 gi|256158404|ref|ZP_05456302.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti M490/95/1]
 gi|256253824|ref|ZP_05459360.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti B1/94]
 gi|256263173|ref|ZP_05465705.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370305|ref|YP_003107816.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella microti CCM 4915]
 gi|260169331|ref|ZP_05756142.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella sp. F5/99]
 gi|260567608|ref|ZP_05838078.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|261220958|ref|ZP_05935239.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           B1/94]
 gi|261315054|ref|ZP_05954251.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M163/99/10]
 gi|261316389|ref|ZP_05955586.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis B2/94]
 gi|261323850|ref|ZP_05963047.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           neotomae 5K33]
 gi|261755613|ref|ZP_05999322.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 3 str. 686]
 gi|261758846|ref|ZP_06002555.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|265982913|ref|ZP_06095648.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella sp.
           83/13]
 gi|265987462|ref|ZP_06100019.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M292/94/1]
 gi|265991934|ref|ZP_06104491.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993666|ref|ZP_06106223.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 3 str. Ether]
 gi|265996917|ref|ZP_06109474.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M490/95/1]
 gi|294851144|ref|ZP_06791817.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella sp. NVSL 07-0026]
 gi|306838922|ref|ZP_07471749.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. NF 2653]
 gi|306842943|ref|ZP_07475577.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO2]
 gi|306843358|ref|ZP_07475959.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO1]
 gi|148370413|gb|ABQ60392.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ovis ATCC 25840]
 gi|161336631|gb|ABX62936.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella canis ATCC 23365]
 gi|163674649|gb|ABY38760.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis ATCC 23445]
 gi|225616928|gb|EEH13975.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti str. Cudo]
 gi|225641705|gb|ACO01619.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis ATCC 23457]
 gi|256000468|gb|ACU48867.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella microti CCM 4915]
 gi|260157126|gb|EEW92206.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|260919542|gb|EEX86195.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           B1/94]
 gi|261295612|gb|EEX99108.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis B2/94]
 gi|261299830|gb|EEY03327.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           neotomae 5K33]
 gi|261304080|gb|EEY07577.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M163/99/10]
 gi|261738830|gb|EEY26826.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|261745366|gb|EEY33292.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 3 str. 686]
 gi|262551385|gb|EEZ07375.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M490/95/1]
 gi|262764647|gb|EEZ10568.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003000|gb|EEZ15293.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093079|gb|EEZ17229.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659659|gb|EEZ29920.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           pinnipedialis M292/94/1]
 gi|264661505|gb|EEZ31766.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella sp.
           83/13]
 gi|294819733|gb|EFG36732.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella sp. NVSL 07-0026]
 gi|306276049|gb|EFM57749.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO1]
 gi|306286871|gb|EFM58396.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. BO2]
 gi|306405992|gb|EFM62244.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella sp. NF 2653]
 gi|326409904|gb|ADZ66969.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis M28]
 gi|326539617|gb|ADZ87832.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella melitensis M5-90]
          Length = 131

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 88/128 (68%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|23502754|ref|NP_698881.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis 1330]
 gi|23348772|gb|AAN30796.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Brucella suis 1330]
          Length = 131

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 87/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  +    HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLMGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|254713681|ref|ZP_05175492.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti M644/93/1]
 gi|254715968|ref|ZP_05177779.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella ceti M13/05/1]
 gi|261217732|ref|ZP_05932013.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M13/05/1]
 gi|261321420|ref|ZP_05960617.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M644/93/1]
 gi|260922821|gb|EEX89389.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M13/05/1]
 gi|261294110|gb|EEX97606.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella ceti
           M644/93/1]
          Length = 131

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 89/128 (69%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++++ 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVLAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|254700547|ref|ZP_05162375.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella suis bv. 5 str. 513]
 gi|261751051|ref|ZP_05994760.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 5 str. 513]
 gi|261740804|gb|EEY28730.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella suis
           bv. 5 str. 513]
          Length = 131

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 88/128 (68%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVWAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|260562820|ref|ZP_05833306.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|260152836|gb|EEW87928.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
          Length = 131

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 89/128 (69%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+SLG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTSLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|153008287|ref|YP_001369502.1| succinate dehydrogenase hydrophobic membrane anchor [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560175|gb|ABS13673.1| Succinate dehydrogenase hydrophobic membrane anchor [Ochrobactrum
           anthropi ATCC 49188]
          Length = 131

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 86/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GTGHF  QR +A A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRTPLGKVRGLGSAKEGTGHFWYQRLSAAALVPLVMFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +K++ + +N+ F  ++   C+F+
Sbjct: 64  LSHPFTAIVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKVVLVMLNTFFTAVVGFACIFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|17986444|ref|NP_539078.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis bv. 1 str. 16M]
 gi|17982040|gb|AAL51342.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella melitensis bv. 1 str. 16M]
          Length = 128

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 89/128 (69%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+SLG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 1   MNNDMRTSLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 61  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 120

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 121 ILKLSFGG 128


>gi|62290759|ref|YP_222552.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus bv. 1 str. 9-941]
 gi|82700670|ref|YP_415244.1| hypothetical protein BAB1_1902 [Brucella melitensis biovar Abortus
           2308]
 gi|189024972|ref|YP_001935740.1| succinate dehydrogenase [Brucella abortus S19]
 gi|237816265|ref|ZP_04595258.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus str. 2308 A]
 gi|254690048|ref|ZP_05153302.1| succinate dehydrogenase [Brucella abortus bv. 6 str. 870]
 gi|254694536|ref|ZP_05156364.1| succinate dehydrogenase [Brucella abortus bv. 3 str. Tulya]
 gi|254696161|ref|ZP_05157989.1| succinate dehydrogenase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731079|ref|ZP_05189657.1| succinate dehydrogenase [Brucella abortus bv. 4 str. 292]
 gi|256258301|ref|ZP_05463837.1| succinate dehydrogenase [Brucella abortus bv. 9 str. C68]
 gi|260546024|ref|ZP_05821764.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260755582|ref|ZP_05867930.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 6 str. 870]
 gi|260758808|ref|ZP_05871156.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 4 str. 292]
 gi|260760532|ref|ZP_05872875.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260884608|ref|ZP_05896222.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 9 str. C68]
 gi|261214855|ref|ZP_05929136.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 3 str. Tulya]
 gi|297247146|ref|ZP_06930864.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella abortus bv. 5 str. B3196]
 gi|62196891|gb|AAX75191.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616771|emb|CAJ11858.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|189020544|gb|ACD73266.1| succinate dehydrogenase [Brucella abortus S19]
 gi|237788332|gb|EEP62547.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brucella abortus str. 2308 A]
 gi|260096131|gb|EEW80007.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260669126|gb|EEX56066.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 4 str. 292]
 gi|260670964|gb|EEX57785.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260675690|gb|EEX62511.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 6 str. 870]
 gi|260874136|gb|EEX81205.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 9 str. C68]
 gi|260916462|gb|EEX83323.1| succinate dehydrogenase hydrophobic membrane anchor [Brucella
           abortus bv. 3 str. Tulya]
 gi|297174315|gb|EFH33662.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Brucella abortus bv. 5 str. B3196]
          Length = 131

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 87/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR  LG+VRG+GSAK+GT HF  QR +A+A +P ++FFI   I    A Y ++ + 
Sbjct: 4   MNNDMRIPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +KI+ + +N+ F +++ + C+F+
Sbjct: 64  LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|239833034|ref|ZP_04681363.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ochrobactrum intermedium LMG 3301]
 gi|239825301|gb|EEQ96869.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ochrobactrum intermedium LMG 3301]
          Length = 131

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 87/128 (67%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ DMR+ LG+VRG+GSAK+GTGHF  QR +A+A +P ++FFI   +    A + ++ + 
Sbjct: 4   MNKDMRTPLGKVRGLGSAKEGTGHFWYQRLSAVALVPLVMFFIGLVVSLNGASFAEVRAA 63

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+   A +M L  ++   HM+LGMQVIIEDY+H   +K++ + +NS F  ++   C+F+
Sbjct: 64  LSHPFTAIVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKVVLVMLNSFFTAVVGFACIFA 123

Query: 121 LLKIAILG 128
           +LK++  G
Sbjct: 124 ILKLSFGG 131


>gi|325294013|ref|YP_004279877.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           sp. H13-3]
 gi|325061866|gb|ADY65557.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           sp. H13-3]
          Length = 126

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 68/125 (54%), Positives = 94/125 (75%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA+AN+P +IFF+ F IKY  APY ++ + LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFWRQRLTAVANVPLLIFFVVFLIKYAGAPYPEVAAALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IMGL  +S  +HM+LGMQVIIEDY+H  + K++ L +N+ F +L+   C+F++LK
Sbjct: 62  PLVAVIMGLVLVSGLIHMKLGMQVIIEDYVHGEVSKLVLLMLNTFFAVLIGGLCIFAILK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|209551263|ref|YP_002283180.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537019|gb|ACI56954.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 126

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 71/125 (56%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFLFFMITYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|116254177|ref|YP_770015.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258825|emb|CAK09931.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 126

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 69/125 (55%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F + Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFVFFMLAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    K+  L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKVALLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|319780754|ref|YP_004140230.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166642|gb|ADV10180.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 131

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 88/127 (69%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           + DMR+ L RVRG+GSA++GTGHF +QR TAIANIP I+FF+ F I    A +E + + L
Sbjct: 5   NTDMRTPLARVRGLGSAREGTGHFWRQRLTAIANIPLILFFVGFLIALNGADHEHVRAAL 64

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +N  VA +M L  IS   HM++GMQVIIEDY+H   +K+  + +N+ F + + +  +F+L
Sbjct: 65  ANPFVALVMALVLISGLTHMRIGMQVIIEDYVHGEGMKLALIALNTFFTIAVGVASIFAL 124

Query: 122 LKIAILG 128
           LK+A  G
Sbjct: 125 LKLAFGG 131


>gi|241206663|ref|YP_002977759.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860553|gb|ACS58220.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 126

 Score =  169 bits (430), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 92/125 (73%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TA+AN+P I+FF+ F + Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFVFFMLAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI+ L +N+ F +L+   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIVLLMLNTFFAILIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|328541810|ref|YP_004301919.1| Succinate dehydrogenase, hydrophobic membrane anchor protein
           [polymorphum gilvum SL003B-26A1]
 gi|326411562|gb|ADZ68625.1| Succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Polymorphum gilvum SL003B-26A1]
          Length = 127

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 56/125 (44%), Positives = 79/125 (63%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSAKDGT HF +QR TA+AN+  I FF+   I    A Y+++ + L N
Sbjct: 3   DMRTPLAKVRGLGSAKDGTEHFWRQRVTAVANVFLISFFVITLISLQGAGYDEVRTCLGN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +M L   S   HM+LGMQVIIEDY+H   +K + L  N+ F   + +  +F++LK
Sbjct: 63  PIVAILMLLVIASGVYHMKLGMQVIIEDYVHGDGVKFLALMANTFFCAFIGLGSVFAVLK 122

Query: 124 IAILG 128
           +   G
Sbjct: 123 LGFGG 127


>gi|86359477|ref|YP_471369.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Rhizobium etli CFN 42]
 gi|86283579|gb|ABC92642.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Rhizobium etli CFN 42]
          Length = 126

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA++NIP I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLFS+LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIASLCLFSILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|218671677|ref|ZP_03521346.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli GR56]
          Length = 126

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA+ANIP I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTSHFWRQRLTAVANIPLILFFVIFMIAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|190893745|ref|YP_001980287.1| succinate dehydrogenase, membrane anchor subunit [Rhizobium etli
           CIAT 652]
 gi|218515348|ref|ZP_03512188.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli 8C-3]
 gi|190699024|gb|ACE93109.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli CIAT 652]
          Length = 126

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/125 (55%), Positives = 91/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA++NIP I+FF+ F I Y  APY  +V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLF++LK
Sbjct: 62  PFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|118590534|ref|ZP_01547936.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Stappia aggregata IAM 12614]
 gi|118436997|gb|EAV43636.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Stappia aggregata IAM 12614]
          Length = 127

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 56/125 (44%), Positives = 78/125 (62%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSAK+GT HF KQR TA+AN+  I FF+   I    + +  +V  L N
Sbjct: 3   DMRTPLNKVRGLGSAKEGTDHFWKQRLTAVANVFLISFFVILVIAMQGSTHADVVETLKN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V+ I+ L  +S   HM+LGMQVIIEDY+H   +K + L  N+ F   +   C+F++LK
Sbjct: 63  PLVSIILLLVILSGVYHMKLGMQVIIEDYVHGEGIKFLTLMANTFFCAFIGFGCVFAVLK 122

Query: 124 IAILG 128
           I   G
Sbjct: 123 IGFGG 127


>gi|227823651|ref|YP_002827624.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Sinorhizobium fredii NGR234]
 gi|227342653|gb|ACP26871.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Sinorhizobium fredii NGR234]
          Length = 126

 Score =  167 bits (423), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 90/125 (72%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA++N+P + FF+ F  +Y  AP+ ++V+ L+N
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFWRQRLTAVSNLPLLTFFVFFVARYAGAPHAEVVAALAN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IM L  IS  VHM++GMQVIIEDY+H   +KI  L +N+ F + +   CLF++LK
Sbjct: 62  PFVAVIMALVVISALVHMRIGMQVIIEDYVHAEGVKIALLMLNTFFAIAIGGLCLFAVLK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|15966824|ref|NP_387177.1| succinate dehydrogenase membrane anchor subunit protein
           [Sinorhizobium meliloti 1021]
 gi|307301652|ref|ZP_07581411.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti BL225C]
 gi|307316324|ref|ZP_07595768.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti AK83]
 gi|15076096|emb|CAC47650.1| Probable succinate dehydrogenase membrane anchor subunit
           [Sinorhizobium meliloti 1021]
 gi|306898164|gb|EFN28906.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti AK83]
 gi|306903350|gb|EFN33939.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sinorhizobium meliloti BL225C]
          Length = 126

 Score =  164 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 88/125 (70%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MR+ LG+VRG+GSAK+GT HF +QR TA+A+IP  IFF+ F   Y  AP+ ++++ LSN
Sbjct: 2   NMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA  MGL  ++  VHM++GMQVIIEDY+H    KI  L +N+ F + +   CLF++LK
Sbjct: 62  PFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVLK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|254503995|ref|ZP_05116146.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Labrenzia alexandrii DFL-11]
 gi|222440066|gb|EEE46745.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Labrenzia alexandrii DFL-11]
          Length = 127

 Score =  164 bits (416), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/125 (46%), Positives = 79/125 (63%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+V G+GSAKDGT HF KQR TA+AN+  I FF+   I    + +  +V  L N
Sbjct: 3   DMRTPLGKVLGLGSAKDGTDHFWKQRLTAVANVFLISFFVILVISMQGSSHGDVVETLQN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V+ I+ L  +S   HM+LGMQVIIEDYIH   LK + +  N+ F + +   C+F++LK
Sbjct: 63  PLVSIILLLVILSGVYHMKLGMQVIIEDYIHGEALKFLTVMANTFFCVFIGFGCIFAVLK 122

Query: 124 IAILG 128
           I   G
Sbjct: 123 IGFGG 127


>gi|218462021|ref|ZP_03502112.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium
           etli Kim 5]
          Length = 123

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 67/123 (54%), Positives = 89/123 (72%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           R+ LG+VRG+GSAK+GT HF +QR TA++NIP I+FF+ F I Y  APY  +V  LSN  
Sbjct: 1   RTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALSNPF 60

Query: 66  VASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
           VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+ F +++   CLF++LKIA
Sbjct: 61  VAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIAGLCLFAILKIA 120

Query: 126 ILG 128
            +G
Sbjct: 121 FVG 123


>gi|110635574|ref|YP_675782.1| succinate dehydrogenase subunit D [Mesorhizobium sp. BNC1]
 gi|110286558|gb|ABG64617.1| succinate dehydrogenase subunit D [Chelativorans sp. BNC1]
          Length = 127

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 61/125 (48%), Positives = 85/125 (68%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSA+ GT HF +QR TA++NIP IIFFI F   Y  + YE+I + L+ 
Sbjct: 3   DMRTPLNKVRGLGSARGGTEHFWRQRLTAVSNIPLIIFFIGFVAAYSGSSYEEIRAALAQ 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A +MGL  +S+  HM+LGMQVIIEDY+H    KI  + +N+ F +++    L+SLL+
Sbjct: 63  PVSALLMGLAFVSVLYHMRLGMQVIIEDYVHGEGWKIALILLNTFFPVIVGAIALYSLLR 122

Query: 124 IAILG 128
           IA  G
Sbjct: 123 IAFGG 127


>gi|307942784|ref|ZP_07658129.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseibium sp. TrichSKD4]
 gi|307773580|gb|EFO32796.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseibium sp. TrichSKD4]
          Length = 127

 Score =  163 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 81/126 (64%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
            DMR+ L +VRG+GSAKDGT HF +QR TA+AN+  I FF+   I    + YE +++ L 
Sbjct: 2   KDMRTPLAKVRGLGSAKDGTEHFWRQRVTAVANVFLISFFVILVISMQGSSYEDMIATLQ 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           N  VA +M +  +S   HM+LGMQVIIEDYIH   +K++ +  N+ F  L+    +F++L
Sbjct: 62  NPLVAILMLMVILSGVYHMKLGMQVIIEDYIHSEGVKVLAVLGNTFFSALIGFGTVFAVL 121

Query: 123 KIAILG 128
           KI   G
Sbjct: 122 KIGFGG 127


>gi|13473608|ref|NP_105176.1| succinate dehydrogenase cytochrome b small subunit [Mesorhizobium
           loti MAFF303099]
 gi|14024358|dbj|BAB50962.1| succinate dehydrogenase cytochrome b small subunit [Mesorhizobium
           loti MAFF303099]
          Length = 132

 Score =  163 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 85/127 (66%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
             DMR+ L +VRG+GSA++GTGHF +QR TAIANIP  +FF+ F I    A Y ++ + L
Sbjct: 6   STDMRTPLAKVRGLGSAREGTGHFWRQRLTAIANIPLTLFFVGFLIALNGAGYAEVRAAL 65

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +N  V  ++ L  IS  +HM+LGMQVIIEDYI    LK+  + +N+ F + + +  +F+L
Sbjct: 66  ANPFVGLMLALVLISGLIHMRLGMQVIIEDYITSEGLKLATIALNTFFTVAVGVASIFAL 125

Query: 122 LKIAILG 128
           LK+A  G
Sbjct: 126 LKLAFGG 132


>gi|15889900|ref|NP_355581.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           tumefaciens str. C58]
 gi|15157851|gb|AAK88366.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           tumefaciens str. C58]
          Length = 126

 Score =  163 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 67/125 (53%), Positives = 94/125 (75%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF++QR TA+AN+P +IFF+ F IKY  APY ++V+ LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFLRQRVTAVANVPLLIFFVIFLIKYAGAPYPEVVAALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IM L  +S  +HM+LGMQVIIEDY+H  + K++ L +N+ F +L+    +F++LK
Sbjct: 62  PLVAVIMALVLVSGLIHMKLGMQVIIEDYVHAEVSKLVLLMLNTFFAILIGGLSIFAILK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|240851319|ref|YP_002972722.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella grahamii as4aup]
 gi|240268442|gb|ACS52030.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella grahamii as4aup]
          Length = 128

 Score =  162 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 79/128 (61%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+ LG+VRG GSA +GT HF  QR T + N+P +IFFI   +      Y  + + 
Sbjct: 1   MKKDFRTELGKVRGRGSAHEGTEHFWLQRLTGLVNLPLLIFFIVLILSLVGKDYSIVRAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L++  VA +MGL T S+  HM+LGMQV+IEDYI     +I FL +N  F  L+    +FS
Sbjct: 61  LAHPVVAILMGLMTFSVLYHMKLGMQVVIEDYIPREGFRIFFLTLNISFCFLIGGVIIFS 120

Query: 121 LLKIAILG 128
           LLKIA+ G
Sbjct: 121 LLKIALGG 128


>gi|150398155|ref|YP_001328622.1| succinate dehydrogenase hydrophobic membrane anchor [Sinorhizobium
           medicae WSM419]
 gi|150029670|gb|ABR61787.1| Succinate dehydrogenase hydrophobic membrane anchor [Sinorhizobium
           medicae WSM419]
          Length = 126

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 62/125 (49%), Positives = 87/125 (69%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ LG+VRG+GSAK+GT HF +QR TA+A+IP  IFF+ F   Y  AP+ ++++ L+N
Sbjct: 2   SMRTPLGKVRGLGSAKEGTDHFWRQRVTAVASIPLTIFFVVFLAHYAGAPHAELLAALAN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA  MGL  ++  VHM++GMQVIIEDY+H    KI  L +N+ F + +   CLF++LK
Sbjct: 62  PFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVLK 121

Query: 124 IAILG 128
           IA  G
Sbjct: 122 IAFAG 126


>gi|222150047|ref|YP_002551004.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           vitis S4]
 gi|221737029|gb|ACM37992.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium
           vitis S4]
          Length = 126

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 67/125 (53%), Positives = 92/125 (73%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAKDGT HF +QR TAIAN+P ++FFI F + +  APY  +VS LSN
Sbjct: 2   DMRTPLGKVRGLGSAKDGTEHFWRQRLTAIANVPLMLFFIIFMLTHAGAPYADVVSALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IMGL  +S  +HM++GMQ II DYIH  ++K+  + +N+ FV++    CLF++LK
Sbjct: 62  PLVAVIMGLVVLSGLIHMKIGMQEIIADYIHNEVMKMGLMMLNTFFVVITGALCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|222087468|ref|YP_002546005.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Agrobacterium radiobacter K84]
 gi|221724916|gb|ACM28072.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Agrobacterium radiobacter K84]
          Length = 126

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 92/125 (73%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ LG+VRG+GSAK+GT HF +QR TA+AN+P  IFF+ F I Y  APY ++V  LSN
Sbjct: 2   DMRTPLGKVRGLGSAKEGTDHFWRQRLTAVANVPLFIFFVIFLIIYAGAPYAEVVHALSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA IMGL  IS  +HM+LGMQVIIEDY+H    KI+ L +N+ F +++   CLF++LK
Sbjct: 62  PFVAVIMGLMVISGIIHMKLGMQVIIEDYVHGEFGKIVLLMLNTFFSIVMAGLCLFAILK 121

Query: 124 IAILG 128
           IA +G
Sbjct: 122 IAFVG 126


>gi|260464203|ref|ZP_05812396.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259030006|gb|EEW31289.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 131

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 58/127 (45%), Positives = 88/127 (69%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
             DMR+ L RVRG+GSA++GTGHF +QR TAIANIP I+FF+ F I    A + ++ + L
Sbjct: 5   KTDMRTPLARVRGLGSAREGTGHFWRQRLTAIANIPLILFFVGFLIALNGAGFAEVRAAL 64

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +N  VA ++ L  +S  +HM++GMQVIIEDY+H   +K+  + +N+ F + + +  +F+L
Sbjct: 65  ANPFVALVVALVLVSGLIHMRIGMQVIIEDYVHGEGMKLALIALNTFFTVAVGVTSIFAL 124

Query: 122 LKIAILG 128
           LK+A  G
Sbjct: 125 LKLAFGG 131


>gi|49476234|ref|YP_034275.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella henselae str. Houston-1]
 gi|49239042|emb|CAF28342.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella henselae str. Houston-1]
          Length = 128

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 61/128 (47%), Positives = 81/128 (63%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+ LG+VRG GSA +GT HF  QR T   N+P +IFFI   +      Y  I + 
Sbjct: 1   MKKDFRTELGKVRGRGSAHEGTEHFWLQRLTGFINLPLLIFFIVLILSLVGKDYSIIRAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L++  VA +MGL T+S+  HM+LGMQV+IEDYI    L+I+FL +N  F  +L    +F+
Sbjct: 61  LAHPVVAVLMGLLTLSVLYHMKLGMQVVIEDYIPREGLRIIFLVLNILFCFVLGGIIVFA 120

Query: 121 LLKIAILG 128
           LLKIAI G
Sbjct: 121 LLKIAIGG 128


>gi|163761420|ref|ZP_02168494.1| probable succinate dehydrogenase membrane anchor subunit protein
           [Hoeflea phototrophica DFL-43]
 gi|162281415|gb|EDQ31712.1| probable succinate dehydrogenase membrane anchor subunit protein
           [Hoeflea phototrophica DFL-43]
          Length = 127

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 83/126 (65%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
            +MR+ L +VRG+GSAK+GT HF +QR TA+AN+P IIFFI F I Y   PYE +   LS
Sbjct: 2   NNMRTPLSKVRGLGSAKEGTDHFWRQRVTAVANVPLIIFFILFIIAYNGEPYEVVAGALS 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           N  VA +MGL  IS  VHM+LGMQVIIEDYIH    K+  L  N+ F   +    LFS+L
Sbjct: 62  NPLVAVLMGLVVISGLVHMRLGMQVIIEDYIHAEGAKVALLLFNTFFTAAIGAVSLFSVL 121

Query: 123 KIAILG 128
           K+   G
Sbjct: 122 KLGFGG 127


>gi|254781042|ref|YP_003065455.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040719|gb|ACT57515.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 130

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 130/130 (100%), Positives = 130/130 (100%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV
Sbjct: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS
Sbjct: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120

Query: 121 LLKIAILGTL 130
           LLKIAILGTL
Sbjct: 121 LLKIAILGTL 130


>gi|49474756|ref|YP_032798.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella quintana str. Toulouse]
 gi|49240260|emb|CAF26730.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella quintana str. Toulouse]
          Length = 128

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/127 (43%), Positives = 80/127 (62%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D ++ LG+VRG+GSA++GT HF  +R T++ N+P  IFFI   +      Y  + + 
Sbjct: 1   MKKDFQTELGKVRGLGSAREGTEHFWLERLTSVLNLPLCIFFIVLILSLIGKDYTIVHAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  V  +MGL T S+  HM+L MQV+IEDYI    L+I+FL +N  F  +L    +F+
Sbjct: 61  LSHPVVTILMGLLTFSVLYHMKLEMQVVIEDYIRREGLRILFLVLNVSFCFVLGGIIIFA 120

Query: 121 LLKIAIL 127
           LLKIA+ 
Sbjct: 121 LLKIALG 127


>gi|254471020|ref|ZP_05084423.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudovibrio sp. JE062]
 gi|211960162|gb|EEA95359.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudovibrio sp. JE062]
          Length = 127

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 55/125 (44%), Positives = 78/125 (62%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           DMR+ L +VRG+GSAKDGT HF +QR TA+AN+  I FF+   I    A Y      L N
Sbjct: 3   DMRTPLAKVRGLGSAKDGTTHFWRQRVTAVANVFLISFFVILVIALQGADYASFTEALQN 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             ++ ++ L  +   +HM+LGMQVIIEDYIH   LK++ L  N  FV ++ +  + ++LK
Sbjct: 63  PVISILLLLVILVGCLHMKLGMQVIIEDYIHSEGLKLLLLMGNIFFVSIIALSSVVAVLK 122

Query: 124 IAILG 128
           I+  G
Sbjct: 123 ISFGG 127


>gi|154245909|ref|YP_001416867.1| succinate dehydrogenase hydrophobic membrane anchor [Xanthobacter
           autotrophicus Py2]
 gi|154159994|gb|ABS67210.1| Succinate dehydrogenase hydrophobic membrane anchor [Xanthobacter
           autotrophicus Py2]
          Length = 135

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 81/124 (65%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR++LGRVRG+GSA+ GT HF KQR T +AN+  +I FI   I    + Y    + L + 
Sbjct: 12  MRTALGRVRGLGSARSGTDHFFKQRVTGLANLILMIAFIGIVISLAGSSYAATRATLGHP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            VA ++ L  +S++ HM++GMQV+IEDYIH   LK+M +  N+ F + + +   F++LKI
Sbjct: 72  FVAVVILLTLLSVTTHMRIGMQVVIEDYIHTEALKVMLIVANTFFSIAIALAGAFAVLKI 131

Query: 125 AILG 128
           ++ G
Sbjct: 132 SLGG 135


>gi|319406314|emb|CBI79951.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella sp. AR 15-3]
          Length = 128

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 73/128 (57%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M+ D+R+ LG+VRG GSA  GT HF  +   + AN+    FFI   +      Y  + S 
Sbjct: 1   MEKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTFFIILVMSCVGKDYSVVYSR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
            S+  VA +MGL   S   +M+LGMQV+IEDYI    ++I FL +N  F  LL    +F+
Sbjct: 61  FSHPIVAVLMGLIIFSSLYYMKLGMQVVIEDYIPNEGMRIFFLVLNILFCFLLGSIMMFA 120

Query: 121 LLKIAILG 128
           LLKIA+  
Sbjct: 121 LLKIALGA 128


>gi|121602811|ref|YP_988427.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Bartonella bacilliformis KC583]
 gi|120614988|gb|ABM45589.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Bartonella bacilliformis KC583]
          Length = 128

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/127 (40%), Positives = 76/127 (59%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  ++R+ LG+VRG+GSA  GT HF  Q  T+  NIP +IFFI   I      Y  I + 
Sbjct: 1   MKKNLRTELGKVRGLGSAHKGTEHFWVQNLTSWINIPLLIFFIILMISLAGEDYSTIHAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  +   M L   S   HM+L MQV+IEDYI ++++++ FL +N  +  L+    +F+
Sbjct: 61  LSHPVILVFMVLTVFSNLYHMKLEMQVVIEDYIPHKIIRMFFLILNISYCCLIGSLIIFA 120

Query: 121 LLKIAIL 127
           LLKIA+ 
Sbjct: 121 LLKIALG 127


>gi|92119076|ref|YP_578805.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           hamburgensis X14]
 gi|91801970|gb|ABE64345.1| succinate dehydrogenase subunit D [Nitrobacter hamburgensis X14]
          Length = 133

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/125 (32%), Positives = 66/125 (52%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
             MR+ L RVR +G+A  GT  F +QR TA+A I  I+  I   +            +L 
Sbjct: 8   KSMRTPLSRVRNLGAAHSGTKDFWRQRLTAVAMILLIVPMIVVMMILLGRNQAGAAQILG 67

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +  +A IM L  ++   HM++GMQVIIEDY+H    K+  +  N+ F + L +   +++ 
Sbjct: 68  SPPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDEKTKLASIMANNFFSVTLALAAAYAIF 127

Query: 123 KIAIL 127
           K++  
Sbjct: 128 KLSSG 132


>gi|163796398|ref|ZP_02190358.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [alpha proteobacterium BAL199]
 gi|159178248|gb|EDP62792.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [alpha proteobacterium BAL199]
          Length = 132

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/126 (34%), Positives = 71/126 (56%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
             MR+ L RVRG+GSAK+G  H+  QR TAIA +P  I+F+          +   V+ + 
Sbjct: 7   QSMRNPLARVRGLGSAKEGVHHWWAQRLTAIALVPLTIWFVISIAGLAGVDHAGAVAWIG 66

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +  VA ++ L   ++  H QLG+QV+IEDY+H   +K+  L       + L +  +F++L
Sbjct: 67  SAPVAVLLVLLIAAVYWHAQLGVQVVIEDYVHNEAVKLTALIALKFAAIALGVASIFAVL 126

Query: 123 KIAILG 128
           ++A  G
Sbjct: 127 RLAFGG 132


>gi|319899435|ref|YP_004159532.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella clarridgeiae 73]
 gi|319403403|emb|CBI76971.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella clarridgeiae 73]
          Length = 128

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 71/127 (55%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D+R+ LG+VRG GSA  GT HF  +   + AN+    FFI   +      Y  + S 
Sbjct: 1   MKKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTFFIILVMSCVGKDYNVVHSR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
            S+  V  +MGL   S   +M+LGMQV+IEDYI +  ++I F  +N  F  +L    +F+
Sbjct: 61  FSHPIVTVLMGLMIFSSLYYMKLGMQVVIEDYIPHEGMRIFFFVLNILFCFILGSIMMFA 120

Query: 121 LLKIAIL 127
           LLKIA+ 
Sbjct: 121 LLKIALG 127


>gi|158425368|ref|YP_001526660.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azorhizobium caulinodans ORS 571]
 gi|158332257|dbj|BAF89742.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azorhizobium caulinodans ORS 571]
          Length = 128

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 78/128 (60%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M   MR+ LGRVRG+GSA+ GT HF  QR TAI N+  ++  +   I    A Y    + 
Sbjct: 1   MHSPMRTPLGRVRGLGSARSGTEHFFLQRLTAIGNLILVVITLGIMISLLGAGYNAAHAT 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L N  VA ++ L  +S++ HM++GMQV+IEDY+H   LK+  +  N+ F  ++ +   F+
Sbjct: 61  LGNPIVAVVILLLLLSVTTHMRIGMQVVIEDYVHSEGLKVALIIANTFFTTVVGLAGAFA 120

Query: 121 LLKIAILG 128
           +LKI++ G
Sbjct: 121 VLKISLGG 128


>gi|27375624|ref|NP_767153.1| succinate dehydrogenase hydrophobic membrane anchor protein subunit
           [Bradyrhizobium japonicum USDA 110]
 gi|3169723|gb|AAC17941.1| succinate dehydrogenase membrane anchor subunit [Bradyrhizobium
           japonicum]
 gi|27348761|dbj|BAC45778.1| succinate dehydrogenase hydrophobic membrane anchor protein subunit
           [Bradyrhizobium japonicum USDA 110]
          Length = 134

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 70/126 (55%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+ LGRVR +G+A  GT  F +QR T +A +  +I  I   +         +   +
Sbjct: 8   KRSMRTPLGRVRNLGAAHSGTSDFWRQRITGVAMVLMMIPVIVIIVMLFGRNQAFVAQTI 67

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            ++ +A IM L   + + HM++GMQV+IEDY+H   LK+  + +N+ F + + +   +++
Sbjct: 68  GSLPIAIIMLLFIFASAWHMKIGMQVVIEDYVHNEKLKLTAIMLNNFFSIAVALASTYAI 127

Query: 122 LKIAIL 127
           LK++  
Sbjct: 128 LKLSSG 133


>gi|319409392|emb|CBI83036.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella schoenbuchensis R1]
          Length = 128

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 78/127 (61%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+  G+VRG GSA +GTGHF  +  T   ++   IFFI   I      Y+ I + 
Sbjct: 1   MKKDFRTEFGKVRGFGSAHEGTGHFWLENLTGFTSVLLWIFFIVLVISLVGEGYDVIYAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  VA +MGL T S   +M+LGMQV+IEDYI +  L+I+FL +N+ F  +L  F +F+
Sbjct: 61  LSHPIVAVLMGLMTFSSLYYMKLGMQVVIEDYIPHGNLRILFLVLNTLFCCVLGGFIIFA 120

Query: 121 LLKIAIL 127
           LLKI + 
Sbjct: 121 LLKIVLG 127


>gi|75676983|ref|YP_319404.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|74421853|gb|ABA06052.1| succinate dehydrogenase subunit D [Nitrobacter winogradskyi Nb-255]
          Length = 135

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 67/126 (53%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+ LGRVR  GSA  GT  F +QR T++A I  I+  +   +            +L
Sbjct: 9   AKSMRTPLGRVRNHGSAHSGTTDFWRQRLTSVAMILLIVPMVVVMMILLGRNQAGAAQIL 68

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +  +A IM L  ++   HM++GMQVIIEDY+H   LK+  +  N+ F + L +   +++
Sbjct: 69  GSPPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDGKLKLASIMANNFFSVTLALTAAYAI 128

Query: 122 LKIAIL 127
            K++  
Sbjct: 129 FKLSSG 134


>gi|163869247|ref|YP_001610503.1| SdhD succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella tribocorum CIP 105476]
 gi|161018950|emb|CAK02508.1| SdhD succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella tribocorum CIP 105476]
          Length = 128

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 76/128 (59%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D R+ LG+VRG GSA +GT HF  +R T   N+P +IF I   +      Y  + + 
Sbjct: 1   MKKDFRTELGKVRGRGSAHEGTEHFWLERLTGFINLPLLIFLIVLILSLVGKDYAIVRAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L++  VA +MGL T+S+  HM+L MQV+IEDYI     ++ FL +N  F   +    +FS
Sbjct: 61  LAHPIVAILMGLMTLSVIYHMKLVMQVVIEDYIPREGFRLFFLILNILFCFFIGGVIIFS 120

Query: 121 LLKIAILG 128
           LLKIA+ G
Sbjct: 121 LLKIALGG 128


>gi|319407789|emb|CBI81440.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella sp. 1-1C]
          Length = 128

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 71/128 (55%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D+R+ LG+VRG GSA  GT HF  +   + AN+    FFI   +      Y  + + 
Sbjct: 1   MKKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTFFIILVMSCVGKDYSVVHAK 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  V   MGL   S   +M+LGMQV+IEDYI +  ++I F  +N  F  +L    +F+
Sbjct: 61  LSHPMVTVWMGLMIFSSLYYMKLGMQVVIEDYIPHEGMRIFFFVLNILFCFILGSIMMFA 120

Query: 121 LLKIAILG 128
           LLKIA+  
Sbjct: 121 LLKIALGA 128


>gi|85714478|ref|ZP_01045466.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698925|gb|EAQ36794.1| succinate dehydrogenase, cytochrome b subunit [Nitrobacter sp.
           Nb-311A]
          Length = 135

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 67/126 (53%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+ LGRVR +GSA  GT  F +QR T++A I  II  +   +            +L
Sbjct: 9   AKSMRTPLGRVRNLGSAHSGTTDFWRQRLTSVAMILLIIPMVVVMMILLGRNQAGAAQIL 68

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +  +A IM L  ++   HM++GMQVIIEDY+H   LK+  +  N+ F   L +   +++
Sbjct: 69  GSPPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDEKLKLASIMANNFFSATLALTAAYAI 128

Query: 122 LKIAIL 127
            K++  
Sbjct: 129 FKLSSG 134


>gi|90421133|ref|ZP_01229035.1| succinate dehydrogenase hydrophobic membrane anchor, SdhD
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90334625|gb|EAS48405.1| succinate dehydrogenase hydrophobic membrane anchor, SdhD
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 126

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 81/124 (65%), Gaps = 1/124 (0%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MR+SL RVRG+GSA +GTGHF +QR +AI+N+  I  F+   I   D PY ++ + L++
Sbjct: 3   EMRTSLRRVRGLGSAHEGTGHFWQQRLSAISNLVLITGFVILLIVLHDQPYAEVRAALAH 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V  ++ L  IS + HM+LGMQVIIEDY+H    K+  L +N+ F + + +  LF++ +
Sbjct: 63  PLVGLLVALTVISFTYHMRLGMQVIIEDYVHG-TTKLPLLILNNFFAIAIAVASLFAIAR 121

Query: 124 IAIL 127
           ++  
Sbjct: 122 MSFG 125


>gi|319404829|emb|CBI78430.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 128

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 70/128 (54%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M  D+R+ LG+VRG GSA  GT HF  +   + AN+     FI   +      Y  + + 
Sbjct: 1   MKKDLRTELGKVRGFGSAHTGTEHFWLENLVSFANVLLWTLFIILVMSCVGKDYSVVHAR 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  V   MGL   S   +M+LGMQV+IEDYI +  ++I F  +N  F  +L    +F+
Sbjct: 61  LSHPMVTVWMGLMIFSSLYYMKLGMQVVIEDYIPHEGMRIFFFVLNILFCFILGSIMMFA 120

Query: 121 LLKIAILG 128
           LLKIA+  
Sbjct: 121 LLKIALGA 128


>gi|90421599|ref|YP_529969.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB18]
 gi|90103613|gb|ABD85650.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris
           BisB18]
          Length = 140

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 66/126 (52%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              +R+ LG+VR  G A  GT  F +QR T +A    I+  +   +            ++
Sbjct: 14  AKSLRTPLGKVRKFGPAGSGTSDFWQQRITGVAMTLLILPVVVVIMMLLGRNQAGAAQII 73

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +  +A  + L  IS +VHM++GMQV+IEDY+    LK++ +  N+ F + + +  +F++
Sbjct: 74  GSPLIALTLILFIISSAVHMKIGMQVVIEDYVQNEKLKLVTIMANNFFSIAVALAAIFAI 133

Query: 122 LKIAIL 127
            K++  
Sbjct: 134 FKLSSG 139


>gi|300024742|ref|YP_003757353.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526563|gb|ADJ25032.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 126

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/125 (37%), Positives = 73/125 (58%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ L   R +GSAK+G  HF KQR TA+AN+   +F +   +    A Y  +   L N
Sbjct: 2   TMRTPLKTARYLGSAKEGADHFWKQRVTAVANVVLAVFLVWLVVSLTGADYATVKRQLGN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             VA  +    +S ++HM+LGMQ IIEDY+H    KI+ L +N+ F +++ +  +FS+LK
Sbjct: 62  PLVALGLLSLVLSGAIHMRLGMQTIIEDYVHGEGAKIVALMLNTFFTIVVALVSIFSVLK 121

Query: 124 IAILG 128
           ++   
Sbjct: 122 LSFGA 126


>gi|148554232|ref|YP_001261814.1| succinate dehydrogenase subunit D [Sphingomonas wittichii RW1]
 gi|148499422|gb|ABQ67676.1| succinate dehydrogenase subunit D [Sphingomonas wittichii RW1]
          Length = 129

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 72/122 (59%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSAK G  H+ +QR TA  N+    +F+    +  +  ++ +V  + +  V
Sbjct: 5   TGIGRVRGLGSAKHGAMHWWRQRVTAAGNLLLATWFVVSLFRLPNLGHDVVVQWIGSPIV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L T+S+  HM+LG+QV++EDY+H    K+  L + + + +      +FS+LKIA 
Sbjct: 65  AVPLVLLTVSVFYHMRLGLQVVLEDYVHEDAGKVFSLLLLNLYTIAGAALAIFSILKIAF 124

Query: 127 LG 128
            G
Sbjct: 125 GG 126


>gi|86747452|ref|YP_483948.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris HaA2]
 gi|86570480|gb|ABD05037.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris HaA2]
          Length = 140

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 68/126 (53%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           +  MR+ +G+VR +G A  GT  F +QR T +A    I+  I   +            +L
Sbjct: 14  ERTMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLILPVIVVIMMLLGRNQAGAAQIL 73

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +  ++  M L  I+ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  +F++
Sbjct: 74  GSPLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNFFSIAVALAAIFAI 133

Query: 122 LKIAIL 127
            K+A  
Sbjct: 134 FKLASG 139


>gi|170744095|ref|YP_001772750.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium sp. 4-46]
 gi|168198369|gb|ACA20316.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium sp. 4-46]
          Length = 137

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 80/125 (64%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              +R+S  RV+G+G A  GTG +   R TA++N+P I+ F+          YE  V ++
Sbjct: 9   TRTIRTSYARVQGLGPAHHGTGEWWLHRVTAVSNVPLILSFVVIVALCAGRSYEDAVRLV 68

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  VA ++ LG +S++ HM++GMQ++IEDY+H + LKI  +  N+ +  ++ + CL+++
Sbjct: 69  SHPLVAILLILGVLSVTNHMRMGMQIVIEDYVHDKGLKIAAVIANTFYSTVVAVACLYAI 128

Query: 122 LKIAI 126
           ++I++
Sbjct: 129 VRISL 133


>gi|209883445|ref|YP_002287302.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Oligotropha carboxidovorans OM5]
 gi|209871641|gb|ACI91437.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Oligotropha carboxidovorans OM5]
          Length = 134

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 67/126 (53%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           +  MR+ L  VR +G+A  GT  F +QR TA+A    +I      I           ++L
Sbjct: 8   NVSMRTPLANVRRLGAAHGGTSDFFRQRLTAVAMALLMIPVAVIVIMLVGRDQASAQALL 67

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +  VA ++ L  I+  VHM++G+QV+IEDY+H    KI  +  N+ F   + +  ++++
Sbjct: 68  GSPVVAILLTLFIIAGCVHMKIGVQVVIEDYVHSEAAKISAILANNFFSFAVGLASIYAI 127

Query: 122 LKIAIL 127
            K+++ 
Sbjct: 128 FKLSVG 133


>gi|218531817|ref|YP_002422633.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium chloromethanicum CM4]
 gi|240140348|ref|YP_002964827.1| Succinate dehydrogenase delta subunit [Methylobacterium extorquens
           AM1]
 gi|254562943|ref|YP_003070038.1| succinate dehydrogenase, membrane anchor subunit [Methylobacterium
           extorquens DM4]
 gi|27902657|gb|AAO24620.1| succinate dehydrogenase delta subunit [Methylobacterium extorquens]
 gi|218524120|gb|ACK84705.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium chloromethanicum CM4]
 gi|240010324|gb|ACS41550.1| Succinate dehydrogenase delta subunit [Methylobacterium extorquens
           AM1]
 gi|254270221|emb|CAX26215.1| succinate dehydrogenase, membrane anchor subunit [Methylobacterium
           extorquens DM4]
          Length = 139

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/127 (33%), Positives = 75/127 (59%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+   RV+G+G++  G GHF  QR T  +N   ++ F+          Y Q V+++
Sbjct: 11  ALSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALV 70

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  VA I+ L  +S+++HM+LGMQ +IEDY+H   LK   L  N+ + + +   CL+++
Sbjct: 71  SHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAVAVAAACLYAI 130

Query: 122 LKIAILG 128
           L++++ G
Sbjct: 131 LRVSLGG 137


>gi|39933295|ref|NP_945571.1| succinate dehydrogenase cytochrome b subunit [Rhodopseudomonas
           palustris CGA009]
 gi|192288648|ref|YP_001989253.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris TIE-1]
 gi|39652920|emb|CAE25662.1| succinate dehydrogenase cytochrome b small subunit
           [Rhodopseudomonas palustris CGA009]
 gi|192282397|gb|ACE98777.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris TIE-1]
          Length = 137

 Score =  140 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 67/124 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ +G+VR  G A  GT  F +QR T +A    I+  I   +            +L +
Sbjct: 13  SMRTPIGKVRKFGPAGSGTSDFWQQRITGVAMALLILPTIVVIMMLLGRNQAAAAQILGS 72

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             ++ IM L  I+ ++HM++GMQV+IEDY+    LK++ +  N+ F + + +  +F++ K
Sbjct: 73  PLISLIMILFIIASAIHMKIGMQVVIEDYVQNEKLKLVTIMANNFFSIAVALAAIFAIFK 132

Query: 124 IAIL 127
           +A  
Sbjct: 133 MASG 136


>gi|299133111|ref|ZP_07026306.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Afipia sp. 1NLS2]
 gi|298593248|gb|EFI53448.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Afipia sp. 1NLS2]
          Length = 135

 Score =  140 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 68/126 (53%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+ L RVR +G+A  GT  F +QR TAIA    II      +            +L
Sbjct: 9   TVSMRTPLARVRRLGAAHAGTSDFFRQRVTAIAMALLIIPVAIIVLMLTGRDQAAAAQLL 68

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +  VA ++ L  ++  +HM++G+QV+IEDY+H   LK++ +  N+ F   + +  +F++
Sbjct: 69  GSPIVAILLALFIVAGCLHMKIGVQVVIEDYVHSEALKLLAIIANNFFSFAVGLASIFAI 128

Query: 122 LKIAIL 127
           LK++  
Sbjct: 129 LKLSFG 134


>gi|188583473|ref|YP_001926918.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium populi BJ001]
 gi|179346971|gb|ACB82383.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium populi BJ001]
          Length = 139

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 74/127 (58%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+   RV+G+G++  G  HF  QR T  +N   ++ F+          Y Q V+++
Sbjct: 11  ALSMRTPRARVKGLGASGHGASHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALV 70

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  VA I+ L  +S+++HM+LGMQ +IEDY+H   LK   L  N+ + + +   CL+++
Sbjct: 71  SHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAVAVAAACLYAI 130

Query: 122 LKIAILG 128
           +++++ G
Sbjct: 131 IRVSLGG 137


>gi|197103677|ref|YP_002129054.1| succinate dehydrogenase,hydrophobic membrane anchor protein
           [Phenylobacterium zucineum HLK1]
 gi|196477097|gb|ACG76625.1| succinate dehydrogenase,hydrophobic membrane anchor protein
           [Phenylobacterium zucineum HLK1]
          Length = 139

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 66/126 (52%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
             R+ L R +G+GSAK G GH+I +R +A A IP  ++ +   I+     Y   V+ +S 
Sbjct: 14  SFRTPLSRAKGLGSAKHGVGHWIGERVSAAALIPLTLWAVYAVIRLAALDYYGAVAWIST 73

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
               ++M L       HM  G++V++EDYIH  L K   L +N     L     +FS+LK
Sbjct: 74  PLNMTLMVLTLAFSFWHMHAGLRVVVEDYIHKTLSKAALLLLNFFVCGLAGALAVFSVLK 133

Query: 124 IAILGT 129
           +A+ G 
Sbjct: 134 VALGGA 139


>gi|220926985|ref|YP_002502287.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium nodulans ORS 2060]
 gi|219951592|gb|ACL61984.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium nodulans ORS 2060]
          Length = 137

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 41/125 (32%), Positives = 80/125 (64%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              +R++  RV+G+G A  GT  +   R TA++NIP I+ F+          YE  V ++
Sbjct: 9   TRTIRTAYARVQGLGPAHHGTSEWWLHRVTAVSNIPLIVSFVVIVALCAGRSYEDAVRLV 68

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  VA ++ LG +S++ HM++G+Q++IEDY+H + LKI  +  N+ + +++ + CL+++
Sbjct: 69  SHPLVAILLILGVLSVTNHMRMGLQIVIEDYVHDKGLKIAAVIANTFYSVVVAVACLYAI 128

Query: 122 LKIAI 126
           ++I++
Sbjct: 129 VRISL 133


>gi|114328743|ref|YP_745900.1| succinate dehydrogenase membrane anchor subunit [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316917|gb|ABI62977.1| succinate dehydrogenase membrane anchor subunit [Granulibacter
           bethesdensis CGDNIH1]
          Length = 132

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 66/122 (54%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS LGR RG+GSAK G  H+  +R T++A +P  ++FI   +        ++   + + 
Sbjct: 11  MRSHLGRARGLGSAKHGLTHWWAERVTSVALVPLTLWFIFAALHLTGHSRAEVAQWVGHP 70

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++     +   H+QLG+QVIIEDY+H   +KI  L        LL + C  S+LK+
Sbjct: 71  VHAVLLLSLVFATFHHVQLGLQVIIEDYVHTESVKIASLLATKAVCFLLGLACAVSILKM 130

Query: 125 AI 126
            +
Sbjct: 131 TL 132


>gi|316931810|ref|YP_004106792.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris DX-1]
 gi|315599524|gb|ADU42059.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodopseudomonas palustris DX-1]
          Length = 137

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 67/124 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ +G+VR  G A  GT  F +QR T +A    I+  I   +            +L +
Sbjct: 13  SMRTPIGKVRKFGPAGSGTSDFWRQRITGVAMTLLILPTIVVIMMLLGRNQAAAAQILGS 72

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             +A +M L  I+ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  +F++ K
Sbjct: 73  PLIALVMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNFFSIAVALAAIFAIFK 132

Query: 124 IAIL 127
           +A  
Sbjct: 133 MASG 136


>gi|115522539|ref|YP_779450.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisA53]
 gi|115516486|gb|ABJ04470.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris
           BisA53]
          Length = 137

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 69/126 (54%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+ LG+VR +G A+ GT  F +QR T +A    I+  I   +            +L
Sbjct: 11  KNTMRTPLGKVRKLGPARSGTSDFWQQRITGVAMTLLILPVIIIIMMLLGRNQAGAAQIL 70

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +  +A  M L  ++ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  +F++
Sbjct: 71  GSPLIALTMILFIVASAIHMKIGMQVVIEDYIQNEKLKLVTIMANNFFSIAVALAPIFAI 130

Query: 122 LKIAIL 127
           +K++  
Sbjct: 131 IKLSSG 136


>gi|325920387|ref|ZP_08182318.1| succinate dehydrogenase subunit D [Xanthomonas gardneri ATCC 19865]
 gi|325549134|gb|EGD20057.1| succinate dehydrogenase subunit D [Xanthomonas gardneri ATCC 19865]
          Length = 128

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 68/127 (53%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
              R+ L  VRG+G+AK GT HF+ QR TA A +   I+F+ F +    + Y   V+ +S
Sbjct: 2   NRYRTPLKNVRGLGAAKTGTEHFVLQRLTATALVVLSIWFLVFVLSLLGSDYPTAVAAVS 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               A ++    +++  H Q+G+QV++EDYIH  LL +           L  I  +F++ 
Sbjct: 62  RPWNAILLVGFLVAMFWHAQIGLQVVLEDYIHNSLLALALQTTVKFVAALGAIVSIFAVA 121

Query: 123 KIAILGT 129
           +IA+ G 
Sbjct: 122 RIALGGA 128


>gi|163853007|ref|YP_001641050.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium extorquens PA1]
 gi|163664612|gb|ABY31979.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium extorquens PA1]
          Length = 139

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/127 (33%), Positives = 75/127 (59%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR+   RV+G+G++  G GHF  QR T  +N   ++ F+          Y Q V+++
Sbjct: 11  ALSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALV 70

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  VA I+ L  +S+++HM+LGMQ +IEDY+H   LK   L  N+ + + +   CL+++
Sbjct: 71  SHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAVAVAAACLYAI 130

Query: 122 LKIAILG 128
           L++++ G
Sbjct: 131 LRVSLGG 137


>gi|254292678|ref|YP_003058701.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hirschia baltica ATCC 49814]
 gi|254041209|gb|ACT58004.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hirschia baltica ATCC 49814]
          Length = 132

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 5/132 (3%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAP-----YE 55
           M   MR+ LG+VRG+GSA+DG GHFI QR +A+A +  + +F+   +           + 
Sbjct: 1   MSNSMRTPLGKVRGLGSARDGAGHFIGQRVSAVALVFLVPWFLISLLGATRGDNTLERFA 60

Query: 56  QIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLII 115
              + LS    A ++ L       HM+LG+QV+IEDYI   + +I+ L +N+     LI 
Sbjct: 61  NAEAWLSQPLNAILVLLAVCGTIYHMRLGLQVVIEDYISGHMPRIVLLMLNTFLSFALIA 120

Query: 116 FCLFSLLKIAIL 127
             +FS+ K+A+ 
Sbjct: 121 ATVFSVFKVAVA 132


>gi|154251887|ref|YP_001412711.1| succinate dehydrogenase hydrophobic membrane anchor [Parvibaculum
           lavamentivorans DS-1]
 gi|154155837|gb|ABS63054.1| Succinate dehydrogenase hydrophobic membrane anchor [Parvibaculum
           lavamentivorans DS-1]
          Length = 141

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/126 (36%), Positives = 72/126 (57%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
             DMR+ L RV  +GSAK GT   I+QR TA+A  P  +FF+   +    A YE   S L
Sbjct: 15  ANDMRTPLARVLHLGSAKSGTQDHIRQRLTAVAIAPLSLFFLVLLVALTGADYETARSWL 74

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +N  V  +     ++  +HM++GMQ++IEDY+    LK + +  N+ F   + + CL+++
Sbjct: 75  ANPLVGILALCLIVAAIIHMRIGMQIVIEDYVIAPGLKHLSILANTFFSYGVGLACLYAV 134

Query: 122 LKIAIL 127
           LK+A  
Sbjct: 135 LKLAFG 140


>gi|298293273|ref|YP_003695212.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Starkeya novella DSM 506]
 gi|296929784|gb|ADH90593.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Starkeya novella DSM 506]
          Length = 136

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/124 (37%), Positives = 75/124 (60%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+   RV G+GSA+ GTGHF  QR TA++N+  +I  +   I      +  +V+ L N 
Sbjct: 13  MRTPRRRVAGLGSARSGTGHFWLQRVTALSNLILVIIALPIVIAVAGEGHAGVVATLGNP 72

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            VA ++ L  +S+ +HM++GMQV+IEDY+H   +K++ L  N+ F   +     F++LKI
Sbjct: 73  LVAIVLLLLLLSVCMHMRIGMQVVIEDYVHAEGVKVLALIANTFFTTAVGFAGAFAILKI 132

Query: 125 AILG 128
           +  G
Sbjct: 133 SFGG 136


>gi|315122381|ref|YP_004062870.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495783|gb|ADR52382.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 128

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 96/126 (76%), Positives = 113/126 (89%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MRSSLG+VRGMGSAKDGTGHF+KQRFTAIANIPF+IFFI FFI+YG AP+EQIVSV+SN
Sbjct: 2   NMRSSLGKVRGMGSAKDGTGHFLKQRFTAIANIPFVIFFIIFFIRYGSAPHEQIVSVVSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
           + VASIMGLG +SI  HMQLGMQVIIEDY+H +LLKI+ L +NS FVL + +FCLFS+LK
Sbjct: 62  LFVASIMGLGAVSIFFHMQLGMQVIIEDYVHSKLLKIVLLMLNSSFVLFMAVFCLFSILK 121

Query: 124 IAILGT 129
           I+ILG 
Sbjct: 122 ISILGN 127


>gi|304394276|ref|ZP_07376199.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ahrensia sp. R2A130]
 gi|303293716|gb|EFL88093.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ahrensia sp. R2A130]
          Length = 136

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           MD D R+ L RVRG+GSAKDGT HF  QR TA+AN+  I FF+   +    A +E+ V+ 
Sbjct: 1   MDQDFRTPLSRVRGLGSAKDGTQHFWHQRLTAMANLVLITFFVWTVVALNGATWEETVAY 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           LS+  VA +M +   +   HM+LGMQVIIEDY+H    K   L  N  F + +   C+F+
Sbjct: 61  LSSPLVAIVMVMVLGAGIYHMKLGMQVIIEDYVHGAAGK-ALLIANVFFAIAIAAACVFA 119

Query: 121 LLKIAIL 127
           +LK+   
Sbjct: 120 VLKLGFG 126


>gi|21231575|ref|NP_637492.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768303|ref|YP_243065.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|188991442|ref|YP_001903452.1| succinate dehydrogenase (ubiquinone) membrane anchor subunit
           [Xanthomonas campestris pv. campestris str. B100]
 gi|21113262|gb|AAM41416.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573635|gb|AAY49045.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167733202|emb|CAP51400.1| succinate dehydrogenase (ubiquinone) membrane anchor subunit
           [Xanthomonas campestris pv. campestris]
          Length = 128

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 67/123 (54%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+   +    A +    + ++  
Sbjct: 4   YRTPLKNVRGLGAAKTGTEHFVVQRLTATALVPLSIWFLILVLSLIGADHTAASAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    I+   H QLGMQV++EDY+H  LL +    +     +L  I  +F++ +I
Sbjct: 64  WNAILLVGFLIASFWHAQLGMQVVLEDYVHNSLLALAAQTLVRFVAVLGAIVSVFAVARI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|319786901|ref|YP_004146376.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465413|gb|ADV27145.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 127

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 67/124 (54%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +   ++F+ F +    + Y      +S  
Sbjct: 4   YRTPLKNVRGLGTAKTGTDHFVHQRLTATALVFLSLWFVYFVLGLVGSDYMAATDAVSKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    +++  H QLG+QV++EDY+H  L+ +          +L  I  +F++ +I
Sbjct: 64  WNAVLLVGFLVAMFWHAQLGLQVVLEDYVHNSLVALALQVSVKFIAVLGAIVSIFAVARI 123

Query: 125 AILG 128
           A+ G
Sbjct: 124 ALAG 127


>gi|296532572|ref|ZP_06895278.1| succinate dehydrogenase membrane anchor subunit [Roseomonas
           cervicalis ATCC 49957]
 gi|296267097|gb|EFH13016.1| succinate dehydrogenase membrane anchor subunit [Roseomonas
           cervicalis ATCC 49957]
          Length = 132

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 63/125 (50%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              + S+LGRVRG+GSAK GT H+  QR +++A +P  ++F+          +E  ++ +
Sbjct: 8   SLRLESALGRVRGLGSAKQGTHHWWMQRVSSMALLPLTLWFVISVATLAGKSHEATIAWI 67

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           ++   A ++         H   G+QV+IEDY+     ++  +        L  +    ++
Sbjct: 68  AHPLNAVLLLASIGLSFQHAASGLQVVIEDYVRGEFARMFSVLAVKAACWLFGLLSAIAV 127

Query: 122 LKIAI 126
           LKIA+
Sbjct: 128 LKIAL 132


>gi|149184715|ref|ZP_01863033.1| succinate dehydrogenase, cytochrome b subunit [Erythrobacter sp.
           SD-21]
 gi|148832035|gb|EDL50468.1| succinate dehydrogenase, cytochrome b subunit [Erythrobacter sp.
           SD-21]
          Length = 128

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 65/123 (52%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSA +G  H+++QRFTAI N+  ++F            Y  +    S    
Sbjct: 5   TPIGRVRGLGSAHEGPHHWLQQRFTAIGNLVLVLFLAVSIALLPSYDYTTMSGWASQTLP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A+ + L  I+   H ++G+QV+IEDY+H    K   + + +   +   +F L S+ +IA 
Sbjct: 65  ATALALICINTFWHARIGLQVLIEDYVHTPGNKFACIALLNLAAIGGAVFGLVSIARIAF 124

Query: 127 LGT 129
            G 
Sbjct: 125 GGI 127


>gi|114320489|ref|YP_742172.1| succinate dehydrogenase subunit D [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226883|gb|ABI56682.1| succinate dehydrogenase subunit D [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 126

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 71/124 (57%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           ++R+++   +G+GSAKDG  H+  QR TA+A +P +++      ++G A YE  V+ ++N
Sbjct: 2   NLRTNIKEAQGLGSAKDGVSHWWLQRLTAVALVPLMLWLAFGLARHGGAGYEATVAWVAN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
                +  L   ++  H++LG+QV+IEDY+H    K   L       +LL    + ++L+
Sbjct: 62  PMTTVLWVLSLAALFWHIKLGLQVVIEDYVHDERAKFASLIAMKFITVLLAAIAILAVLR 121

Query: 124 IAIL 127
           +A+ 
Sbjct: 122 VALG 125


>gi|91974960|ref|YP_567619.1| succinate dehydrogenase, cytochrome b subunit [Rhodopseudomonas
           palustris BisB5]
 gi|91681416|gb|ABE37718.1| succinate dehydrogenase subunit D [Rhodopseudomonas palustris
           BisB5]
          Length = 140

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 66/124 (53%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            MR+ +G+VR +G A  GT  F +QR T +A     +  +   +            +L +
Sbjct: 16  SMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLTLPVVVVVMMLLGRNQAGAAQILGS 75

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             ++  M L  I+ ++HM++GMQV+IEDYI    LK++ +  N+ F + + +  +F++ K
Sbjct: 76  PLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNFFTIAVALAAIFAIFK 135

Query: 124 IAIL 127
           +A  
Sbjct: 136 LASG 139


>gi|182679665|ref|YP_001833811.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635548|gb|ACB96322.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 130

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 67/125 (53%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              MR++  RVR +G+A+ GT      R T++A +P  I F+   +      Y+ +V+ L
Sbjct: 5   SSSMRTAASRVRFLGAARSGTAETWHMRATSVALLPLSIAFVWIVLSLLGKNYQDVVATL 64

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +   A ++ L  ++   HM++GMQ II+DY+H    K   L  N  F   + + C++++
Sbjct: 65  GSPLPALLILLFVLASVYHMKIGMQSIIDDYVHEPHFKDWALLGNLFFSFCIGLACIYAV 124

Query: 122 LKIAI 126
           LK++ 
Sbjct: 125 LKLSF 129


>gi|148251846|ref|YP_001236431.1| succinate dehydrogenase subunit D [Bradyrhizobium sp. BTAi1]
 gi|146404019|gb|ABQ32525.1| succinate dehydrogenase subunit D [Bradyrhizobium sp. BTAi1]
          Length = 124

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 71/123 (57%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+ LGRVR +G+A  GT  F +QR TA+A    I+  +   I            +L ++
Sbjct: 1   MRTPLGRVRNLGAAHSGTSDFWRQRITAVAMTLLIVPVVVVVIMLLGRNQAGAAQILGSL 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            +A IM L  I+   HM++GMQV+IEDY+H   LK++ +  N+ F + + +  +++L+K+
Sbjct: 61  PIALIMLLFVIASCWHMKIGMQVVIEDYVHSEPLKLVAIMANNFFAVTVALASIYALIKL 120

Query: 125 AIL 127
           +  
Sbjct: 121 STG 123


>gi|285018595|ref|YP_003376306.1| succinate dehydrogenase membrane anchor subunit protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473813|emb|CBA16315.1| putative succinate dehydrogenase membrane anchor subunit protein
           [Xanthomonas albilineans]
          Length = 128

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 65/125 (52%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +   I+F+   +    A Y      ++  
Sbjct: 4   YRTPLKNVRGLGAAKSGTEHFVLQRLTATALVGLTIWFLTLVLSLLGADYVTATQAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    I++  H Q+G+QVI+EDY+H  LL +          +L  I  +F++ +I
Sbjct: 64  WNAVLLVGFLIAMFWHAQIGLQVILEDYVHNSLLALALQTTVKFIAVLGAIVGVFAVARI 123

Query: 125 AILGT 129
           A+   
Sbjct: 124 ALGSA 128


>gi|288957015|ref|YP_003447356.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azospirillum sp. B510]
 gi|288909323|dbj|BAI70812.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Azospirillum sp. B510]
          Length = 131

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 65/127 (51%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
              +RS L   RG+GSAK GT H+  QR TAIA +P  ++F+   I +  A +   V+ +
Sbjct: 5   SKTLRSPLQVARGLGSAKHGTEHWWSQRLTAIALVPLTVWFVFGVIGHLGADHAAFVAWM 64

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +   A +M L  +    H Q G+QV+IEDY++    K+  +         L   C+ ++
Sbjct: 65  KSPFSAVMMVLTAVVTFHHAQSGLQVVIEDYVNVEWQKMALIIGVKFLSFALAAACVLAV 124

Query: 122 LKIAILG 128
           +KI I  
Sbjct: 125 VKIFIGA 131


>gi|114769285|ref|ZP_01446911.1| probable succinate dehydrogenase membrane anchor subunit protein
           [alpha proteobacterium HTCC2255]
 gi|114550202|gb|EAU53083.1| probable succinate dehydrogenase membrane anchor subunit protein
           [alpha proteobacterium HTCC2255]
          Length = 126

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 63/125 (50%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
             R+   +V G+GSAK G  H+  +R  ++A IP  I F++         +  ++S   N
Sbjct: 2   TFRTDRAKVLGLGSAKSGADHWFGERLKSVALIPLTIIFVSIVAPLIGKDHTTVISSFQN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V+  + L  +    H++ G+QV+IEDY+H +   ++ +  N  F     +  +F++LK
Sbjct: 62  PFVSISLILFFLVSFKHLEEGLQVVIEDYVHSKGSLLLLIIFNKLFCWTFGLAAVFAILK 121

Query: 124 IAILG 128
           I   G
Sbjct: 122 ITFAG 126


>gi|88812337|ref|ZP_01127587.1| succinate dehydrogenase membrane anchor subunit [Nitrococcus
           mobilis Nb-231]
 gi|88790344|gb|EAR21461.1| succinate dehydrogenase membrane anchor subunit [Nitrococcus
           mobilis Nb-231]
          Length = 126

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 70/125 (56%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
             R+ L +  G+G++  GT  +  QR +++A +P +I+ I   +++G A Y    + LS+
Sbjct: 2   SFRTPLKQALGLGASHSGTSRWWAQRVSSVALVPLLIWLIIGIVRHGGADYTDAQAWLSS 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A +  L  ++   H  LGMQVI+EDY+ +  +++  + +     ++L +  +F++L 
Sbjct: 62  PITAVLTILTLVASFYHGALGMQVIVEDYVSHETVQLALVVLVKFAAMVLAVAGIFAVLL 121

Query: 124 IAILG 128
           +A+ G
Sbjct: 122 VALGG 126


>gi|87199762|ref|YP_497019.1| succinate dehydrogenase subunit D [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135443|gb|ABD26185.1| succinate dehydrogenase subunit D [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 127

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 66/123 (53%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +S+GRVRG+GS+ +GT H++  R TA+ N+  I F +       D  Y  +   ++    
Sbjct: 5   TSIGRVRGLGSSHEGTHHWLTARLTAVGNLVLITFLVVSLALLPDYSYATVRGWVARPVP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           +  + L  I+   H ++G+QV++EDY+H    KI    + +    +   F + S+L+IA+
Sbjct: 65  SIALILIMINTFTHARMGVQVMLEDYVHEEGGKIAAWLLVNIVPFVAAAFGILSVLRIAL 124

Query: 127 LGT 129
            G 
Sbjct: 125 GGA 127


>gi|53804138|ref|YP_114004.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylococcus capsulatus str. Bath]
 gi|53757899|gb|AAU92190.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Methylococcus capsulatus str. Bath]
          Length = 126

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 66/125 (52%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
            + R+ L R RG+GSA++G   + +QR TA+A +P  ++F         A + ++V+ ++
Sbjct: 2   KNYRTPLARARGLGSAREGLHDWWRQRVTAVALVPLGLWFAFSVALLPSASHAELVAWIN 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
                 ++    +    H  LG+QV+IEDY+H   LK++ +      V  L +  ++++L
Sbjct: 62  VPWNTLLLLSFILIAFYHTMLGLQVVIEDYVHLDWLKLVGILGVKLVVSFLTLAAVYAIL 121

Query: 123 KIAIL 127
           +I   
Sbjct: 122 RIVFT 126


>gi|146337398|ref|YP_001202446.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bradyrhizobium sp. ORS278]
 gi|146190204|emb|CAL74196.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bradyrhizobium sp. ORS278]
          Length = 124

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 72/123 (58%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+ LGRVR +G+A  GTG F +QR TA+A    I+  +   I            +L ++
Sbjct: 1   MRTPLGRVRNLGAAHSGTGDFWRQRITAVAMTLLIVPVVVVVIMLLGRNQAGAAQILGSL 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            +A IM L  ++   HM++GMQVIIEDY+H   LK++ +  N+ F + + I  +++L+K+
Sbjct: 61  PIALIMLLFVVASCWHMKIGMQVIIEDYVHTESLKLIAIMGNNFFAVTVAIASIYALIKL 120

Query: 125 AIL 127
           +  
Sbjct: 121 STG 123


>gi|162147200|ref|YP_001601661.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544253|ref|YP_002276482.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785777|emb|CAP55348.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531930|gb|ACI51867.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 140

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 68/123 (55%), Gaps = 1/123 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS L R RG+GSAK G  H+  +R +A+A +P   +F+   ++   +  E +V      
Sbjct: 12  MRSQLSRARGLGSAKTGVDHWWMERMSAVALVPLSGWFVLQVLRLAGSSQEDVVEWGGKP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             +S++    +    HMQLG+QVII+DY+H +    + L M      L+ +F + ++LK+
Sbjct: 72  VNSSMLLALMVLTFYHMQLGLQVIIDDYVHGKAHLPVSLLM-KGAAFLIGLFAVIAVLKL 130

Query: 125 AIL 127
           A+ 
Sbjct: 131 ALA 133


>gi|103488507|ref|YP_618068.1| succinate dehydrogenase, cytochrome b subunit [Sphingopyxis
           alaskensis RB2256]
 gi|98978584|gb|ABF54735.1| succinate dehydrogenase subunit D [Sphingopyxis alaskensis RB2256]
          Length = 134

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 74/121 (61%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + LGRVRG+GS+  G+ H+++QR TA+ NI  + F     ++   A +  ++   SN +V
Sbjct: 5   TRLGRVRGLGSSHHGSHHWLQQRLTALGNILLVSFLFVSLLRLPLADHGAVLRWASNPSV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L  IS+  H++LG+QV+IEDYIH    ++  L + + + +    + +F++++IA+
Sbjct: 65  ALALILMVISVFWHLRLGLQVMIEDYIHGEATRLFALVLLNFYAIGGAAYGIFAIVRIAL 124

Query: 127 L 127
            
Sbjct: 125 A 125


>gi|332188518|ref|ZP_08390238.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingomonas sp. S17]
 gi|332011423|gb|EGI53508.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingomonas sp. S17]
          Length = 127

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 70/123 (56%), Gaps = 1/123 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +++GRVRG+GSAK GT H++ QR TA +N   +++ +   ++     Y  +   L+N   
Sbjct: 5   TAIGRVRGLGSAKSGTHHWLNQRLTAGSNFLLVVWLLISILRQPSYDYAAMRLWLANPWA 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  M +   SI  HM+LG+QV+IEDY   +  ++  L + + FV  +    +FS+LKIA 
Sbjct: 65  AIPMVMLVASIFYHMRLGLQVVIEDYEQDQN-RVALLVVMNLFVFTIAAVAIFSILKIAF 123

Query: 127 LGT 129
              
Sbjct: 124 GAA 126


>gi|166712287|ref|ZP_02243494.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 128

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 68/123 (55%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++  
Sbjct: 4   YRTPLKNVRGLGAAKTGTEHFVMQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    I+   H QLGMQV++EDY+H  LL +    +     ++  I  +F++ +I
Sbjct: 64  WNAILLVAFLIASFWHAQLGMQVVLEDYVHDPLLALTAQTLVRFVAVVGAIVSVFAVARI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|307295106|ref|ZP_07574948.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingobium chlorophenolicum L-1]
 gi|306879580|gb|EFN10798.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sphingobium chlorophenolicum L-1]
          Length = 129

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 74/124 (59%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSA+ G  H++ QR+TAI N+  +++ +   I      Y+ +V  ++N  V
Sbjct: 5   TGIGRVRGLGSARHGAHHWLAQRYTAIGNLLLVLWLLFSLIALPGLDYQSVVGWIANPLV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L  +SI  H++LGMQV++EDY+H + L  + + + + +        +F++ KIA 
Sbjct: 65  AVPLMLMIVSIFWHLRLGMQVMLEDYVHDKGLAFLSMLLLNFYAFGGAAAGVFAIAKIAF 124

Query: 127 LGTL 130
            G +
Sbjct: 125 TGIV 128


>gi|190573777|ref|YP_001971622.1| putative succinate dehydrogenase hydrophobic membrane anchor
           subunit [Stenotrophomonas maltophilia K279a]
 gi|190011699|emb|CAQ45318.1| putative succinate dehydrogenase hydrophobic membrane anchor
           subunit [Stenotrophomonas maltophilia K279a]
          Length = 128

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 68/123 (55%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+GSAK GT HF+ QR TA A +   I+F+ F +    + Y    + ++  
Sbjct: 4   FRTPLKNVRGLGSAKTGTEHFVHQRLTAAALVVLGIWFLVFVLGLLGSDYATAAAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A  +    I++  H QLGMQV++EDYIH  LL ++         +L +I  +F++ +I
Sbjct: 64  WNAVPLIGLLIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAVGRI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|23014377|ref|ZP_00054197.1| COG2142: Succinate dehydrogenase, hydrophobic anchor subunit
           [Magnetospirillum magnetotacticum MS-1]
          Length = 127

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/124 (36%), Positives = 70/124 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           + S +GR RG+GSAK+G  H+I QR TAI  IP  ++F    I    A Y    + ++  
Sbjct: 4   LESPVGRARGLGSAKEGASHWIAQRVTAIFLIPLSLWFAVSVIGLSHADYATFKAWMAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             +S++ L  +++  H QLG+QV+IEDY+H    K+  L  +   +  L +F   S+LK+
Sbjct: 64  GNSSLLLLTVLTVLYHAQLGLQVVIEDYVHCECKKVAALVGSKLVIAFLAVFMTVSILKV 123

Query: 125 AILG 128
           AI  
Sbjct: 124 AIGA 127


>gi|58581932|ref|YP_200948.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84623844|ref|YP_451216.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|188576492|ref|YP_001913421.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|50313516|gb|AAT74620.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae]
 gi|58426526|gb|AAW75563.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84367784|dbj|BAE68942.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|188520944|gb|ACD58889.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 128

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 68/123 (55%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++  
Sbjct: 4   YRTPLKNVRGLGAAKTGTEHFVMQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    I+   H QLGMQV++EDY+H  LL +    +     ++  I  +F++ +I
Sbjct: 64  WNAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALTAQTLVRFVAVVGAIVSVFAVARI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|294011058|ref|YP_003544518.1| succinate dehydrogenase hydrophobic anchor subunit [Sphingobium
           japonicum UT26S]
 gi|292674388|dbj|BAI95906.1| succinate dehydrogenase hydrophobic anchor subunit [Sphingobium
           japonicum UT26S]
          Length = 129

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 74/124 (59%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSA+ G  H++ QR+TAI N+  +++ +   I      Y+ +V  ++N  V
Sbjct: 5   TGIGRVRGLGSARHGAHHWLAQRYTAIGNLLLVLWLLFSLIALPGLDYQSVVGWIANPLV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  + L  +SI  H++LGMQV++EDY+H + L  + + + + +        +F++ KIA 
Sbjct: 65  AVPLMLMIVSIFWHLRLGMQVMLEDYVHDKGLAFLSMLLLNFYAFGGAAAGVFAIAKIAF 124

Query: 127 LGTL 130
            G +
Sbjct: 125 TGIV 128


>gi|332285735|ref|YP_004417646.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Pusillimonas sp. T7-7]
 gi|330429688|gb|AEC21022.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Pusillimonas sp. T7-7]
          Length = 137

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 65/124 (52%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            +R+ L   R +GS+K G  H+  QR TAIA IP  I+ + F      A Y  +++ ++ 
Sbjct: 9   SLRTPLKVARRLGSSKSGVHHWWLQRLTAIALIPLSIWLLYFMGALMHASYPTVLAAIAQ 68

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A  + + ++ +  H  LG+QVIIEDY+H R L++          +L  + C+ ++L 
Sbjct: 69  PVHAIFLIVLSLCLFWHGALGLQVIIEDYVHTRWLEVALQIALRFGAILATLACVLAVLA 128

Query: 124 IAIL 127
           I + 
Sbjct: 129 IWLG 132


>gi|289669027|ref|ZP_06490102.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 128

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 69/125 (55%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
              R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++
Sbjct: 2   NRYRTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVA 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               A ++    I+   H QLGMQV++EDY+H  LL +M   +     +L  I  +F++ 
Sbjct: 62  KPWNAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALMAQTLVRFVAVLGAIVSVFAVA 121

Query: 123 KIAIL 127
           +IA+ 
Sbjct: 122 RIALG 126


>gi|330991157|ref|ZP_08315110.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Gluconacetobacter sp. SXCC-1]
 gi|329761743|gb|EGG78234.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Gluconacetobacter sp. SXCC-1]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 66/125 (52%), Gaps = 1/125 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS L R RG+GS + G GH+  +R +A+A +P   +F+    +   A   ++    +  
Sbjct: 12  MRSQLSRARGLGSGQAGVGHWWAERASAVALVPLSGWFVIQVFRLAGASQPEVAKWGARP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
              ++M    I    H QLG+QVII+DY+H +   +    +    V LL +F   S+LK+
Sbjct: 72  FNTTMMLSLVILTFYHTQLGLQVIIDDYVHGKAH-LPAGLLMKGIVFLLGLFGTVSVLKL 130

Query: 125 AILGT 129
           A+ G+
Sbjct: 131 ALAGS 135


>gi|254521173|ref|ZP_05133228.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas sp. SKA14]
 gi|219718764|gb|EED37289.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas sp. SKA14]
          Length = 128

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 68/123 (55%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+GSAK GT HF+ QR TA A +   I+F+ F +    + Y    + ++  
Sbjct: 4   FRTPLKSVRGLGSAKTGTEHFVHQRLTAAALVVLGIWFLVFVLSLLGSDYATAAAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A  +    I++  H QLGMQV++EDYIH  LL ++         +L +I  +F++ +I
Sbjct: 64  WNAVPLIGLLIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAVGRI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|325917572|ref|ZP_08179772.1| succinate dehydrogenase subunit D [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536206|gb|EGD08002.1| succinate dehydrogenase subunit D [Xanthomonas vesicatoria ATCC
           35937]
          Length = 128

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 68/123 (55%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++  
Sbjct: 4   YRTPLKNVRGLGAAKTGTEHFVVQRLTATALVPLSIWFLIFVLSLIGADHAAASAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    I+   H QLGMQV++EDY+H  LL +    +     +L  I  +F++ +I
Sbjct: 64  WNAILLVGFLIASFWHAQLGMQVVLEDYVHNSLLALAAQTIVRFVAVLGAIVSVFAVARI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|78047798|ref|YP_363973.1| putative succinate dehydrogenase membrane anchor subunit
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325928376|ref|ZP_08189571.1| succinate dehydrogenase subunit D [Xanthomonas perforans 91-118]
 gi|78036228|emb|CAJ23919.1| putative succinate dehydrogenase membrane anchor subunit
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325541252|gb|EGD12799.1| succinate dehydrogenase subunit D [Xanthomonas perforans 91-118]
          Length = 128

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 69/123 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++  
Sbjct: 4   YRTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLIGADHAAATAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    I+   H QLGMQV++EDY+H  LL ++   +     +L  I  +F++ +I
Sbjct: 64  WNAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALIAQTLVRFVAVLGAIVSVFAVARI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|21242815|ref|NP_642397.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|21108301|gb|AAM36933.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|50981402|gb|AAT91479.1| succinate dehydrogenase subunit D [Xanthomonas citri]
          Length = 128

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 69/123 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++  
Sbjct: 4   YRTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLVFVLSLIGADHAAASAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    I+   H QLGMQV++EDY+H  LL ++   +     +L  I  +F++ +I
Sbjct: 64  WNAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALIAQTLVRFVAVLGAIVSVFAVARI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|289665884|ref|ZP_06487465.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 128

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 68/125 (54%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
              R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++
Sbjct: 2   NRYRTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAVA 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               A ++    I    H QLGMQV++EDY+H  LL +M   +     +L  I  +F++ 
Sbjct: 62  KPWNAILLVAFLIVSFWHAQLGMQVVLEDYVHDSLLALMAQTLVRFVAVLGAIVSVFAVA 121

Query: 123 KIAIL 127
           +IA+ 
Sbjct: 122 RIALG 126


>gi|307822159|ref|ZP_07652391.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacter tundripaludum SV96]
 gi|307736725|gb|EFO07570.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacter tundripaludum SV96]
          Length = 126

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 67/121 (55%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           D R+ L RV+G+GSAKDGT H+  QR TA+A IP   + I F      APY+Q V  L++
Sbjct: 2   DYRTPLSRVKGLGSAKDGTTHWWMQRVTAVALIPLSFWLIYFLGLSLTAPYQQTVVWLTS 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
                 +    I+   H  LG+QV+IEDY+     KI+ ++  +   L L I  L ++ +
Sbjct: 62  PVNTVCIVAWIIAAFYHAALGLQVVIEDYVAAEGPKIISIWAVNLAFLFLAIAALLAVFR 121

Query: 124 I 124
           I
Sbjct: 122 I 122


>gi|294624874|ref|ZP_06703531.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|294665037|ref|ZP_06730344.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292600833|gb|EFF44913.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292605194|gb|EFF48538.1| succinate dehydrogenase membrane anchor subunit [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 128

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 69/123 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+G+AK GT HF+ QR TA A +P  I+F+ F +    A +    + ++  
Sbjct: 4   YRTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLIGADHAAASAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    ++   H QLGMQV++EDY+H  LL ++   +     +L  I  +F++ +I
Sbjct: 64  WNAILLVAFLVASFWHAQLGMQVVLEDYVHDSLLALIAQTLVRFVAVLGAIVSVFAVARI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|329114747|ref|ZP_08243504.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Acetobacter pomorum DM001]
 gi|326695878|gb|EGE47562.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Acetobacter pomorum DM001]
          Length = 137

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 67/125 (53%), Gaps = 1/125 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS LGR RG+G+   G GH+  +R TA + +P   +F+    + G A + ++V      
Sbjct: 11  MRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADHAEVVKWGGKP 70

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A+++    I+   H QLG+QVI++DY+H +   +    +      LL +  + +++K+
Sbjct: 71  VNATMLIALIITTFYHAQLGLQVIVDDYVHGKAH-LPARLLVKIGTSLLGLLGVIAVIKL 129

Query: 125 AILGT 129
            + G+
Sbjct: 130 FVRGS 134


>gi|83313050|ref|YP_423314.1| succinate dehydrogenase, hydrophobic anchor subunit
           [Magnetospirillum magneticum AMB-1]
 gi|82947891|dbj|BAE52755.1| Succinate dehydrogenase, hydrophobic anchor subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 126

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/125 (36%), Positives = 70/125 (56%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            + S +GR RG+GSAK+G GH+I QR TAI  IP  ++F    I    A Y    + ++ 
Sbjct: 2   SLESPVGRARGLGSAKEGAGHWIAQRVTAIFLIPLSLWFAVSVIGLSHADYATFKAWMAK 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              +S++ L  +++  H QLG+QV+IEDY+     KI  L  +   +  L +F   S+LK
Sbjct: 62  PGNSSLLLLTVLTVLYHAQLGLQVVIEDYVSCECKKIAALVGSKLIIAFLAVFMTVSILK 121

Query: 124 IAILG 128
           +AI  
Sbjct: 122 VAIGA 126


>gi|15837673|ref|NP_298361.1| succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
 gi|9106018|gb|AAF83881.1|AE003943_12 succinate dehydrogenase, membrane anchor subunit [Xylella
           fastidiosa 9a5c]
          Length = 127

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 69/123 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L   RG+G+AK GTGHF+ QR TAIA +   ++F+AF +      Y   V+ ++  
Sbjct: 4   YRTPLKNARGLGAAKAGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    ++   H QLG+QV++EDYIH   L +    M     +L  +  +F++++I
Sbjct: 64  WNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALALQTMVKFIAVLGAVASVFAVVRI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|194365314|ref|YP_002027924.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas maltophilia R551-3]
 gi|194348118|gb|ACF51241.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Stenotrophomonas maltophilia R551-3]
          Length = 128

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 68/123 (55%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L  VRG+GSAK GT HF+ QR TA A +   I+F+ F +    + Y    + ++  
Sbjct: 4   FRTPLKGVRGLGSAKTGTEHFVHQRLTAAALVALGIWFLVFVLGLLGSDYATAAAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A  +    I++  H QLGMQV++EDYIH  LL ++         +L +I  +F++ +I
Sbjct: 64  WNAVPLIGLLIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAVGRI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|121996855|ref|YP_001001642.1| succinate dehydrogenase, cytochrome b subunit [Halorhodospira
           halophila SL1]
 gi|121588260|gb|ABM60840.1| succinate dehydrogenase subunit D [Halorhodospira halophila SL1]
          Length = 127

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 64/124 (51%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
             +++ R RG+GSAK+G  H+  QR TA+  +P +++          A +E   + ++N 
Sbjct: 4   YETAVSRARGLGSAKNGFHHWWHQRLTALVLVPLMMWLGIGLALQAGADFEAARAWVANP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A+++    I +  H  LG+QV+IEDY+H   LK            L+ +  + ++++I
Sbjct: 64  FNATLLIAAIIMLFYHGALGVQVVIEDYVHLEGLKWFGNLAVYFACFLVAVAGILAVIQI 123

Query: 125 AILG 128
            + G
Sbjct: 124 VLGG 127


>gi|85708848|ref|ZP_01039914.1| hypothetical protein NAP1_06395 [Erythrobacter sp. NAP1]
 gi|85690382|gb|EAQ30385.1| hypothetical protein NAP1_06395 [Erythrobacter sp. NAP1]
          Length = 128

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 65/123 (52%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +S+G+VRG+GS+  G  H++  R TAI N+  + + I  F+   D  Y+ +   LS    
Sbjct: 5   TSIGKVRGLGSSHHGAHHWLAARTTAIGNLVLMTWLILSFVLLPDFSYQSVSGWLSQPIA 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A  M L  IS+  H +LG+QV+IEDYIH    K   L   +        F +FS+  +A+
Sbjct: 65  AVPMILLIISVFYHARLGLQVVIEDYIHEPGSKFALLSALNLAAFGGGAFAIFSVASLAL 124

Query: 127 LGT 129
            G 
Sbjct: 125 TGA 127


>gi|83944806|ref|ZP_00957172.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Oceanicaulis alexandrii HTCC2633]
 gi|83851588|gb|EAP89443.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Oceanicaulis alexandrii HTCC2633]
          Length = 125

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 66/122 (54%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           D R+ L + RG+GSAK G GHFI QR +A+A +  +  F+        A Y    + + +
Sbjct: 3   DFRTPLAKARGLGSAKSGVGHFIAQRVSALALVILVPLFVWAVASLPGADYASAYAFVGS 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A +  L   +   HM+LG+QV+IEDYIH  + K + L  N+     L +  L+++L 
Sbjct: 63  PYGAILTLLTLTAALYHMRLGLQVVIEDYIHKPMSKALLLIANTLICAGLWVAALYAVLA 122

Query: 124 IA 125
           IA
Sbjct: 123 IA 124


>gi|258541136|ref|YP_003186569.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632214|dbj|BAH98189.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635271|dbj|BAI01240.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638326|dbj|BAI04288.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641380|dbj|BAI07335.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644435|dbj|BAI10383.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647490|dbj|BAI13431.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650543|dbj|BAI16477.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653534|dbj|BAI19461.1| succinate dehydrogenase membrane anchor subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 137

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 67/125 (53%), Gaps = 1/125 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS LGR RG+G+   G GH+  +R TA + +P   +F+    + G A + ++V      
Sbjct: 11  MRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADHTEVVKWGGKP 70

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A+++    I+   H QLG+QVI++DY+H +   +    +      LL +  + +++K+
Sbjct: 71  VNATMLIALIITTFYHAQLGLQVIVDDYVHGKAH-LPTRLLVKIGTSLLGLLGVIAVIKL 129

Query: 125 AILGT 129
            + G+
Sbjct: 130 FVRGS 134


>gi|71275602|ref|ZP_00651887.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Dixon]
 gi|71899419|ref|ZP_00681578.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|71899499|ref|ZP_00681656.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|170729590|ref|YP_001775023.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa M12]
 gi|71163493|gb|EAO13210.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Dixon]
 gi|71730719|gb|EAO32793.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|71730828|gb|EAO32900.1| Succinate dehydrogenase, cytochrome b subunit [Xylella fastidiosa
           Ann-1]
 gi|167964383|gb|ACA11393.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa M12]
          Length = 127

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 69/123 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L   RG+G+AK GTGHF+ QR TAIA +   ++F+AF +      Y   V+ ++  
Sbjct: 4   YRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    ++   H QLG+QV++EDYIH   L +    M     +L  +  +F++++I
Sbjct: 64  WNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALALQTMVRFIAVLGAVASVFAVVRI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|28198268|ref|NP_778582.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa Temecula1]
 gi|182680905|ref|YP_001829065.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xylella fastidiosa M23]
 gi|28056338|gb|AAO28231.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Xylella fastidiosa Temecula1]
 gi|182631015|gb|ACB91791.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Xylella fastidiosa M23]
 gi|307579373|gb|ADN63342.1| succinate dehydrogenase membrane anchor subunit [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 127

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 69/123 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L   RG+G+AK GTGHF+ QR TAIA +   ++F+AF +      Y   V+ ++  
Sbjct: 4   YRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAVAKP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++    ++   H QLG+QV++EDYIH   L +    M     +L  +  +F++++I
Sbjct: 64  WNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALTLQTMVRFIAVLGAVASVFAVVRI 123

Query: 125 AIL 127
           A+ 
Sbjct: 124 ALG 126


>gi|83953491|ref|ZP_00962213.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83842459|gb|EAP81627.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 123

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G+GSAK GT HF   + +++A +  I  F+  F       YE+I++  S    
Sbjct: 5   TDRKRAMGLGSAKSGTAHFWAMKVSSVALLILIPLFVFTFGSALGGTYEEIIAYYSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  I    H   G+QV+IEDY+H    K+  + M +C         +F++ +IA+
Sbjct: 65  AIVAALTLIVGFKHFNDGVQVLIEDYVHGLSQKVAIILM-TCLSYGAAAVGVFAIARIAL 123


>gi|260431520|ref|ZP_05785491.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415348|gb|EEX08607.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 123

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G+GSAK GT HF   + +++A +  +  F+  F      PY+ ++   S    
Sbjct: 5   TDRKRALGLGSAKSGTQHFWAMKVSSVALLILVPLFVFTFGPTLGQPYDVMLDYYSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L       H   G QV+IEDY+H  L K+  + + +C         +F++ +IA+
Sbjct: 65  AIVAALTLAVGFKHFADGAQVMIEDYVHGTLEKV-LIILVTCLSYGAAAVGIFAIARIAL 123


>gi|319777840|ref|YP_004134270.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317171559|gb|ADV15096.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 129

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 71/124 (57%)

Query: 3   FDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLS 62
             +R+ L RVRG+GSAK GT  F+ +R T+ A +  +I+ +A  I+    P + ++ V+ 
Sbjct: 5   RSIRTPLARVRGLGSAKHGTETFMLERLTSAALLILVIYIVAVVIRLSGEPRDVVIRVVG 64

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           ++ VA  +    +   VHM+LGMQ IIEDY H  +LK + L  N  F   + +   F++L
Sbjct: 65  SIYVAPALIAFILVNCVHMRLGMQSIIEDYCHATVLKSVLLIANWLFCWAVALASFFAVL 124

Query: 123 KIAI 126
            I+ 
Sbjct: 125 VISF 128


>gi|85374259|ref|YP_458321.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erythrobacter litoralis HTCC2594]
 gi|84787342|gb|ABC63524.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erythrobacter litoralis HTCC2594]
          Length = 128

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 75/122 (61%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +SLGRVRG+GSAK+G  H+I QRFTAI N+  +++ +A FI   +  Y+ +   L++   
Sbjct: 5   TSLGRVRGLGSAKEGAHHWIVQRFTAIGNVVLMLWLVASFILLPNLSYDTVSGWLASPIP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A+ M L  +S+  H +LG+ V+IEDY+H   LK   L   +   +   +F +F + ++A+
Sbjct: 65  AAAMVLLIVSVFWHARLGLTVLIEDYVHEAGLKFAALAALNLAAVAGGVFGIFCIARLAL 124

Query: 127 LG 128
            G
Sbjct: 125 GG 126


>gi|83943850|ref|ZP_00956307.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. EE-36]
 gi|83845097|gb|EAP82977.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sulfitobacter sp. EE-36]
          Length = 123

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT HF   + +++A +  I  F+  F       YE+I++  S    
Sbjct: 5   TDRKRAMGMGSAKSGTAHFWAMKVSSVALLILIPLFVFTFGAALGGTYEEIIAYYSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  I    H   G+QV+IEDY+H    K+  + M +C         +F++ +IA+
Sbjct: 65  AIVAALTLIVGFKHFNDGVQVLIEDYVHGLSQKVAIILM-TCLSYGAAAVGVFAIARIAL 123


>gi|312112887|ref|YP_004010483.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311218016|gb|ADP69384.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 130

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 73/128 (57%), Gaps = 3/128 (2%)

Query: 2   DFDMRSSLGRVRGMGSA--KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVS 59
               R+ L +VRG+GSA    GT HF  QR TA++N+  + F +   +    AP   + +
Sbjct: 3   STTYRTELKKVRGLGSAIGGPGTDHFWAQRLTAVSNLFVVAFLVYTGLTLAGAPLGDVKA 62

Query: 60  VLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
              +   A    L  IS ++HM+LGMQV +E+Y+    LK+ FLF+N+ FV+++ +  + 
Sbjct: 63  FFGHPFNAIASILVVISTAIHMRLGMQVPVEEYMP-HGLKVPFLFLNTFFVIVIAVVGVL 121

Query: 120 SLLKIAIL 127
           S+LK+ + 
Sbjct: 122 SILKLFLG 129


>gi|217979668|ref|YP_002363815.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylocella silvestris BL2]
 gi|217505044|gb|ACK52453.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylocella silvestris BL2]
          Length = 129

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 2/128 (1%)

Query: 1   MDFDMRSSLGRVRG--MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIV 58
           M  D  SS   VR   +GSAK G         T++A +P  I F+   +      Y  + 
Sbjct: 1   MAHDKSSSRSPVRKGFLGSAKSGASDAWSMHVTSVALLPLAIGFVWVMLSLMHKDYAGVK 60

Query: 59  SVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + L +   A ++ L  ++   HM+LGMQ II+DYIH    K   L  N CF   + +  +
Sbjct: 61  AELGHPLPAIVLLLFILAGCWHMKLGMQSIIDDYIHAPHAKEWALVGNFCFSAAIALASV 120

Query: 119 FSLLKIAI 126
           F+++K+ +
Sbjct: 121 FAVVKLGL 128


>gi|84515884|ref|ZP_01003245.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Loktanella vestfoldensis SKA53]
 gi|84510326|gb|EAQ06782.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Loktanella vestfoldensis SKA53]
          Length = 123

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 60/120 (50%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT H  +   T++A +  I  F+  F     APY ++++       
Sbjct: 5   TDRKRAVGMGSAKSGTHHHWQMMVTSVALLVLIPLFVFTFGTILGAPYAEVIAYYQRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  +    H +LG+Q +IEDY+H    K   +FM  C       F +F++++IA+
Sbjct: 65  AVVAILTMLVGFFHFRLGVQTVIEDYVHGFARKAAIIFM-ICLSYAAAGFAVFAIIRIAL 123


>gi|254463366|ref|ZP_05076782.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium HTCC2083]
 gi|206679955|gb|EDZ44442.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 123

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 60/120 (50%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT HF   + +++A +  +  FI  F     + Y ++++       
Sbjct: 5   TDRKRATGMGSAKSGTHHFWSMKVSSVALLFLLPMFIFTFGGTLGSNYAEVMTYFGRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L T+    H   G QV+IEDY+H  + K++ + + +C         +F++ K+A+
Sbjct: 65  AIVAALTTLVGFKHFNDGAQVLIEDYVHGLMQKVLIILL-TCLSYGAAAVGIFAIAKLAL 123


>gi|144898838|emb|CAM75702.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 127

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 61/125 (48%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            +RS +GR RG+GSAK G GH      +A+  IP  ++F+    +   A +    + ++ 
Sbjct: 3   TLRSPIGRARGLGSAKSGMGHHWSTIVSAVGLIPLSLWFVVSIARLAGADHAVFTAWIAK 62

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              A+++ L       H  LG+ ++IEDY+  +  K   L        LL +    S+LK
Sbjct: 63  GPNAALLILTIGLTCYHASLGLSMVIEDYVTCKAKKFAALLATRLIAALLAVGMSVSILK 122

Query: 124 IAILG 128
           +AI G
Sbjct: 123 VAIGG 127


>gi|254448797|ref|ZP_05062254.1| succinate dehydrogenase, hydrophobic membrane anchor protein [gamma
           proteobacterium HTCC5015]
 gi|198261638|gb|EDY85926.1| succinate dehydrogenase, hydrophobic membrane anchor protein [gamma
           proteobacterium HTCC5015]
          Length = 120

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 65/120 (54%)

Query: 9   LGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVAS 68
           + +  G+GSAKDGT HF+ QR T IA +P +++        G A    +   ++N   A+
Sbjct: 1   MSKAYGLGSAKDGTHHFMIQRLTGIALVPLMLWLTFSIACLGGADLASVRDFIANPLNAT 60

Query: 69  IMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILG 128
           ++   T+S+  H  LGMQV++EDY+    L++    + +     L +  + ++LK+A+  
Sbjct: 61  LLICLTVSVFYHSSLGMQVVLEDYLRPHWLRLTVQILINFANFALAVVSILAILKLAVAA 120


>gi|16127758|ref|NP_422322.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter crescentus CB15]
 gi|13425260|gb|AAK25490.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Caulobacter crescentus CB15]
          Length = 139

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 66/123 (53%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L R RGMG+++ G  HFI +R + +A  P  ++     +K   AP++ +V  ++  
Sbjct: 12  FRTPLSRARGMGASRHGVSHFITERVSGLALAPLTVWGAYAALKQVRAPHDVVVQWMAQP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++ L  I+  VH+Q  +QV+IEDYI     K   +  N    +L     +FS+LK+
Sbjct: 72  VNAVLLSLLLIAALVHLQSAVQVVIEDYIERFTTKTALVIGNLFVCVLAGAVGVFSILKV 131

Query: 125 AIL 127
           A+ 
Sbjct: 132 ALT 134


>gi|221236579|ref|YP_002519016.1| succinate dehydrogenase membrane anchor subunit [Caulobacter
           crescentus NA1000]
 gi|220965752|gb|ACL97108.1| succinate dehydrogenase membrane anchor subunit [Caulobacter
           crescentus NA1000]
          Length = 151

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 66/123 (53%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L R RGMG+++ G  HFI +R + +A  P  ++     +K   AP++ +V  ++  
Sbjct: 24  FRTPLSRARGMGASRHGVSHFITERVSGLALAPLTVWGAYAALKQVRAPHDVVVQWMAQP 83

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++ L  I+  VH+Q  +QV+IEDYI     K   +  N    +L     +FS+LK+
Sbjct: 84  VNAVLLSLLLIAALVHLQSAVQVVIEDYIERFTTKTALVIGNLFVCVLAGAVGVFSILKV 143

Query: 125 AIL 127
           A+ 
Sbjct: 144 ALT 146


>gi|326387616|ref|ZP_08209222.1| succinate dehydrogenase subunit D [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207662|gb|EGD58473.1| succinate dehydrogenase subunit D [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 118

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 58/117 (49%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           RG+GS+  G  H++  R TA+ N+  I + I       D  +  + S L+    A+ + L
Sbjct: 2   RGLGSSHQGAHHWLLTRLTAVGNLILIPYLIVSLALLPDFEWATVHSWLAKPVPATALIL 61

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGT 129
             I+   H +LG+QV++EDY+H    KI    + +        F + S+++IA+   
Sbjct: 62  TFINTFYHARLGIQVMLEDYVHEEAGKIAAWLLVNIVPFAAGAFGVVSVIRIALGAA 118


>gi|83592539|ref|YP_426291.1| succinate dehydrogenase subunit D [Rhodospirillum rubrum ATCC
           11170]
 gi|83575453|gb|ABC22004.1| succinate dehydrogenase subunit D [Rhodospirillum rubrum ATCC
           11170]
          Length = 128

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/127 (33%), Positives = 65/127 (51%), Gaps = 2/127 (1%)

Query: 4   DMRSSLGRVRGMGSAKDGTG-HFIKQRFTAIANIPFIIFFIA-FFIKYGDAPYEQIVSVL 61
            +RS LGR RG+GSAK G   H++ +R  AIA +P  ++F+    I    A Y QI + +
Sbjct: 2   SLRSPLGRARGLGSAKAGAANHWMAERLPAIALVPLALWFVFVAIISNLGASYAQIQAFM 61

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +    A++M L       H  LG+ VIIEDY+    +K   +F    + L   +    S+
Sbjct: 62  AVPLNATLMLLTVFCAFFHGALGLIVIIEDYVQNHAVKNALVFGTKLYALFGAVLAAVSI 121

Query: 122 LKIAILG 128
           LK+   G
Sbjct: 122 LKLTFGG 128


>gi|295687607|ref|YP_003591300.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Caulobacter segnis ATCC 21756]
 gi|295429510|gb|ADG08682.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter segnis ATCC 21756]
          Length = 139

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 63/123 (51%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ L R RG+GS+  G  HFI +R + +A  P  ++ +   +K   A    + + L + 
Sbjct: 12  FRTPLSRARGLGSSHHGVSHFITERVSGLALAPLSLWGVYSALKLIGADQHTVAAWLGHP 71

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A ++ L  +S  VH+   +QV+IEDY+H    K   +  N    +L     +FS+LK+
Sbjct: 72  LNAVLLLLLLLSALVHLSNAVQVVIEDYVHRFTSKSALVIGNLFVCVLAGAIGIFSILKV 131

Query: 125 AIL 127
           A+ 
Sbjct: 132 ALT 134


>gi|254486788|ref|ZP_05099993.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseobacter sp. GAI101]
 gi|214043657|gb|EEB84295.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseobacter sp. GAI101]
          Length = 123

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT HF   + +++A +  I  F+  F       YE+I++  +    
Sbjct: 5   TDRKRAVGMGSAKSGTAHFWAMKVSSVALLILIPLFVFTFGAALGGTYEEILAYYAKPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A I  L       H   G+QV+IEDY+H    K+  + M +C         +F+++++A+
Sbjct: 65  ALIAALTIAVGFKHFNDGVQVLIEDYVHGLSQKVAIILM-TCLSYGAAAAGVFAIIRLAL 123


>gi|84684218|ref|ZP_01012120.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667971|gb|EAQ14439.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 125

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 66/124 (53%), Gaps = 1/124 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            ++   RV G+GSAK GTGHF +QR +AIA +  +  F+  F       YE + +  ++ 
Sbjct: 3   YQTDRARVEGLGSAKQGTGHFWEQRISAIALLFLVPLFVFPFAYNLGDGYEAVRAAYAHP 62

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A I     ++  +H+  G+QV++EDY+H R   ++ +        L  +  ++++++I
Sbjct: 63  VNAIIAIAFFLTAFLHLFQGVQVVVEDYVHGRAG-MVIIIATRLLCTLFALVGVYAVIRI 121

Query: 125 AILG 128
           ++  
Sbjct: 122 SLGA 125


>gi|56695274|ref|YP_165622.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria pomeroyi DSS-3]
 gi|56677011|gb|AAV93677.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria pomeroyi DSS-3]
          Length = 123

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 57/120 (47%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT HF   + +++A +  I  F+  F      P++ ++   S    
Sbjct: 5   TDRKRAVGMGSAKTGTAHFWAMKVSSVALLILIPLFVFTFGPMLGEPHQAVLDYFSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  +    H   G QV+IEDY+H  + KI  + +  C         LF++ +IA+
Sbjct: 65  AIVAALTLVVGFKHFADGAQVLIEDYVHGLMQKI-LIILVICLSYAAAATGLFAIARIAL 123


>gi|91205982|ref|YP_538337.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii RML369-C]
 gi|157826654|ref|YP_001495718.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii OSU 85-389]
 gi|122425295|sp|Q1RHB6|DHSD_RICBR RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|91069526|gb|ABE05248.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii RML369-C]
 gi|157801958|gb|ABV78681.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia bellii OSU 85-389]
          Length = 125

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 60/122 (49%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D R+ + + +  GSAK G+ H++ QR TAI  +   ++ + F +   ++    I+  
Sbjct: 1   MTYDFRAEIVKAKNTGSAKSGSHHWLLQRITAIILVLCSLWLLYFTLANKNSDVNIIIWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +  I+   H  LGMQV+IEDYI    L+   +     F +L I+  + +
Sbjct: 61  LKRPINLIPLLIAVITSLYHAMLGMQVVIEDYISCNKLRNTLIIAVKLFSILTIVAFIVA 120

Query: 121 LL 122
           + 
Sbjct: 121 VF 122


>gi|163744266|ref|ZP_02151626.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanibulbus indolifex HEL-45]
 gi|161381084|gb|EDQ05493.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanibulbus indolifex HEL-45]
          Length = 120

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G+GSAK GT HF   + +++A +  I  F+  F       YE+I++  +    
Sbjct: 2   TDRKRALGLGSAKTGTAHFWAMKVSSLALLVLIPLFVFTFGSALGGTYEEILAYYARPFP 61

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  I    H   G+QV+IEDY+H    KI  + M +          +F++ K+A+
Sbjct: 62  AIVAALTLIVGFKHFNDGVQVLIEDYVHGLANKIAIIVM-TIISYGAAAVGVFAIAKLAL 120


>gi|114799518|ref|YP_761917.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomonas neptunium ATCC 15444]
 gi|114739692|gb|ABI77817.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hyphomonas neptunium ATCC 15444]
          Length = 129

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 63/118 (53%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +     RG+GSAK GT H I+ R TAIA    + + +   IK   A YE  ++ +     
Sbjct: 8   TPTKAARGLGSAKSGTQHHIRLRVTAIALAFLVPWCLYAVIKASGAGYEGALAWVGQPIN 67

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           A+++ L   ++S HM+LGMQVIIEDYI     +   L +N+     + I    ++++I
Sbjct: 68  ATLLILTAAAVSYHMRLGMQVIIEDYIAKTATRTTLLILNTFAAYAMFIAVAMAVVQI 125


>gi|209967179|ref|YP_002300094.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Rhodospirillum centenum SW]
 gi|209960645|gb|ACJ01282.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Rhodospirillum centenum SW]
          Length = 132

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 69/126 (54%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
           D   R+ LGRVRG+GSA+ G+ H+   R  A AN+P +++ +   I    A + ++V+ L
Sbjct: 7   DAGFRTPLGRVRGLGSARSGSAHWFGYRMLAAANVPLLLWLLVSLIPLAGAGHAEVVAFL 66

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
                A +M L   +I  H   GM  ++EDY+  +L+K +   +     LLL +   F++
Sbjct: 67  QRPLNAVLMLLTIGAIFYHAAYGMMEVLEDYVQAKLVKTLAAALIKGGCLLLAVASAFAV 126

Query: 122 LKIAIL 127
           LKIA+ 
Sbjct: 127 LKIALA 132


>gi|296285023|ref|ZP_06863021.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Citromicrobium bathyomarinum JL354]
          Length = 128

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 69/123 (56%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +S+GRVRG+GSA +G  H++ QRFTAI N+  ++F +  F+      Y  +   LS+   
Sbjct: 5   TSIGRVRGLGSAHEGAHHWLLQRFTAIGNLVLVLFLLVSFLLLPAYDYGTVTGWLSSPIA 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A+ + L  +S   H +LG+QV+IEDYIH    +   + + +   +   +F +F +  IA 
Sbjct: 65  AAALILLIVSTFWHARLGLQVLIEDYIHQGGSRFALIALLNLVAVAGAVFGIFCIASIAF 124

Query: 127 LGT 129
            G 
Sbjct: 125 AGA 127


>gi|163734149|ref|ZP_02141590.1| succinate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161392685|gb|EDQ17013.1| succinate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 123

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G+GSAK GT H      ++ A +  I  F+  F     A YE++ +  +    
Sbjct: 5   TDRKRAVGLGSAKSGTEHHWSMTVSSGALLILIPLFVFTFGPMLGASYEEVTAYFARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A I GL  I    H   G+Q ++EDY+H    K+  +   +C     + F L++++++A+
Sbjct: 65  AVIAGLTIIVTFKHFAGGVQALLEDYVHGVAQKVA-IVAMTCVSYAAMGFGLYAIVRLAL 123


>gi|241518523|ref|YP_002979151.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862936|gb|ACS60600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 127

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 70/125 (56%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           M + LGRVRG+GSAK GT  ++ ++ + +A      + I   I       + +V+ + + 
Sbjct: 1   MTTPLGRVRGLGSAKGGTRPYVLKQASGLALGILTPYLIGIGIYLLGRDRDFVVASIGSF 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            +   +    +  +VHM +GM+ IIEDY+H  + K++ LF+NS F  L+ + C+F++L++
Sbjct: 61  WIGPALLAFILLSAVHMDIGMRTIIEDYVHGHMRKLVILFLNSAFTWLVCLLCVFAILRM 120

Query: 125 AILGT 129
                
Sbjct: 121 MFDAA 125


>gi|159045406|ref|YP_001534200.1| hypothetical protein Dshi_2866 [Dinoroseobacter shibae DFL 12]
 gi|157913166|gb|ABV94599.1| hypothetical protein Dshi_2866 [Dinoroseobacter shibae DFL 12]
          Length = 123

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
             +   R  G+GSAK GT H    + +++  +  +  F+  F +   APYE++++ L+  
Sbjct: 3   FMTDRKRAMGLGSAKSGTEHHWHMQVSSVGLLILVPLFLFTFGRVVGAPYEEVIAYLARP 62

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A +  L  +    H + G+ V IEDY      K   +   +C     +   LF++ ++
Sbjct: 63  FPAIVTALMLVVGFDHFRHGVTVAIEDYAQGTTRK-ALIIAMTCVSYGAMATGLFAIARL 121

Query: 125 AI 126
           A+
Sbjct: 122 AL 123


>gi|110678933|ref|YP_681940.1| hypothetical protein RD1_1627 [Roseobacter denitrificans OCh 114]
 gi|109455049|gb|ABG31254.1| suc [Roseobacter denitrificans OCh 114]
          Length = 123

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 58/120 (48%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G+GSAK GT H      ++ A +  I  F+  F     A Y+++ +  +    
Sbjct: 5   TDRKRAVGLGSAKSGTEHHWSMTVSSGALLILIPLFVFTFGPMLGASYDEVTAYFARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A I GL  I    H   G+Q ++EDY+H    K+  +   +C     + F L++++++A+
Sbjct: 65  AVIAGLTIIVTFKHFAGGVQALLEDYVHGVAQKVA-IVAMTCVSYAAMGFGLYAVVRLAL 123


>gi|94496885|ref|ZP_01303459.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Sphingomonas sp. SKA58]
 gi|94423561|gb|EAT08588.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Sphingomonas sp. SKA58]
          Length = 129

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 68/103 (66%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           + +GRVRG+GSAK+G  H++ QR+TA+ N+  +++ +   I      Y+ +V+ ++N  V
Sbjct: 5   TGIGRVRGLGSAKEGAHHWLTQRYTAVGNLLLVLWLLFSLISLPGLDYDSVVAWIANPLV 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCF 109
           A  M L  +SI +H++LGMQV++EDY+H + L  + + + + +
Sbjct: 65  AVPMMLMLVSIFLHLRLGMQVMLEDYVHDKGLNFLCILLLNFY 107


>gi|6649875|gb|AAF21610.1|AF018287_4 SdhD [papaya bunchy top disease rickettsia]
          Length = 125

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 60/122 (49%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D R+ + + +  GSAK G+ H++ QR TAI      ++ I F +   ++    I+  
Sbjct: 1   MTYDFRAEILKAKNTGSAKSGSHHWLLQRITAIILALCSVWLIYFTLANKNSDVNIIIWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +  I+   H  LGMQV+IEDYI    L+   + +   F +L I+  + +
Sbjct: 61  LKRPINLVPLLIAVITSLYHAMLGMQVVIEDYIGCNKLRNTLVIVVKLFSILTIVAFIVA 120

Query: 121 LL 122
           + 
Sbjct: 121 VF 122


>gi|114571386|ref|YP_758066.1| succinate dehydrogenase subunit D [Maricaulis maris MCS10]
 gi|114341848|gb|ABI67128.1| succinate dehydrogenase subunit D [Maricaulis maris MCS10]
          Length = 123

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 63/123 (51%), Gaps = 2/123 (1%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           D R+   +VRG+G++  G  H+I  R T+IA       F+    K   AP        S+
Sbjct: 3   DYRTPTAKVRGLGASGHGASHWIVHRVTSIALFFLAPVFVWMLAK-SGAP-ASAAEFFSS 60

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
            A A I  L   +   HM+LGMQVIIEDY+H    K + +  N+   L L +   F+LLK
Sbjct: 61  PAGAIITLLTLTAGLSHMRLGMQVIIEDYVHKHGTKTLLMLANTFLTLGLWLVTAFALLK 120

Query: 124 IAI 126
           +A+
Sbjct: 121 LAL 123


>gi|114707254|ref|ZP_01440152.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Fulvimarina pelagi HTCC2506]
 gi|114537450|gb|EAU40576.1| succinate dehydrogenase subunit D, membrane anchor protein
           [Fulvimarina pelagi HTCC2506]
          Length = 113

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 1/113 (0%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGT 74
           MG++  GT HF +QR TAIAN+     F+   +    A   ++     N  + ++  L  
Sbjct: 1   MGASSGGTEHFWQQRLTAIANLVLFTTFLIIVLTLIGADITEVRETFGNPIIGTLAALMI 60

Query: 75  ISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAIL 127
           +S  VHM+LGMQ I+EDY+H  + K      N+ F  L+    L++++K++  
Sbjct: 61  VSACVHMRLGMQTILEDYVHGPM-KWPLAIANTFFACLIAALGLYAIVKMSFG 112


>gi|254512425|ref|ZP_05124492.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacteraceae bacterium KLH11]
 gi|221536136|gb|EEE39124.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacteraceae bacterium KLH11]
          Length = 123

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 57/120 (47%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G+GSAK GT HF   + +++A +  +  FI  F      PY+ ++   S    
Sbjct: 5   TDRKRAVGLGSAKSGTAHFWSMKVSSVALLILVPLFIFTFGPILGQPYDVVLDYYSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  +    H   G QV+IEDY+H  + K+  + +  C         LF++ +IA+
Sbjct: 65  AIVAALTLLVGFKHFADGAQVMIEDYVHGTMEKV-LIILTICLSYGAAAAGLFAIARIAL 123


>gi|170746892|ref|YP_001753152.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium radiotolerans JCM 2831]
 gi|170653414|gb|ACB22469.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylobacterium radiotolerans JCM 2831]
          Length = 139

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/124 (33%), Positives = 75/124 (60%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
            +R+   RVRG+G +  G  H+  QR TA+AN+  ++ F+    K     Y +   +++ 
Sbjct: 13  SIRTPRARVRGLGVSHHGADHWWLQRLTAVANVVLMLSFVVIIAKMAGRGYAEARLLVAT 72

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
             V+ ++ L  +S++VHM+LGMQVIIEDY+H    KI  +F N+ + +++ + CL+++L+
Sbjct: 73  PLVSILLILALLSVTVHMRLGMQVIIEDYVHAPSTKIAAVFANNAYAVVVAVACLYAVLR 132

Query: 124 IAIL 127
           I   
Sbjct: 133 IGFG 136


>gi|254464400|ref|ZP_05077811.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium Y4I]
 gi|206685308|gb|EDZ45790.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium Y4I]
          Length = 123

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMG+AK GT H    + +A+A +  +  F+  F       YE+I +  S    
Sbjct: 5   TDRKRAVGMGAAKSGTAHHWSMQVSAVALLILVPLFVFTFGSALGGSYEEITAYYSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L      +H + G Q++IEDY+H    ++  + +  C    +     ++L+++A+
Sbjct: 65  ALVAVLTIWVGMMHFKSGAQIMIEDYVHGLKGRLA-IILVKCLSYAVAATSAYALIRLAL 123


>gi|167648794|ref|YP_001686457.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter sp. K31]
 gi|167351224|gb|ABZ73959.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Caulobacter sp. K31]
          Length = 135

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 66/126 (52%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
            R+ + R RG+G+++ G  HFI +R + +A IP  ++ +   ++     ++     ++  
Sbjct: 10  FRTPMSRARGLGASRHGVAHFITERVSGVALIPLALWGLFAALRLASLGFDGAAEWVAIP 69

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A+++ L  +   +H++  +QV+IEDYI    LK + +  N    +L  +  + ++LK+
Sbjct: 70  CNAALLCLLLVVALIHLKGAVQVVIEDYIADFTLKTVLVLANLFVCVLGGVLGVVAILKV 129

Query: 125 AILGTL 130
           A  G  
Sbjct: 130 AFTGAF 135


>gi|126725052|ref|ZP_01740895.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium HTCC2150]
 gi|126706216|gb|EBA05306.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacterales bacterium HTCC2150]
          Length = 123

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 1/122 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
             +   R  GMGSAK+GT HF     ++IA    +  FI  F    D  Y  + +  +  
Sbjct: 3   FMTDRKRANGMGSAKEGTHHFWSMTVSSIALAILMPLFIFNFGPMLDESYADVQAHFARP 62

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             A + GL  I    H ++G Q +IEDY+     KI  +   S      +   LF+L  I
Sbjct: 63  YPAILTGLTLIVAFTHFKMGAQTMIEDYVKGGARKIT-IIAVSLLSYAAMATGLFALASI 121

Query: 125 AI 126
           A+
Sbjct: 122 AL 123


>gi|3273340|dbj|BAA31211.1| succinate dehydrogenase cytochrome b small subunit [Rhodospirillum
           rubrum]
          Length = 127

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 1/126 (0%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIA-FFIKYGDAPYEQIVSVLS 62
            +RS LGR R          H++ +R  AIA +P  ++F+    I    A Y QI + ++
Sbjct: 2   SLRSPLGRARRGFRQGGAANHWMAERLPAIALVPLALWFVFVAIISNLGASYAQIQAFMA 61

Query: 63  NVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               A++M L       H  LG+ VIIEDY+    +K   +F    + L   +    S+L
Sbjct: 62  VPLNATLMLLTVFCAFFHGALGLIVIIEDYVQNHAVKNALVFGTKLYALFGAVLAAVSIL 121

Query: 123 KIAILG 128
           K+   G
Sbjct: 122 KLTFGG 127


>gi|238650697|ref|YP_002916550.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           peacockii str. Rustic]
 gi|238624795|gb|ACR47501.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           peacockii str. Rustic]
          Length = 125

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 57/122 (46%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +  +    H  LGM+V+IEDYI    L+   + +   F ++ I+  + +
Sbjct: 61  LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA 120

Query: 121 LL 122
           L 
Sbjct: 121 LF 122


>gi|254438569|ref|ZP_05052063.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Octadecabacter antarcticus 307]
 gi|198254015|gb|EDY78329.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Octadecabacter antarcticus 307]
          Length = 123

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT H  +   +++A    I  F+  +       Y    +  +    
Sbjct: 5   TDRKRAVGMGSAKSGTEHHWQMIVSSVALTGLIPLFVFTYGAALGMSYADASAYYARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           + +  L  +   +H + G+Q +IEDY+     K   +  + C         +F++++IA+
Sbjct: 65  SIVGILTLLVGFLHFKGGVQTLIEDYVQGFARK-ALIIGSICLSYGAAAAGVFAIVRIAL 123


>gi|157828043|ref|YP_001494285.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932740|ref|YP_001649529.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           rickettsii str. Iowa]
 gi|157800524|gb|ABV75777.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907827|gb|ABY72123.1| succinate dehydrogenase membrane anchor subunit [Rickettsia
           rickettsii str. Iowa]
          Length = 125

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 57/122 (46%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +  +    H  LGM+V+IEDYI    L+   + +   F ++ I+  + +
Sbjct: 61  LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA 120

Query: 121 LL 122
           L 
Sbjct: 121 LF 122


>gi|254449958|ref|ZP_05063395.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Octadecabacter antarcticus 238]
 gi|198264364|gb|EDY88634.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Octadecabacter antarcticus 238]
          Length = 123

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 53/120 (44%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT H  +   +++A    I  F+  +       YE   +  +    
Sbjct: 5   TDRKRAVGMGSAKSGTEHHWQMIVSSVALTGLIPLFVFTYGAALGMSYEDAAAYYARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           + +  L  +   +H + G+Q +IEDY H    K   +  + C         +F++++IA+
Sbjct: 65  SIVGILTLLVGFLHFKGGVQTLIEDYFHGFARK-ALIIGSICLSYAAAAVGVFAIVRIAL 123


>gi|126734840|ref|ZP_01750586.1| succinate dehydrogenase [Roseobacter sp. CCS2]
 gi|126715395|gb|EBA12260.1| succinate dehydrogenase [Roseobacter sp. CCS2]
          Length = 123

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 48/97 (49%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT H  +   T++A +  I  FI  F     APYE++++       
Sbjct: 5   TDRKRASGMGSAKTGTEHHWQMMVTSVALLILIPMFIFTFGWILGAPYEEVIAYYQRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFL 103
           A +  L  +    H +LG+Q +IEDY+H    K   +
Sbjct: 65  AVVAILTLLVGFFHYRLGVQTLIEDYVHGFARKAAII 101


>gi|157964194|ref|YP_001499018.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia massiliae MTU5]
 gi|157843970|gb|ABV84471.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia massiliae MTU5]
          Length = 125

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 58/122 (47%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++++ + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAAIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +  +    H  LGM+V+IEDYI    L+   + +   F ++ I+  + +
Sbjct: 61  LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCYKLRNTLIIIVQLFCIVTIVAFVVA 120

Query: 121 LL 122
           + 
Sbjct: 121 IF 122


>gi|241518580|ref|YP_002979208.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862993|gb|ACS60657.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 127

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 66/122 (54%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           M + LGRVRG+GSA  GT  ++ ++ + IA      + +   I       + +V  + + 
Sbjct: 1   MTTPLGRVRGLGSAHGGTKAYVLKQASGIAIGVLTPYIVGLGIYLFGRDRDFLVLSVGSF 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            V   +    I  ++HM++GM+ IIEDY+H  + K+  LF+NS F   + + C+F+++ +
Sbjct: 61  WVGPPLLAFVILSAIHMEIGMRTIIEDYVHGHMRKLALLFLNSAFTWSVCLLCVFAIVLM 120

Query: 125 AI 126
             
Sbjct: 121 MF 122


>gi|153868749|ref|ZP_01998496.1| succinate dehydrogenase membrane anchor subunit [Beggiatoa sp. PS]
 gi|152074660|gb|EDN71494.1| succinate dehydrogenase membrane anchor subunit [Beggiatoa sp. PS]
          Length = 128

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 70/125 (56%), Gaps = 1/125 (0%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK-YGDAPYEQIVSVLSN 63
            ++ L +VR  GSA++GT HFI QR +AIA +P +++F+A  I     A +  +V  +  
Sbjct: 4   FQTPLSQVRLWGSAREGTSHFIAQRLSAIALVPLLLWFVAAIIFFIVKADHASLVEWIRL 63

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
                ++ L  +    H   G+Q I+ DY+H  ++K + + +   FV+ + +  + ++L+
Sbjct: 64  YWNTELLILLILLTFHHAHAGLQEILVDYVHNEIIKAIVMTLMKFFVIGITVASVLAVLR 123

Query: 124 IAILG 128
           IA+ G
Sbjct: 124 IALGG 128


>gi|15892092|ref|NP_359806.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia conorii str. Malish 7]
 gi|20137872|sp|Q92J98|DHSD_RICCN RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|15619215|gb|AAL02707.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia conorii str. Malish 7]
          Length = 126

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 1/123 (0%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW 60

Query: 61  -LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
            L        + +  +    H  LGM+V+IEDYI Y  L+   + +   F ++ I+  + 
Sbjct: 61  ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV 120

Query: 120 SLL 122
           +L 
Sbjct: 121 ALF 123


>gi|326404268|ref|YP_004284350.1| succinate dehydrogenase membrane anchor subunit [Acidiphilium
           multivorum AIU301]
 gi|325051130|dbj|BAJ81468.1| succinate dehydrogenase membrane anchor subunit [Acidiphilium
           multivorum AIU301]
          Length = 122

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 64/122 (52%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS+LGR RGMG+AK G  H+  QR TA+A +P  ++ +   +    A   +++  ++  
Sbjct: 1   MRSALGRARGMGAAKSGVHHWWAQRLTALALLPLALYAVLSVLLLEGASQAEMLRYMAEP 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
               +     I++  H+QLG+QV+IEDYI     ++  +           +  + S+LK+
Sbjct: 61  WNGVLFLALVIALFYHLQLGLQVVIEDYIRSEGKRLAVMLAMRATAGFFGLLAIISVLKL 120

Query: 125 AI 126
           + 
Sbjct: 121 SF 122


>gi|239947121|ref|ZP_04698874.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921397|gb|EER21421.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 56/122 (45%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      I+ I F +   +     I+  
Sbjct: 1   MVYDFKAKIVKAKNSGSAKSGSHHWLLQRATGIILALCSIWLIYFTLTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +       H  LGM+V+IEDY+ Y  L+   + +   F ++ I   + +
Sbjct: 61  LKKPFNVIALLITVAISLYHAMLGMRVVIEDYVSYHKLRNTLIIIVQLFCIVTIAAFVVA 120

Query: 121 LL 122
           + 
Sbjct: 121 MF 122


>gi|84500177|ref|ZP_00998443.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanicola batsensis HTCC2597]
 gi|84392111|gb|EAQ04379.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanicola batsensis HTCC2597]
          Length = 123

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMG++K GT H  + + ++IA +  +  F+  F     + YE++V+  S    
Sbjct: 5   TDRKRAVGMGASKTGTAHHWQMQISSIALLILVPLFVLNFGAILGSSYEEVVAHYSRPYP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  +    H + G Q+ IEDYIH    ++  +   +     +    +FSLL++A+
Sbjct: 65  AIVAALTLLVGMTHFKNGAQMAIEDYIHGLAGRL-SIIGVTILAYAIAGVGIFSLLRLAL 123


>gi|148260874|ref|YP_001235001.1| succinate dehydrogenase, cytochrome b subunit [Acidiphilium cryptum
           JF-5]
 gi|146402555|gb|ABQ31082.1| succinate dehydrogenase subunit D [Acidiphilium cryptum JF-5]
          Length = 125

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 64/122 (52%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MRS+LGR RGMG+AK G  H+  QR TA+A +P  ++ +   +    A   +++  ++  
Sbjct: 4   MRSALGRARGMGAAKSGVHHWWAQRLTALALLPLALYAVLSVLLLEGASQAEMLRYMAEP 63

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
               +     I++  H+QLG+QV+IEDYI     ++  +           +  + S+LK+
Sbjct: 64  WNGVLFLALVIALFYHLQLGLQVVIEDYIRSEGKRLAVMLAMRATAGFFGLLAIISVLKL 123

Query: 125 AI 126
           + 
Sbjct: 124 SF 125


>gi|229586367|ref|YP_002844868.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia africae ESF-5]
 gi|228021417|gb|ACP53125.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia africae ESF-5]
          Length = 126

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 1/123 (0%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFMLTNKNNDINIIMLW 60

Query: 61  -LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
            L        + +  +    H  LGM+V+IEDYI Y  L+   + +   F ++ I+  + 
Sbjct: 61  ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV 120

Query: 120 SLL 122
            L 
Sbjct: 121 VLF 123


>gi|119385744|ref|YP_916799.1| succinate dehydrogenase, cytochrome b subunit [Paracoccus
           denitrificans PD1222]
 gi|119376339|gb|ABL71103.1| succinate dehydrogenase subunit D [Paracoccus denitrificans PD1222]
          Length = 127

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 1/118 (0%)

Query: 8   SLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVA 67
              R RG+G+A  GTG +  QR +A   +P +++F         A + ++V+ L+    +
Sbjct: 8   PFARARGLGAAGHGTGRWWAQRVSAAGLVPLVLWFALALAGGAAADHAKLVAWLAAPLNS 67

Query: 68  SIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            +M L  ++   H  LG+QV+ EDYIH    + +            ++F + S+L+IA
Sbjct: 68  GLMILLLMAGFHHAALGLQVLAEDYIHS-GARFVAAAAIQLACFAGVVFGIASVLRIA 124


>gi|34580877|ref|ZP_00142357.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia sibirica 246]
 gi|28262262|gb|EAA25766.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia sibirica 246]
          Length = 126

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 1/123 (0%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +  GSAK G+ H++ QR T I      ++ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW 60

Query: 61  -LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
            L        + +  +    H  LGM+V+IEDYI Y  L+   + +   F ++ I+  + 
Sbjct: 61  ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV 120

Query: 120 SLL 122
            L 
Sbjct: 121 VLF 123


>gi|255262499|ref|ZP_05341841.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thalassiobium sp. R2A62]
 gi|255104834|gb|EET47508.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thalassiobium sp. R2A62]
          Length = 123

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/102 (31%), Positives = 47/102 (46%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMGSAK GT H      ++ A +  +  FI  F       YE++++  S    
Sbjct: 5   TDRKRAAGMGSAKQGTEHHWSMMVSSAALLILVPLFIFTFGAALGGTYEEVIAYYSRPVP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSC 108
           A I  L      +H + G+QV+IEDY+H    KI  + M   
Sbjct: 65  AVIAVLTLWVGFMHFKSGVQVLIEDYVHGVARKIAIIAMIIL 106


>gi|163738940|ref|ZP_02146353.1| malate dehydrogenase [Phaeobacter gallaeciensis BS107]
 gi|163741816|ref|ZP_02149206.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Phaeobacter gallaeciensis 2.10]
 gi|161384989|gb|EDQ09368.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Phaeobacter gallaeciensis 2.10]
 gi|161387745|gb|EDQ12101.1| malate dehydrogenase [Phaeobacter gallaeciensis BS107]
          Length = 123

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 57/120 (47%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  GMG+AK GT H    + ++I  +  +  F+  F       YE+I +  +    
Sbjct: 5   TDRKRAVGMGAAKSGTAHHWSMQVSSIGLLILVPLFVFTFGSALGGSYEEITAYYARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L      +H + G Q++IEDY+H    ++  + + +C    +     ++L+++A+
Sbjct: 65  ALVALLTIWVGMMHFKSGAQIMIEDYVHGFAGRLT-IILVTCLSYAVAAVSAYALIRLAL 123


>gi|149913138|ref|ZP_01901672.1| malate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813544|gb|EDM73370.1| malate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 123

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           ++  R  G+G+A  GT H      +A+     +  F+ FF +     ++++++  S+ A+
Sbjct: 5   TARKRAEGLGAAHSGTEHHWYMTVSAVGLALIVPLFLFFFGRALGGTHDEVMATFSHPAM 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L       H + G Q +IEDY      K+  +   +     LI   +F++LKIA+
Sbjct: 65  AILTLLVIFVGLQHFRKGAQTMIEDYARGMTRKV-LIIAVTVLSYGLIATGVFAVLKIAL 123


>gi|15604004|ref|NP_220519.1| succinate dehydrogenase hydrophobic membrane anchor protein (sdhD)
           [Rickettsia prowazekii str. Madrid E]
 gi|729337|sp|P41086|DHSD_RICPR RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|409935|gb|AAA18326.1| putative hydrophobic subunit of succinate dehydrogenase [Rickettsia
           prowazekii]
 gi|3860695|emb|CAA14596.1| SUCCINATE DEHYDROGENASE HYDROPHOBIC MEMBRANE ANCHOR PROTEIN (sdhD)
           [Rickettsia prowazekii]
 gi|292571720|gb|ADE29635.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia prowazekii Rp22]
          Length = 125

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 53/122 (43%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +    +K G+ H++ QR T +       + I F     +     I+  
Sbjct: 1   MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
                   I+ +       H  LGM+V+IEDYI+   L+   + +   F +L I+  + +
Sbjct: 61  FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA 120

Query: 121 LL 122
           + 
Sbjct: 121 IF 122


>gi|157803314|ref|YP_001491863.1| hypothetical protein A1E_00650 [Rickettsia canadensis str. McKiel]
 gi|157784577|gb|ABV73078.1| hypothetical protein A1E_00650 [Rickettsia canadensis str. McKiel]
          Length = 125

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 55/122 (45%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D +  + + +  GSAK G+ H++ QR TAI      I+ I F +    +    I+  
Sbjct: 1   MVYDFKVEIVKAKASGSAKSGSHHWLLQRVTAIILALCSIWLIYFTLTNKSSDLSIIMWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +  I    H  +G+Q++IEDYI    L    + +   F L+ I   + +
Sbjct: 61  LKKPFNVVALLITVIISLYHAMIGVQIVIEDYIRCNKLLNTLIIVVKLFCLVTIAAFVTA 120

Query: 121 LL 122
           + 
Sbjct: 121 MF 122


>gi|157825306|ref|YP_001493026.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia akari str. Hartford]
 gi|157799264|gb|ABV74518.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia akari str. Hartford]
          Length = 125

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 54/124 (43%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D +  + + +  GSAK G+  ++ QR T I      I+ I F +   +     I+  
Sbjct: 1   MVYDFKVEIVKAKNSGSAKSGSHRWLSQRITGIILALCSIWLIYFMLTNKNNDINIIMWE 60

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +       H  LGM+V+IEDYI    L  + + +   F ++ I   + +
Sbjct: 61  LKKPFNVVALLITVAISLYHSMLGMRVVIEDYISCHKLHNILIIIVQLFCIVTITTFVVA 120

Query: 121 LLKI 124
           +  I
Sbjct: 121 MFYI 124


>gi|189184863|ref|YP_001938648.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Ikeda]
 gi|189181634|dbj|BAG41414.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Ikeda]
          Length = 129

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 65/123 (52%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           ++++SL  ++ + + K    H+  QR +AI  +P +++ + F          ++V ++  
Sbjct: 5   NLQNSLNTIKSLSTDKYCVQHWWYQRLSAILMLPLLVWLVFFGKAIVQKSPVELVELVKY 64

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
                ++ L  I++  H  +G++VIIEDY++   ++ + + +  CF  + ++  + S++ 
Sbjct: 65  PYNVLMIILLLITMFFHAAIGLKVIIEDYVNNLSVRYLLIVLVQCFTFVTVVAGIISIIL 124

Query: 124 IAI 126
           + I
Sbjct: 125 LCI 127


>gi|89068122|ref|ZP_01155539.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanicola granulosus HTCC2516]
 gi|89046361|gb|EAR52418.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanicola granulosus HTCC2516]
          Length = 123

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G+GSAK GT    +   ++ A +  ++ FI  F       YE+ V        
Sbjct: 5   TDRKRASGLGSAKRGTEKHWQMSLSSAALVVLVVLFIFTFGGALGMGYEEAVVYYHRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L      +H + G+Q++I+DY      K   +   +C     +   +F++ ++A+
Sbjct: 65  AIVALLTIAVGLLHFRGGVQILIDDYTRGLTRK-ALIVGTACLSYAALAAGVFAIARLAL 123


>gi|126740504|ref|ZP_01756191.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseobacter sp. SK209-2-6]
 gi|126718305|gb|EBA15020.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseobacter sp. SK209-2-6]
          Length = 123

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           ++  R  G G++  GT H    + +A+A    +  F+        + +E++++  S    
Sbjct: 5   TARKRAEGKGASGTGTEHHWYMQASAVALAFLVPAFLYVVGSAIGSSHEEVLATFSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A + GL   +  +H   G Q++IEDY    + K   +          I   +F+L KIA+
Sbjct: 65  AILTGLTLYAGVMHFNKGAQMMIEDYARGSMRK-ALIIFVIGLSYTTIATGVFALAKIAL 123


>gi|86138976|ref|ZP_01057547.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Roseobacter sp. MED193]
 gi|85824207|gb|EAQ44411.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Roseobacter sp. MED193]
          Length = 123

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           ++  R  G G+A  GT H    + +A+A    +  FI           E++++  +    
Sbjct: 5   TARKRAVGKGAAGTGTEHHWYMQVSAVALAFLVPAFIYIVGSAIGGTQEEVLATFARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A + GL      +H   G Q++IEDY    + K   +          I   +F+L KIA+
Sbjct: 65  AILTGLTLFVGVMHFNKGAQMMIEDYARGSMRK-ALIMFVIGLSYATIATGVFALAKIAL 123


>gi|89053301|ref|YP_508752.1| succinate dehydrogenase subunit D [Jannaschia sp. CCS1]
 gi|88862850|gb|ABD53727.1| succinate dehydrogenase subunit D [Jannaschia sp. CCS1]
          Length = 123

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   RV G+GSAK GT        T++A +    FF+A       + +  +++ L     
Sbjct: 5   TDRKRVSGLGSAKGGTAQHWTMTVTSVALLILTPFFLAIIGSALGSDHADVIATLGKPVP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A I+    +    H++ GMQ ++EDY H    K+  +   +     L    L +L++IA+
Sbjct: 65  ALIVAAYLVVGMHHLRYGMQTLLEDYTHGLTKKVSIIV-TTILSYGLAAGGLVALMQIAL 123


>gi|67459553|ref|YP_247177.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia felis URRWXCal2]
 gi|75536047|sp|Q4UKC3|DHSD_RICFE RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|67005086|gb|AAY62012.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia felis URRWXCal2]
          Length = 120

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 1   MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV 60
           M +D ++ + + +       G+ H++ QR T I      I+ I F +   +     I+  
Sbjct: 1   MVYDFKAEIVKAKN-----SGSHHWLLQRVTGIILALCSIWLIYFTLTNKNNDINIIMWE 55

Query: 61  LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           L        + +       H  LGM+V+IEDY+    L+   + +   F ++ I   + +
Sbjct: 56  LKKPFNVVALLITVAISLYHAMLGMRVVIEDYVSCHKLRNTLIVIVQLFCIVTIAAFVVA 115

Query: 121 LL 122
           + 
Sbjct: 116 MF 117


>gi|148284920|ref|YP_001249010.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Boryong]
 gi|146740359|emb|CAM80792.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Orientia tsutsugamushi str. Boryong]
          Length = 129

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 65/125 (52%)

Query: 2   DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
             ++++SL  ++ + + K    H+  QR +AI  +P +++ + F          ++V ++
Sbjct: 3   AQNLQNSLNTIKSLSTDKYCVQHWRYQRLSAILMLPLLVWLVFFGKAIVQKSPVELVELV 62

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
                  ++ L  I++  H  +G++VIIEDY++   ++ + + +  CF  + ++  + S+
Sbjct: 63  KYPYNVLMIILLLITMFFHAAIGLKVIIEDYVNNLAVRYLLIVLVQCFTFVTVVAGIISI 122

Query: 122 LKIAI 126
           + + I
Sbjct: 123 ILLCI 127


>gi|46203231|ref|ZP_00051839.2| COG2142: Succinate dehydrogenase, hydrophobic anchor subunit
          [Magnetospirillum magnetotacticum MS-1]
          Length = 131

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 48/85 (56%)

Query: 2  DFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVL 61
             MR+   RV+G+G++  G GHF  QR T  +N   ++ F+          Y Q V+++
Sbjct: 11 ALSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAGRTYPQAVALV 70

Query: 62 SNVAVASIMGLGTISISVHMQLGMQ 86
          S+  VA I+ L  +S++ HM++GMQ
Sbjct: 71 SHPLVAIILILAVVSVATHMRIGMQ 95


>gi|149201369|ref|ZP_01878344.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Roseovarius sp. TM1035]
 gi|149145702|gb|EDM33728.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Roseovarius sp. TM1035]
          Length = 123

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           ++  R  G G+A  GT HF   + + +     I  F+  F +       ++++  S+ A+
Sbjct: 5   TARKRAEGKGAAGTGTEHFWYMKLSGVGLALIIPVFLVAFGRALGGDRAEVLAAFSHPAM 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A + GL       H   G Q +IEDY H    +   +   +     LI   LF+L KIA+
Sbjct: 65  AILTGLVIFFGLRHYASGAQTMIEDYSHGSTRR-GLIIAVTVLSYGLIATGLFALAKIAL 123


>gi|218679248|ref|ZP_03527145.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Rhizobium etli CIAT 894]
          Length = 81

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 54/81 (66%)

Query: 48  KYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNS 107
            Y  APY  +V  LSN  VA +MGL  IS  +HM+LGMQVIIEDY+H    KI  L +N+
Sbjct: 1   AYAGAPYADVVRALSNPFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNT 60

Query: 108 CFVLLLIIFCLFSLLKIAILG 128
            F +L+   CLF++LKIA +G
Sbjct: 61  FFAILIAGLCLFAILKIAFVG 81


>gi|85706757|ref|ZP_01037849.1| putative succinate dehydrogenase, hydrophobic membrane
           anchorprotein [Roseovarius sp. 217]
 gi|85668815|gb|EAQ23684.1| putative succinate dehydrogenase, hydrophobic membrane
           anchorprotein [Roseovarius sp. 217]
          Length = 123

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           ++  R  G G+A  GT HF   + + +     I  F+  F +       ++++  ++  +
Sbjct: 5   TARKRAEGKGAAGTGTEHFWYMKLSGVGLALIIPVFLVAFGRALGGDRTEVMAAFAHPGM 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A + GL       H   G Q +IEDY H  + +   +   +     LI   LF+L KIA+
Sbjct: 65  AILTGLVIFFGLRHYASGAQTMIEDYSHGSMRR-GLIIAVTVLSYGLIATGLFALAKIAL 123


>gi|119383320|ref|YP_914376.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Paracoccus denitrificans PD1222]
 gi|2494618|sp|Q59660|DHSD_PARDE RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|975317|gb|AAA75176.1| succinate dehydrogenase hydrophobic membrane anchor [Paracoccus
           denitrificans]
 gi|119373087|gb|ABL68680.1| succinate dehydrogenase subunit D [Paracoccus denitrificans PD1222]
          Length = 129

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 1/124 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +      G+GSA +GT H      +A+A       F+    +      EQ+++       
Sbjct: 5   TPRKAAEGLGSAHEGTQHHWAMTVSAVALTVLTPLFMIVVARAIGLSQEQLLAYFGRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A I  L  I   VH   G +++I+DY      K   +F    F   +I   +++L ++ +
Sbjct: 65  ALITALFVIVGMVHFIKGTRIMIDDYFQGGTRKAAIIFSVI-FGWAVIAAAVYALARMGL 123

Query: 127 LGTL 130
              +
Sbjct: 124 GAIV 127


>gi|126730328|ref|ZP_01746139.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sagittula stellata E-37]
 gi|126709061|gb|EBA08116.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sagittula stellata E-37]
          Length = 123

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 56/120 (46%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R +G+GS + GT    +   T++A +  +  F+  F       YE + +  +    
Sbjct: 5   TDRKRAQGLGSGRTGTQFHKRMLVTSMALVVLVPLFVFSFGSGFGGSYEDVQAFFARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A I  L  +   +H     Q  IEDY+H    K++ +   + F  +LI   LF+L+++A+
Sbjct: 65  AIITALMLVVGVIHFNGEAQEAIEDYVHGTTGKLLAV-AVTAFSYVLIAAGLFALVRLAL 123


>gi|260425803|ref|ZP_05779783.1| succinate dehydrogenase hydrophobic membrane anchor [Citreicella
           sp. SE45]
 gi|260423743|gb|EEX16993.1| succinate dehydrogenase hydrophobic membrane anchor [Citreicella
           sp. SE45]
          Length = 123

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G GSA  G  H      +++A    +  +I  F     + Y+  ++ +S    
Sbjct: 5   TDRKRAVGKGSAHTGAEHHWFMIVSSVALAFMMPAWIFIFGNALGSGYDAALATMSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  I   +H   G +V+IEDY      K+  +     F  ++I   LF+L+KIA+
Sbjct: 65  AILTALVLIVGMMHFHKGGRVMIEDYTAGTTRKV-LIMAYVAFSYVMIACGLFALVKIAL 123


>gi|51473327|ref|YP_067084.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia typhi str. Wilmington]
 gi|81390259|sp|Q68XP0|DHSD_RICTY RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|51459639|gb|AAU03602.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rickettsia typhi str. Wilmington]
          Length = 125

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 42/102 (41%)

Query: 21  GTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           G  H++ QR T +       + I F     +     I+          I+ +       H
Sbjct: 21  GAHHWLLQRVTGVVLALCSFWLIYFMFTNKNNDINIIMWEFKKPFNIVILLITVTISLYH 80

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
             LGM+V+IEDYI+   L+   + +   F +L I+  + ++ 
Sbjct: 81  SVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVAFIVAIF 122


>gi|77464555|ref|YP_354059.1| succinate dehydrogenase subunit D [Rhodobacter sphaeroides 2.4.1]
 gi|126463395|ref|YP_001044509.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221640466|ref|YP_002526728.1| Succinate dehydrogenase subunit D [Rhodobacter sphaeroides KD131]
 gi|332559448|ref|ZP_08413770.1| succinate dehydrogenase subunit D [Rhodobacter sphaeroides WS8N]
 gi|77388973|gb|ABA80158.1| succinate dehydrogenase subunit D [Rhodobacter sphaeroides 2.4.1]
 gi|126105059|gb|ABN77737.1| succinate dehydrogenase subunit D [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161247|gb|ACM02227.1| Succinate dehydrogenase subunit D [Rhodobacter sphaeroides KD131]
 gi|332277160|gb|EGJ22475.1| succinate dehydrogenase subunit D [Rhodobacter sphaeroides WS8N]
          Length = 123

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           ++  R  GMG+A  GT        +A+     I  F+           E+++ + S+   
Sbjct: 5   TARKRAEGMGAAHHGTDRHWYMIVSAVGLAVLIPIFVYIVGNAIGEGRERVLEIFSHPFN 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A + GL       H   G  ++IEDY      +++ +   S F   +    LF+L KIA+
Sbjct: 65  AILSGLVLFFGMRHFAEGSTMMIEDYWQGVPRRLLVICAQS-FAYGVAAIGLFALAKIAL 123


>gi|146276144|ref|YP_001166303.1| hypothetical protein Rsph17025_0087 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554385|gb|ABP68998.1| succinate dehydrogenase subunit D [Rhodobacter sphaeroides ATCC
           17025]
          Length = 123

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           ++  R  GMG+A  GT        +A+     I  F+           E+++ + S+   
Sbjct: 5   TARKRAEGMGAAHHGTDRHWYMIVSAVGLAVLIPIFVYVVGNAIGEGRERVLEIFSHPFN 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A + GL       H   G  ++IEDY      +++ +   S F   +    LF+L KIA+
Sbjct: 65  AILSGLVLFFGMRHFAEGSTMMIEDYWQGVPRRLLVICAQS-FAYGVAAIGLFALAKIAL 123


>gi|294676289|ref|YP_003576904.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter capsulatus SB 1003]
 gi|294475109|gb|ADE84497.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter capsulatus SB 1003]
          Length = 133

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 1/123 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G G++  GT HF     +++A    +  FI  F         Q+ +  +    
Sbjct: 5   TDRKRAVGKGASGSGTEHFWWMTMSSVALAFLVPAFIFVFGHAIGMDQAQLQAYFARPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L TI    H   G QV++EDY    L K + +F+ S    L+    L++L K+  
Sbjct: 65  AILTALVTIVGMRHFAKGAQVMLEDYTQGSLRKGLVIFVYSL-SWLISALVLYALAKMMF 123

Query: 127 LGT 129
           L  
Sbjct: 124 LAA 126


>gi|114764871|ref|ZP_01444053.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114542757|gb|EAU45780.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseovarius sp. HTCC2601]
          Length = 123

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G GSA  G  H      +++A    +  ++  F +   + Y+  +  +S    
Sbjct: 5   TDRKRAVGKGSAHAGAEHHWFMIVSSVALAFMLPTWLIVFGRALGSGYDAALDTMSRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  I   VH Q G + +IEDY      K+  +   + F  L+I   +F+L+KIA+
Sbjct: 65  AILTALVLIVGMVHFQKGARTMIEDYTGGTTRKL-LIMAFAGFAYLMIACGIFALVKIAL 123


>gi|296445360|ref|ZP_06887318.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylosinus trichosporium OB3b]
 gi|296257121|gb|EFH04190.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylosinus trichosporium OB3b]
          Length = 126

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/109 (26%), Positives = 46/109 (42%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S + G+ H +  R +A A  P  +  + F        YE   + L     A  +      
Sbjct: 15  SDRSGSLHALAMRHSARALAPLGLLSVWFIANLSGQSYEAARAHLGRPLPAITLIAFICI 74

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            S H +LGM+ I+EDY+H   LK   L +N    + +      S++ IA
Sbjct: 75  ASYHARLGMETIVEDYVHDEALKARALQINKWLTVAIAASWTLSIMIIA 123


>gi|254475941|ref|ZP_05089327.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria sp. R11]
 gi|214030184|gb|EEB71019.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ruegeria sp. R11]
          Length = 123

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 54/120 (45%), Gaps = 1/120 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R +G+GS + GT        T+   +P +  F+          YE++++  S    
Sbjct: 5   TDRKRAQGLGSGRTGTKTHWNAIVTSTLLVPAVPVFVFTVGAGLGGTYEEVLAYFSRPVP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           A +  L  I I +H    ++  IEDY+H    ++  +   + F   LI   L +L+K+A+
Sbjct: 65  AILTALSMIVIVLHTLHEVREAIEDYMHGVSERMATIAA-TAFAYSLIAAGLLALIKLAL 123


>gi|83950427|ref|ZP_00959160.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseovarius nubinhibens ISM]
 gi|83838326|gb|EAP77622.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Roseovarius nubinhibens ISM]
          Length = 98

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 45/99 (45%), Gaps = 1/99 (1%)

Query: 28  QRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQV 87
            + ++   +  +  FI  F     AP+ ++V+  +    A +  L  I    H + G Q+
Sbjct: 1   MKLSSAGLLVLVPLFIFTFGPMLGAPHAEVVAYFARPFPALVAALTIIVGFKHFRDGAQI 60

Query: 88  IIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           ++EDY+H    KI  +   +      +   LF++ KIA+
Sbjct: 61  MLEDYVHGTAQKI-CIMALTLLSYGAMAAGLFAIAKIAL 98


>gi|304320538|ref|YP_003854181.1| hypothetical protein PB2503_04822 [Parvularcula bermudensis
           HTCC2503]
 gi|303299440|gb|ADM09039.1| hypothetical protein PB2503_04822 [Parvularcula bermudensis
           HTCC2503]
          Length = 112

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%)

Query: 22  TGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           T H+I QRFTA+  IP +I+ +   I +     +Q    LS    AS+M +  +S+  HM
Sbjct: 6   TKHYIAQRFTALIQIPLVIWLVFGVIGHAGDTQDQFRVWLSEPLTASLMIIFILSVFFHM 65

Query: 82  QLGMQVIIEDYIHYRLLKIMF 102
            LGM  +++DYIH    + + 
Sbjct: 66  HLGMGEVVDDYIHKPSSRSLL 86


>gi|259415142|ref|ZP_05739064.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter sp. TrichCH4B]
 gi|259349052|gb|EEW60806.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Silicibacter sp. TrichCH4B]
          Length = 123

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 22  TGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           T H  +   ++I  +  +  F+  F       YE++++       A I GL  +   +H+
Sbjct: 20  THHHWQMMVSSILLVFLVPAFVITFGLGLGGTYEEVLAYYGRPVPAIITGLTLVVGIIHL 79

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
               QV +EDY+H    K+  +   + F   +I   LF+L+K+A+
Sbjct: 80  MREAQVAVEDYMHGLAEKLTLI-AVAAFSYTMIAAGLFALVKLAL 123


>gi|99078502|ref|YP_611760.1| succinate dehydrogenase subunit D [Ruegeria sp. TM1040]
 gi|99035640|gb|ABF62498.1| succinate dehydrogenase subunit D [Ruegeria sp. TM1040]
          Length = 123

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 22  TGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           T H  +   ++I  +  +  F+  F       YE++++       A I GL  +   +H+
Sbjct: 20  THHHWQMMVSSILLVVLVPAFVITFGLGLGGTYEEVLAYYGRPVPAIITGLTLVVGIIHL 79

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
               QV +EDY+H    K+  +   +     +I   LF+L+K+A+
Sbjct: 80  MREAQVAVEDYMHGLAEKLTLI-AVAALSYTMIAAGLFALVKLAL 123


>gi|260576580|ref|ZP_05844568.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter sp. SW2]
 gi|259021184|gb|EEW24492.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rhodobacter sp. SW2]
          Length = 123

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 1/119 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +      G GSA  GT        T+I     +  F+  F +    P+E +V+       
Sbjct: 5   TDRKTANGKGSAHSGTHEHKDMALTSIGLAFLMPTFLFIFGRTLGQPHEVVVATFGRPIP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
           A + GL       HM  G+  ++ DY      +++ +F+N+    L+    L++L+++A
Sbjct: 65  AIVTGLMVFLAMRHMMHGVGSVLADYTRGTARRLLTIFVNAL-AYLITAAVLYALIRMA 122


>gi|310814647|ref|YP_003962611.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ketogulonicigenium vulgare Y25]
 gi|308753382|gb|ADO41311.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ketogulonicigenium vulgare Y25]
          Length = 127

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 51/121 (42%), Gaps = 1/121 (0%)

Query: 7   SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66
           +   R  G G+++ GT   I    T+   +  +   +         P++Q  + +     
Sbjct: 5   TDRKRAVGNGASRTGTFDHIFMTSTSYGLLVLVPCLVWVLGNALFLPFDQARAYVGRPFP 64

Query: 67  ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
             ++GL  +    H  +G Q+++EDY+     +I  L        LLI   L +L+++A+
Sbjct: 65  LIVLGLTLVVGLRHFAVGAQMMLEDYLQGFAREITVLIA-RGLSWLLIATGLLALVRLAL 123

Query: 127 L 127
            
Sbjct: 124 G 124


>gi|329847591|ref|ZP_08262619.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Asticcacaulis biprosthecum C19]
 gi|328842654|gb|EGF92223.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Asticcacaulis biprosthecum C19]
          Length = 127

 Score = 76.6 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 43/90 (47%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S K G G ++ +RFT+IA IP  ++            Y+  ++ ++       +    + 
Sbjct: 16  SEKHGAGEWLAERFTSIALIPLTLWAAYAAFTIAGTGYDGALAFVAKPFNILAIAATMLI 75

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
            + HM +G++VII+DYI     +   LF+ 
Sbjct: 76  TAWHMYMGVKVIIDDYIGKPGTRGFLLFLT 105


>gi|294085394|ref|YP_003552154.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664969|gb|ADE40070.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 121

 Score = 76.6 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/107 (21%), Positives = 46/107 (42%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G  H+  QR +A+A +  + +F+    + G   Y    + L+    A  + L  +    
Sbjct: 15  SGLSHWRWQRMSAVAVLMLMAYFVFVVTRIGTLDYAAARAFLATPYQALALALLVVIGVF 74

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           H  LG  V+IEDY+  +  +   +   S  + ++    L ++  +A 
Sbjct: 75  HGTLGAHVVIEDYVPVKSGRHALILTVSIIMAIIAGASLIAIASVAF 121


>gi|225629574|ref|ZP_03787601.1| succinate dehydrogenase, hydrophobic membrane [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225591572|gb|EEH12585.1| succinate dehydrogenase, hydrophobic membrane [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 116

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 2/110 (1%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK--YGDAPYEQIVSVLSNVAVASIMGL 72
           M  + +   H+  QR +A+  +    +FI  F    Y D+        +++        +
Sbjct: 1   MSQSGNSVHHWWVQRVSAVILLFLFPWFIYSFSCTFYTDSSLSFSEKFINHPLELLFFVV 60

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               I  H  LGMQV+ EDYIH   L+I  +        +  I   F++ 
Sbjct: 61  LLFCIFWHAVLGMQVVCEDYIHSVPLRIFTITCIKYLSSITYITLAFTIF 110


>gi|302381552|ref|YP_003817375.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302192180|gb|ADK99751.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 134

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 49/113 (43%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S + G G +  ++    A +P  ++  +         Y+ ++   ++   A+++    + 
Sbjct: 14  SERHGAGEWTLEKILLAALMPLGLWVASTAFTLSGQGYDIVLQWFASPVNAALLAATALI 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGT 129
           +     L  +VIIEDYIH    K + + + +   L      +F ++++A+   
Sbjct: 74  LFGFASLAWKVIIEDYIHVAGTKALLIGLVNLICLAAAAASVFFIVRLALGSA 126


>gi|58698190|ref|ZP_00373111.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630886|ref|YP_002727677.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Wolbachia sp. wRi]
 gi|58535271|gb|EAL59349.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592867|gb|ACN95886.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Wolbachia sp. wRi]
          Length = 118

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 2/110 (1%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK--YGDAPYEQIVSVLSNVAVASIMGL 72
           M  + +   H+  QR +A+  +    +FI  F    Y D+        +++        +
Sbjct: 1   MSQSGNSVHHWWVQRVSAVILLFLFPWFIYSFSCTFYTDSSLSFSEKFINHPLELLFFVV 60

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               I  H  LGMQV+ EDYIH   L+I  +        +  I   F++ 
Sbjct: 61  LLFCIFWHAVLGMQVVCEDYIHSVPLRIFTITCIKYLSSITYITLAFTIF 110


>gi|42521019|ref|NP_966934.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410760|gb|AAS14868.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 118

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 2/110 (1%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIK--YGDAPYEQIVSVLSNVAVASIMGL 72
           M  + +   H+  QR +A+  +    +FI  F    Y D+        +++        +
Sbjct: 1   MSQSGNSVHHWWVQRVSAVILLFLFPWFIYSFSCTFYTDSSLSFSEKFINHPLELLFFVV 60

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               I  H  LGMQV+ EDYIH   L+I  +        +  I   F++ 
Sbjct: 61  LLFCIFWHAVLGMQVVCEDYIHSVPLRIFTITCIKYLSSITYITLAFTIF 110


>gi|323138216|ref|ZP_08073288.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylocystis sp. ATCC 49242]
 gi|322396468|gb|EFX98997.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylocystis sp. ATCC 49242]
          Length = 131

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 41/109 (37%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S  +G+ H    R +A A  P       + +     P E + + +     A ++    + 
Sbjct: 20  SDHEGSVHARFMRLSAYALAPLGALSAWWLVGVVGKPLEGVRAEIGRPVPAIVLLAFAVI 79

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
             +H   GM  II DY+H   LK      N    + +      ++L IA
Sbjct: 80  GMIHAYHGMNEIIVDYVHDEALKERAHKANKWAAIAIAAAWTLAILLIA 128


>gi|330813448|ref|YP_004357687.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486543|gb|AEA80948.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 111

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 49/102 (48%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
           +I QR TA+  +P +I+F++ FI      +  ++    N    S   +  + +  HM++G
Sbjct: 9   WILQRVTAVILLPLLIWFLSVFIGLVQKDFTTVIIFFENNINFSFSVVFLVLVFSHMKIG 68

Query: 85  MQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           M  I EDYI     K +   + S F  +L +  + SL+ I  
Sbjct: 69  MGEIFEDYIQDSRYKSVANLIISIFATVLPLITIVSLILIKF 110


>gi|190571455|ref|YP_001975813.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|190357727|emb|CAQ55177.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
          Length = 121

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 43/103 (41%), Gaps = 5/103 (4%)

Query: 22  TGHFIKQRFTAIANIPFIIFFIAFFIK--YGDAPY---EQIVSVLSNVAVASIMGLGTIS 76
             H+  QR +A+  +    +FI  F    Y D+P    E++   +++        +    
Sbjct: 8   VHHWWIQRVSAVILLFLFPWFIYSFSCTFYVDSPLSFNEKLFQAINHPLELLFFVILVFC 67

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           I  H  LGMQV+ EDYI   LL+I  +        +  I   F
Sbjct: 68  IFWHAVLGMQVVCEDYIDSVLLRIFTITCIKYLSSITYIVLAF 110


>gi|11466548|ref|NP_044797.1| succinate:ubiquinone oxidoreductase subunit 4 [Reclinomonas
           americana]
 gi|1706431|sp|P80482|DHSD_RECAM RecName: Full=Succinate dehydrogenase membrane anchor subunit;
           AltName: Full=Succinate dehydrogenase, subunit IV
 gi|2258378|gb|AAD11912.1| succinate:ubiquinone oxidoreductase subunit 4 [Reclinomonas
           americana]
          Length = 120

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 3/99 (3%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAV--ASIMGLGTI 75
           K G+ H+  QRF AI   P I++ +     Y        ++  L+ +    +  + + ++
Sbjct: 12  KSGSMHWWLQRFLAILLAPIILYLLFDVAIYIGQQSDPTVMMFLNRIFNHNSIFIFITSV 71

Query: 76  SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
            +  H++ GM+VIIEDY+H    +I+ +F+     + ++
Sbjct: 72  ILIWHVRGGMEVIIEDYVHGEKTRIVSIFLIRVIAIEIM 110


>gi|254418739|ref|ZP_05032463.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brevundimonas sp. BAL3]
 gi|196184916|gb|EDX79892.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Brevundimonas sp. BAL3]
          Length = 139

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 19/113 (16%), Positives = 51/113 (45%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S + G G ++ +R   +  +P  ++  +       A Y+ +    +N   A ++ L  + 
Sbjct: 19  SERHGAGEWLAERVLLVVVLPLGLWVASTAFTLTGAGYDAVQDWFANRLNAGLLALTAVV 78

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGT 129
              ++ +  +VI+EDY+     +   + + +   L+L    +F ++++A+   
Sbjct: 79  FFGYVSVAWKVILEDYVPQPGTRKALVALLNLVFLVLAAASVFFIVRMALGSA 131


>gi|57238922|ref|YP_180058.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58578854|ref|YP_197066.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Welgevonden]
 gi|57161001|emb|CAH57907.1| putative succinate dehydrogenase cytochrome b small subunit
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58417480|emb|CAI26684.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 116

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVS-----VLSNVAVASIMGLG 73
                H++ QR TA   +PF ++F   F+++     + +       V  N          
Sbjct: 2   GSSVYHWLSQRLTAFIMLPFSVWFFYKFLRFLSIVCKSVSELDLSFVELNTIDVIASVCF 61

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            I    H  LG+QVI+EDY+   +L++  L +    V + ++F +F++  I++
Sbjct: 62  FIIAFYHAILGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLIFAIFNISL 114


>gi|58584742|ref|YP_198315.1| succinate dehydrogenase subunit D sdhD, hydrophobic membrane anchor
           protein [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58419058|gb|AAW71073.1| Succinate dehydrogenase subunit D sdhD, hydrophobic membrane anchor
           protein [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 121

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 44/110 (40%), Gaps = 5/110 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPY-----EQIVSVLSNVAVASIMGL 72
           + +   ++   R +A+  +  + +FI  F     A       E++   +++        +
Sbjct: 4   SGNAVHYWWVHRISAVILLFLLPWFIYSFSYAFYANNSLSFNEKLFQAINHPLDLLFFVV 63

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
               I  H  LGMQV+ EDYIH   L+I  +        +  I   F++ 
Sbjct: 64  LLFCIFWHAVLGMQVVCEDYIHSIPLRIFTITCIKYLSSITYIVLAFTIF 113


>gi|329891126|ref|ZP_08269469.1| succinate dehydrogenase,hydrophobic membrane anchor protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846427|gb|EGF95991.1| succinate dehydrogenase,hydrophobic membrane anchor protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 131

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/113 (16%), Positives = 52/113 (46%), Gaps = 1/113 (0%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S + G G +  ++   +A +P  ++ ++       A Y  +V+   +   A ++ +  + 
Sbjct: 14  SERHGAGEWKLEKLALLALMPLGLWALSTGFTLAGADYGAVVAWFGSTLNAGLLAVTAVV 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGT 129
             +   L  +VI+EDY+     +   + +++   L+L    +F ++++A+   
Sbjct: 74  FCLFASLAWKVILEDYVPGSS-RPALILVSNLIFLVLAAASVFFIVRLALGSA 125


>gi|302342523|ref|YP_003807052.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Desulfarculus baarsii DSM 2075]
 gi|301639136|gb|ADK84458.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Desulfarculus baarsii DSM 2075]
          Length = 122

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/112 (20%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 15  MGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAP----YEQIVSVLSNVAVASIM 70
           +GS + G   +  QR + +A +   +      I Y   P    Y+++   L++    +  
Sbjct: 4   LGSGRTGAFEWFFQRVSGVALVAL-LGLHFILIHYTGEPGPVTYDKVAPRLASPLYKAWE 62

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
            L  +    H   G++++I+DY+H    +   L ++    L L+IF   +++
Sbjct: 63  LLFLVLALYHAMNGVKLVIDDYVHNSTWRSCLLGLSWLVALALLIFGALTII 114


>gi|68171572|ref|ZP_00544947.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658456|ref|YP_507708.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Ehrlichia chaffeensis str. Arkansas]
 gi|67999013|gb|EAM85689.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599913|gb|ABD45382.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 118

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 5/114 (4%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD---APYEQIVSVLSNVAVA--SIMGLGT 74
               H++ QR TA   IP  ++F+   +         + ++   +SN++     I+    
Sbjct: 4   HSVYHWLIQRVTAFVLIPLSLWFLFKVLGVISIILKSFPELHLSISNISNTDLIILLCFF 63

Query: 75  ISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILG 128
           IS   H  LG+QVI+EDYIH  +L+     +    V+L ++F  F +L   +LG
Sbjct: 64  ISAFYHAVLGVQVILEDYIHSVVLRASVFLVIKGIVILTVLFLTFIILYSVLLG 117


>gi|111073628|emb|CAL29490.1| SdhD; succinate dehydrogenase [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 121

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 46/109 (42%), Gaps = 5/109 (4%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIA--FFIKYGDAPY---EQIVSVLSNVAVASIMGLG 73
           ++   ++  QR +A+  +    +FI   F+  Y +A     E+++  + +        + 
Sbjct: 5   RNSVHYWWVQRVSAVVLLLLFPWFIYLGFYAFYANASLLFNEKLLQAIDHPLELLFFVIL 64

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              I  H  LG+QV+ EDYIH   +K   +        +  I   F++ 
Sbjct: 65  LFYIFWHAVLGIQVVCEDYIHSIPIKFFVITCIKYLSSVTYIVLAFTIF 113


>gi|58616912|ref|YP_196111.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Gardel]
 gi|58416524|emb|CAI27637.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Ehrlichia ruminantium str. Gardel]
          Length = 116

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 51/113 (45%), Gaps = 5/113 (4%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVS-----VLSNVAVASIMGLG 73
                H++ QR TA   +PF ++F   F+++       +       V  N          
Sbjct: 2   GSSVYHWLSQRVTAFIVLPFSVWFFYKFLRFLSIVCRSVSELDLSFVELNTIDVIASVCF 61

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
            I    H  LG+QVI+EDY+   +L++  L +    V + ++F +F++  I++
Sbjct: 62  FIIAFYHAVLGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLVFAIFNISL 114


>gi|73542010|ref|YP_296530.1| succinate dehydrogenase subunit D [Ralstonia eutropha JMP134]
 gi|72119423|gb|AAZ61686.1| succinate dehydrogenase subunit D [Ralstonia eutropha JMP134]
          Length = 121

 Score = 63.9 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 44/101 (43%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+  + F +     F+    A YE    + SN  +  I  L  +S+
Sbjct: 15  AHYGLKDWLAQRVTAVIMVVFTVILAIAFLLSNGASYEAWAGLFSNQWMKIITFLTILSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DY+    ++++   +   +++    +  
Sbjct: 75  LYHAWIGVRDIWMDYVKPMAVRLVLQVLTILWLVGCAGYAA 115


>gi|113868592|ref|YP_727081.1| succinate dehydrogenase (hydrophobic anchor subunit) [Ralstonia
           eutropha H16]
 gi|33320237|gb|AAQ05855.1| SdhD protein [Cupriavidus necator]
 gi|113527368|emb|CAJ93713.1| succinate dehydrogenase (hydrophobic anchor subunit) [Ralstonia
           eutropha H16]
          Length = 121

 Score = 63.9 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 44/101 (43%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+  + F +     F+    A YE    + SN  +  I  L  +S+
Sbjct: 15  AHYGLKDWLAQRVTAVIMVVFTVVLAIAFLLSNGASYEAWAGLFSNQWMKIITFLTILSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DY+    ++++   +   +++    +  
Sbjct: 75  LYHAWIGVRDIWMDYVRPMAVRLVLQVLTILWLVGCAGYAA 115


>gi|88607526|ref|YP_505560.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Anaplasma phagocytophilum HZ]
 gi|46361035|gb|AAS89250.1| succinate dehydrogenase subunit D [Anaplasma phagocytophilum]
 gi|88598589|gb|ABD44059.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Anaplasma phagocytophilum HZ]
          Length = 109

 Score = 63.9 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 24  HFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQL 83
           H+  QR TA+  +P  IF +   +    + +   +  L++    ++  L  +    H  L
Sbjct: 8   HWWMQRMTAVVMLPVPIFLVKALLV---SDFATGLLDLTHGYKGALTALFLMPAFYHGVL 64

Query: 84  GMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           G+QV++EDY+    L+   +     F +L    C+FSL+ +
Sbjct: 65  GVQVVLEDYVRSDALRAFLITFIKLFAVLT--VCVFSLVVL 103


>gi|194290223|ref|YP_002006130.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhc [Cupriavidus taiwanensis LMG 19424]
 gi|193224058|emb|CAQ70067.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Cupriavidus taiwanensis LMG 19424]
          Length = 121

 Score = 63.5 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 44/101 (43%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+  + F +     F+    A YE    + +N  +  I  L  +S+
Sbjct: 15  AHYGLKDWLAQRVTAVVMVVFTVILAIAFLLSNGASYEAWAGLFANQWMKIITFLTILSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DY+    ++++   +   +++    +  
Sbjct: 75  LYHAWIGVRDIWMDYVKPMAVRLVLQVLTILWLVGCAGYAA 115


>gi|156934785|ref|YP_001438701.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Cronobacter sakazakii ATCC BAA-894]
 gi|156533039|gb|ABU77865.1| hypothetical protein ESA_02625 [Cronobacter sakazakii ATCC BAA-894]
          Length = 115

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R T+I    +II+ I FF   GD  YE      S+        L  ISI 
Sbjct: 10  RNGVHDFILVRATSIVMTLYIIYMIGFFAMNGDLTYEVWTGFFSSTFTKVFTLLTLISIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DY+ +  L++         +++ +I+    +
Sbjct: 70  VHTWIGMWQVLTDYVKHLALRLFLQLAIVVALVVYVIYGFVVV 112


>gi|262277892|ref|ZP_06055685.1| succinate dehydrogenase, hydrophobic membrane anchor protein [alpha
           proteobacterium HIMB114]
 gi|262224995|gb|EEY75454.1| succinate dehydrogenase, hydrophobic membrane anchor protein [alpha
           proteobacterium HIMB114]
          Length = 109

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 50/102 (49%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
           ++ QR  A+  +PF+++F+  F       Y   V  L+N     I+ L  +    HM++G
Sbjct: 8   WLLQRVAAVILLPFLVWFLFHFDNLMTFSYSDAVMFLNNKIYVGILSLVFLLAFFHMRIG 67

Query: 85  MQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           M  I EDYIH   +K +   +     L++ I  + +++ + +
Sbjct: 68  MGEIFEDYIHNEKVKKIASGLILLISLIIPIAAISAMVILGL 109


>gi|260597121|ref|YP_003209692.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Cronobacter turicensis z3032]
 gi|260216298|emb|CBA29265.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Cronobacter turicensis z3032]
          Length = 115

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R T+I    +II+ I FF   GD  YE      S+        L  +SI 
Sbjct: 10  RNGVHDFILVRATSIVMTLYIIYMIGFFAMNGDLTYEVWTGFFSSTFTKVFTLLTLVSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DY+ +  L++         +++ +I+    +
Sbjct: 70  VHTWIGMWQVLTDYVKHLALRLFLQLAIVVALVVYVIYGFVVV 112


>gi|152979976|ref|YP_001353197.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Janthinobacterium sp. Marseille]
 gi|151280053|gb|ABR88463.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Janthinobacterium sp. Marseille]
          Length = 121

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 44/106 (41%)

Query: 9   LGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVAS 68
           +GR R +  A  G   ++ QR TAI  + + +  +  F+   D  YE    + +      
Sbjct: 6   IGRHRLVVGAHYGVRDWLAQRITAIVMVLYTLVLLIAFLTATDFSYEGWAGLFAQQWFKM 65

Query: 69  IMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
              +  +S+  H  +GM+ I  DYI    +++        +++   
Sbjct: 66  FTFVTFLSLFYHAWVGMRNIWMDYIKPVSIRLALQVATILWLVACA 111


>gi|82701991|ref|YP_411557.1| succinate dehydrogenase, cytochrome b subunit [Nitrosospira
           multiformis ATCC 25196]
 gi|82410056|gb|ABB74165.1| succinate dehydrogenase subunit D [Nitrosospira multiformis ATCC
           25196]
          Length = 120

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 45/107 (42%)

Query: 12  VRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMG 71
           VR +  A  G   ++ QR TA     +I+      +      Y    ++  N  +     
Sbjct: 6   VRAITGAHYGLRDWLAQRVTAAVMAIYILMLAGVLLVSPPQDYASFKTLFDNQWMRVASF 65

Query: 72  LGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           L  +S+  H  +GM+ I+ DY+H   ++++   +    +L   I+ +
Sbjct: 66  LFLLSLFWHAWIGMRNILMDYVHPAGIRLILEILVILSLLSYAIWSV 112


>gi|94499005|ref|ZP_01305543.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanobacter sp. RED65]
 gi|94428637|gb|EAT13609.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Oceanobacter sp. RED65]
          Length = 115

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 2/104 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F + F +   D  Y Q     S+ AV     L  IS 
Sbjct: 9   SRSGLSDWLIQRVSAVILALYTVFIVGFLLANPDLDYAQWKEFFSSNAVRIFSLLALIST 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFM--NSCFVLLLIIFCLF 119
             H  +GM  +  DY     ++ +F      + FV L+    + 
Sbjct: 69  VAHAWIGMWTVATDYFKPVSIRFVFQVACFLALFVYLVWGIEII 112


>gi|149911924|ref|ZP_01900523.1| hypothetical succinate dehydrogenase, hydrophobic subunit
           [Moritella sp. PE36]
 gi|149805017|gb|EDM65045.1| hypothetical succinate dehydrogenase, hydrophobic subunit
           [Moritella sp. PE36]
          Length = 114

 Score = 61.2 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 41/101 (40%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + GT  FI  R TAI    +  +F+ F   + D  Y+      ++        L  I+I 
Sbjct: 10  RSGTHDFIMIRATAIIMALYTFYFVGFVA-FNDLTYQVWSDFFASTGNKVFTLLTLIAIV 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DY+    L+    F+ +    +  +    
Sbjct: 69  IHAWIGVWQVLTDYVKSTGLRGALQFILTTTAFIYALVGFV 109


>gi|320539323|ref|ZP_08038992.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Serratia symbiotica str. Tucson]
 gi|320030448|gb|EFW12458.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Serratia symbiotica str. Tucson]
          Length = 239

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 40/87 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R ++I  I ++++ + FFI   D  YE      +         L  +SI 
Sbjct: 134 RNGVHDWLLLRASSIIIILYVLYLLGFFILAPDLTYEIWHGFFATSMTKVFTLLTLLSIL 193

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +G+  ++ DY+    ++++    
Sbjct: 194 VHAWIGLWQVLTDYVKPLAVRLVSQLA 220


>gi|294787719|ref|ZP_06752963.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Simonsiella muelleri ATCC 29453]
 gi|294484012|gb|EFG31695.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Simonsiella muelleri ATCC 29453]
          Length = 115

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 48/110 (43%), Gaps = 1/110 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMG 71
           R +  A  G   +  QR TA+  + + + F  F +    A  Y +  ++ +   V     
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVVMVLYTVLFFFFLLGMIGANDYTEWQALFNKTWVKVFTQ 63

Query: 72  LGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +  I++ +H  +G++ +  DYI    L++        +++   ++  F++
Sbjct: 64  VTFIALFLHAWVGIRDLWMDYIKPFYLRLFLQCATVVWLVGCTVYSFFAI 113


>gi|145588944|ref|YP_001155541.1| succinate dehydrogenase, cytochrome b subunit [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047350|gb|ABP33977.1| succinate dehydrogenase subunit D [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 121

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 46/101 (45%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TAI  + F I  +  +   G A YE   S+ SN  +  +  L  IS+
Sbjct: 15  AHYGLKEWIIQRVTAIVMVVFTIVLLVDYCITGSATYEGWSSLFSNQFMKLLTLLAFISL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DYI    +++    +   +++    + +
Sbjct: 75  FYHAWIGIRDIWMDYIKPVSIRLTLQVLTVLYLVACAAYAV 115


>gi|315497256|ref|YP_004086060.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Asticcacaulis excentricus CB 48]
 gi|315415268|gb|ADU11909.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Asticcacaulis excentricus CB 48]
          Length = 124

 Score = 60.1 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/107 (16%), Positives = 41/107 (38%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S K G G ++ +R+T++A     ++         +  YE  +S +     A ++    + 
Sbjct: 17  SEKHGAGEWLAERWTSVALFFLTLWAAWSAFGLANQGYEAALSFVKVPLNAGLLAATFVI 76

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              H  +G+   + DY        +   +    VL + +  ++   K
Sbjct: 77  TMWHTYMGLNANVLDYFPNSRALRLLNLLFCLAVLAVALGGIYLAFK 123


>gi|218694146|ref|YP_002401813.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli 55989]
 gi|218350878|emb|CAU96576.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli 55989]
          Length = 115

 Score = 60.1 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 48/103 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVVFFATSGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L++M   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|323976307|gb|EGB71397.1| succinate dehydrogenase [Escherichia coli TW10509]
          Length = 115

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 48/103 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATTGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L++M   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|209363839|ref|YP_001424000.2| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           Dugway 5J108-111]
 gi|215919175|ref|NP_820387.2| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           RSA 493]
 gi|218512006|sp|P51057|DHSD_COXBU RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|206584059|gb|AAO90901.2| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           RSA 493]
 gi|207081772|gb|ABS78118.2| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           Dugway 5J108-111]
          Length = 115

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           +++ G   +  QR TA+ +  + +F I F + +    Y Q  ++ S++ +     +   S
Sbjct: 7   TSRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFTLIVIFS 66

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           I  H  +GM  I  DY+  + +++    + +   LLL+ + ++++
Sbjct: 67  ILWHAWIGMWTIFTDYVKNKPIRLA---LETLVCLLLVGYFVWAI 108


>gi|16128697|ref|NP_415250.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. MG1655]
 gi|24112002|ref|NP_706512.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella flexneri 2a str. 301]
 gi|26246690|ref|NP_752730.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli CFT073]
 gi|30062115|ref|NP_836286.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella flexneri 2a str. 2457T]
 gi|74311246|ref|YP_309665.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sonnei Ss046]
 gi|82543149|ref|YP_407096.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella boydii Sb227]
 gi|82775990|ref|YP_402337.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella dysenteriae Sd197]
 gi|89107580|ref|AP_001360.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. W3110]
 gi|91209756|ref|YP_539742.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli UTI89]
 gi|110640931|ref|YP_668659.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli 536]
 gi|110804650|ref|YP_688170.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella flexneri 5 str. 8401]
 gi|117622916|ref|YP_851829.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli APEC O1]
 gi|157156814|ref|YP_001461882.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli E24377A]
 gi|157160202|ref|YP_001457520.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli HS]
 gi|170020933|ref|YP_001725887.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli ATCC 8739]
 gi|170080389|ref|YP_001729709.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170684264|ref|YP_001742823.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli SMS-3-5]
 gi|188494894|ref|ZP_03002164.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 53638]
 gi|191167187|ref|ZP_03029006.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B7A]
 gi|191174074|ref|ZP_03035590.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli F11]
 gi|193065515|ref|ZP_03046583.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E22]
 gi|193070649|ref|ZP_03051586.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E110019]
 gi|194429057|ref|ZP_03061588.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B171]
 gi|194433999|ref|ZP_03066270.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1012]
 gi|194439238|ref|ZP_03071318.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 101-1]
 gi|209917973|ref|YP_002292057.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli SE11]
 gi|215485741|ref|YP_002328172.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218549713|ref|YP_002383504.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia fergusonii ATCC 35469]
 gi|218553249|ref|YP_002386162.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli IAI1]
 gi|218557638|ref|YP_002390551.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli S88]
 gi|218688516|ref|YP_002396728.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli ED1a]
 gi|218699077|ref|YP_002406706.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli IAI39]
 gi|218704039|ref|YP_002411558.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli UMN026]
 gi|227884311|ref|ZP_04002116.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli 83972]
 gi|237707316|ref|ZP_04537797.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia sp. 3_2_53FAA]
 gi|238899987|ref|YP_002925783.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli BW2952]
 gi|253774307|ref|YP_003037138.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254160792|ref|YP_003043900.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli B str. REL606]
 gi|256021204|ref|ZP_05435069.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sp. D9]
 gi|256023676|ref|ZP_05437541.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia sp. 4_1_40B]
 gi|260842929|ref|YP_003220707.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O103:H2 str. 12009]
 gi|260853957|ref|YP_003227848.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O26:H11 str. 11368]
 gi|260866853|ref|YP_003233255.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O111:H- str. 11128]
 gi|293403966|ref|ZP_06647960.1| sdhD [Escherichia coli FVEC1412]
 gi|293409096|ref|ZP_06652672.1| succinate dehydrogenase [Escherichia coli B354]
 gi|293413999|ref|ZP_06656648.1| succinate dehydrogenase [Escherichia coli B185]
 gi|293432991|ref|ZP_06661419.1| succinate dehydrogenase [Escherichia coli B088]
 gi|297521385|ref|ZP_06939771.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli OP50]
 gi|298379742|ref|ZP_06989347.1| sdhD [Escherichia coli FVEC1302]
 gi|300816370|ref|ZP_07096592.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 107-1]
 gi|300822990|ref|ZP_07103125.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 119-7]
 gi|300900717|ref|ZP_07118866.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 198-1]
 gi|300906979|ref|ZP_07124648.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 84-1]
 gi|300918381|ref|ZP_07134981.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 115-1]
 gi|300926125|ref|ZP_07141938.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 182-1]
 gi|300929474|ref|ZP_07144942.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 187-1]
 gi|300937821|ref|ZP_07152617.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 21-1]
 gi|300947199|ref|ZP_07161409.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 116-1]
 gi|300957668|ref|ZP_07169858.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 175-1]
 gi|300989868|ref|ZP_07178997.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 45-1]
 gi|300996467|ref|ZP_07181441.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 200-1]
 gi|301020817|ref|ZP_07184881.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 69-1]
 gi|301027098|ref|ZP_07190470.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 196-1]
 gi|301046046|ref|ZP_07193226.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 185-1]
 gi|301305208|ref|ZP_07211306.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 124-1]
 gi|301327914|ref|ZP_07221085.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 78-1]
 gi|301648025|ref|ZP_07247792.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 146-1]
 gi|306812869|ref|ZP_07447062.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli NC101]
 gi|307137333|ref|ZP_07496689.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli H736]
 gi|307314813|ref|ZP_07594407.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli W]
 gi|309786386|ref|ZP_07681012.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1617]
 gi|309797435|ref|ZP_07691827.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 145-7]
 gi|312965152|ref|ZP_07779389.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 2362-75]
 gi|312970799|ref|ZP_07784978.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1827-70]
 gi|331641223|ref|ZP_08342358.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H736]
 gi|331645871|ref|ZP_08346974.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M605]
 gi|331651720|ref|ZP_08352739.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M718]
 gi|331662075|ref|ZP_08362998.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA143]
 gi|331667088|ref|ZP_08367953.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA271]
 gi|331676404|ref|ZP_08377101.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H591]
 gi|331682153|ref|ZP_08382775.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H299]
 gi|332282430|ref|ZP_08394843.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sp. D9]
 gi|81175274|sp|P0AC45|DHSD_ECOL6 RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|81175275|sp|P0AC44|DHSD_ECOLI RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|81175276|sp|P0AC46|DHSD_SHIFL RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|28948821|pdb|1NEK|D Chain D, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Ubiquinone Bound
 gi|28948825|pdb|1NEN|D Chain D, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Dinitrophenol-17 Inhibitor Co-Crystallized At The
           Ubiquinone Binding Site
 gi|85544087|pdb|2ACZ|D Chain D, Complex Ii (Succinate Dehydrogenase) From E. Coli With
           Atpenin A5 Inhibitor Co-Crystallized At The Ubiquinone
           Binding Site
 gi|256599503|pdb|2WDQ|D Chain D, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599507|pdb|2WDQ|H Chain H, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599511|pdb|2WDQ|L Chain L, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Carboxin Bound
 gi|256599515|pdb|2WDV|D Chain D, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|256599519|pdb|2WDV|H Chain H, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|256599523|pdb|2WDV|L Chain L, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
           Empty Quinone-Binding Pocket
 gi|259045636|pdb|2WDR|D Chain D, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|259045640|pdb|2WDR|H Chain H, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|259045644|pdb|2WDR|L Chain L, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
           Pentachlorophenol Bound
 gi|304445591|pdb|2WP9|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445595|pdb|2WP9|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445599|pdb|2WP9|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhb His207thr Mutant
 gi|304445631|pdb|2WU2|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|304445635|pdb|2WU2|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|304445639|pdb|2WU2|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhc His84met Mutant
 gi|26107089|gb|AAN79273.1|AE016757_177 Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli CFT073]
 gi|42924|emb|CAA25486.1| unnamed protein product [Escherichia coli]
 gi|146198|gb|AAA23894.1| succinate dehydrogenase [Escherichia coli K-12]
 gi|1651318|dbj|BAA35389.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K12 substr. W3110]
 gi|1786941|gb|AAC73816.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. MG1655]
 gi|24050818|gb|AAN42219.1| succinate dehydrogenase, hydrophobic subunit [Shigella flexneri 2a
           str. 301]
 gi|30040360|gb|AAP16092.1| succinate dehydrogenase, hydrophobic subunit [Shigella flexneri 2a
           str. 2457T]
 gi|73854723|gb|AAZ87430.1| succinate dehydrogenase, hydrophobic subunit [Shigella sonnei
           Ss046]
 gi|81240138|gb|ABB60848.1| succinate dehydrogenase, hydrophobic subunit [Shigella dysenteriae
           Sd197]
 gi|81244560|gb|ABB65268.1| succinate dehydrogenase, hydrophobic subunit [Shigella boydii
           Sb227]
 gi|91071330|gb|ABE06211.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli
           UTI89]
 gi|110342523|gb|ABG68760.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 536]
 gi|110614198|gb|ABF02865.1| succinate dehydrogenase, hydrophobic subunit [Shigella flexneri 5
           str. 8401]
 gi|115512040|gb|ABJ00115.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli APEC O1]
 gi|157065882|gb|ABV05137.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli HS]
 gi|157078844|gb|ABV18552.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E24377A]
 gi|169755861|gb|ACA78560.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli ATCC 8739]
 gi|169888224|gb|ACB01931.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170521982|gb|ACB20160.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli SMS-3-5]
 gi|188490093|gb|EDU65196.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 53638]
 gi|190902735|gb|EDV62465.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B7A]
 gi|190905682|gb|EDV65305.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli F11]
 gi|192926804|gb|EDV81430.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E22]
 gi|192956037|gb|EDV86503.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E110019]
 gi|194412888|gb|EDX29179.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli B171]
 gi|194417764|gb|EDX33862.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1012]
 gi|194421823|gb|EDX37830.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 101-1]
 gi|209911232|dbj|BAG76306.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli SE11]
 gi|215263813|emb|CAS08150.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218357254|emb|CAQ89889.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia fergusonii ATCC 35469]
 gi|218360017|emb|CAQ97564.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli IAI1]
 gi|218364407|emb|CAR02087.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli S88]
 gi|218369063|emb|CAR16817.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli IAI39]
 gi|218426080|emb|CAR06898.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli ED1a]
 gi|218431136|emb|CAR12012.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli UMN026]
 gi|222032459|emb|CAP75198.1| Succinate dehydrogenase hydrophobic membrane anchor [Escherichia
           coli LF82]
 gi|226898526|gb|EEH84785.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia sp. 3_2_53FAA]
 gi|227838397|gb|EEJ48863.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli 83972]
 gi|238863589|gb|ACR65587.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli BW2952]
 gi|242376484|emb|CAQ31188.1| succinate dehydrogenase membrane protein, subunit of succinate
           dehydrogenase [Escherichia coli BL21(DE3)]
 gi|253325351|gb|ACT29953.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972693|gb|ACT38364.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli B str. REL606]
 gi|253976887|gb|ACT42557.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli BL21(DE3)]
 gi|257752606|dbj|BAI24108.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O26:H11 str. 11368]
 gi|257758076|dbj|BAI29573.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O103:H2 str. 12009]
 gi|257763209|dbj|BAI34704.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O111:H- str. 11128]
 gi|260450124|gb|ACX40546.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli DH1]
 gi|281177865|dbj|BAI54195.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli SE15]
 gi|281599963|gb|ADA72947.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Shigella flexneri 2002017]
 gi|284920500|emb|CBG33562.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli 042]
 gi|291323810|gb|EFE63232.1| succinate dehydrogenase [Escherichia coli B088]
 gi|291428552|gb|EFF01577.1| sdhD [Escherichia coli FVEC1412]
 gi|291434057|gb|EFF07030.1| succinate dehydrogenase [Escherichia coli B185]
 gi|291469564|gb|EFF12048.1| succinate dehydrogenase [Escherichia coli B354]
 gi|294490933|gb|ADE89689.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli IHE3034]
 gi|298279440|gb|EFI20948.1| sdhD [Escherichia coli FVEC1302]
 gi|299879432|gb|EFI87643.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 196-1]
 gi|300301963|gb|EFJ58348.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 185-1]
 gi|300304521|gb|EFJ59041.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 200-1]
 gi|300315613|gb|EFJ65397.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 175-1]
 gi|300355776|gb|EFJ71646.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 198-1]
 gi|300398463|gb|EFJ82001.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 69-1]
 gi|300401200|gb|EFJ84738.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 84-1]
 gi|300407271|gb|EFJ90809.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 45-1]
 gi|300414444|gb|EFJ97754.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 115-1]
 gi|300417824|gb|EFK01135.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 182-1]
 gi|300453185|gb|EFK16805.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 116-1]
 gi|300457186|gb|EFK20679.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 21-1]
 gi|300462583|gb|EFK26076.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 187-1]
 gi|300524531|gb|EFK45600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 119-7]
 gi|300531060|gb|EFK52122.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 107-1]
 gi|300839520|gb|EFK67280.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 124-1]
 gi|300845557|gb|EFK73317.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 78-1]
 gi|301073851|gb|EFK88657.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 146-1]
 gi|305853632|gb|EFM54071.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli NC101]
 gi|306905711|gb|EFN36239.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli W]
 gi|307552574|gb|ADN45349.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Escherichia coli ABU 83972]
 gi|307627863|gb|ADN72167.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli UM146]
 gi|308118959|gb|EFO56221.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 145-7]
 gi|308925780|gb|EFP71261.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 1617]
 gi|309700944|emb|CBJ00241.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli ETEC H10407]
 gi|310336560|gb|EFQ01727.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1827-70]
 gi|312290243|gb|EFR18126.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 2362-75]
 gi|312945247|gb|ADR26074.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|313649637|gb|EFS14061.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 2a str. 2457T]
 gi|315059965|gb|ADT74292.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli W]
 gi|315135378|dbj|BAJ42537.1| sdhD [Escherichia coli DH1]
 gi|315257639|gb|EFU37607.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 85-1]
 gi|315287164|gb|EFU46576.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 110-3]
 gi|315292035|gb|EFU51387.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 153-1]
 gi|315299239|gb|EFU58493.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 16-3]
 gi|315614596|gb|EFU95238.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 3431]
 gi|320177265|gb|EFW52271.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Shigella dysenteriae CDC 74-1112]
 gi|320179438|gb|EFW54395.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Shigella boydii ATCC 9905]
 gi|320182927|gb|EFW57796.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Shigella flexneri CDC 796-83]
 gi|320194120|gb|EFW68752.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli WV_060327]
 gi|320198159|gb|EFW72763.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli EC4100B]
 gi|323153765|gb|EFZ40012.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli EPECa14]
 gi|323158772|gb|EFZ44785.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli E128010]
 gi|323163880|gb|EFZ49690.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella sonnei 53G]
 gi|323170841|gb|EFZ56491.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli LT-68]
 gi|323180040|gb|EFZ65596.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1180]
 gi|323185119|gb|EFZ70485.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli 1357]
 gi|323191067|gb|EFZ76332.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli RN587/1]
 gi|323379475|gb|ADX51743.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli KO11]
 gi|323938300|gb|EGB34557.1| succinate dehydrogenase [Escherichia coli E1520]
 gi|323942944|gb|EGB39108.1| succinate dehydrogenase [Escherichia coli E482]
 gi|323947013|gb|EGB43027.1| succinate dehydrogenase [Escherichia coli H120]
 gi|323952719|gb|EGB48587.1| succinate dehydrogenase [Escherichia coli H252]
 gi|323958466|gb|EGB54172.1| succinate dehydrogenase [Escherichia coli H263]
 gi|323963103|gb|EGB58673.1| succinate dehydrogenase [Escherichia coli H489]
 gi|323967429|gb|EGB62849.1| succinate dehydrogenase [Escherichia coli M863]
 gi|323972007|gb|EGB67227.1| succinate dehydrogenase [Escherichia coli TA007]
 gi|324006246|gb|EGB75465.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 57-2]
 gi|324010443|gb|EGB79662.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 60-1]
 gi|324020371|gb|EGB89590.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli MS 117-3]
 gi|324114832|gb|EGC08800.1| succinate dehydrogenase [Escherichia fergusonii B253]
 gi|324116263|gb|EGC10184.1| succinate dehydrogenase [Escherichia coli E1167]
 gi|325498103|gb|EGC95962.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia fergusonii ECD227]
 gi|327254401|gb|EGE66023.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli STEC_7v]
 gi|330910471|gb|EGH38981.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli AA86]
 gi|331038021|gb|EGI10241.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H736]
 gi|331044623|gb|EGI16750.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M605]
 gi|331049998|gb|EGI22056.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli M718]
 gi|331060497|gb|EGI32461.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA143]
 gi|331065444|gb|EGI37337.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA271]
 gi|331075897|gb|EGI47194.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H591]
 gi|331080577|gb|EGI51753.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli H299]
 gi|332093782|gb|EGI98836.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella boydii 5216-82]
 gi|332096512|gb|EGJ01508.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella dysenteriae 155-74]
 gi|332097688|gb|EGJ02663.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella boydii 3594-74]
 gi|332104782|gb|EGJ08128.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella sp. D9]
 gi|332342057|gb|AEE55391.1| succinate dehydrogenase, hydrophobic membrane anchor protein SdhD
           [Escherichia coli UMNK88]
 gi|332760913|gb|EGJ91201.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 4343-70]
 gi|332761362|gb|EGJ91648.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 2747-71]
 gi|332763960|gb|EGJ94198.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-671]
 gi|332768181|gb|EGJ98366.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri 2930-71]
 gi|333007369|gb|EGK26849.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri VA-6]
 gi|333008010|gb|EGK27486.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-218]
 gi|333010163|gb|EGK29598.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-272]
 gi|333021433|gb|EGK40683.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella flexneri K-304]
          Length = 115

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 48/103 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L++M   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|331672238|ref|ZP_08373029.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA280]
 gi|331070433|gb|EGI41797.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA280]
          Length = 115

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 48/103 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L++M   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|212212229|ref|YP_002303165.1| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           CbuG_Q212]
 gi|212010639|gb|ACJ18020.1| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           CbuG_Q212]
          Length = 115

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           +++ G   +  QR TA+ +  + +F I F + +    Y Q  ++ S++ +     +   S
Sbjct: 7   TSRRGYRDWFVQRITALLSGIYAVFVIVFLLVHYPISYPQWHALFSHLIMKIFTLIVIFS 66

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           I  H  +GM  I  DY+  + +++    + +   LLL+ + ++++
Sbjct: 67  ILWHAWIGMWTIFTDYVKNKPIRLA---LETLVCLLLVGYFVWAI 108


>gi|331656739|ref|ZP_08357701.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA206]
 gi|331054987|gb|EGI26996.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli TA206]
          Length = 111

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 47/101 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +GM  ++ DY+    L++M   +    +++ +I+   
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFV 110


>gi|161829711|ref|YP_001597243.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Coxiella burnetii RSA 331]
 gi|495754|gb|AAA74132.1| succinate dehydrogenase [Coxiella burnetii]
 gi|161761578|gb|ABX77220.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Coxiella burnetii RSA 331]
          Length = 113

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           +++ G   +  QR TA+ +  + +F I F + +    Y Q  ++ S++ +     +   S
Sbjct: 5   TSRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFTLIVIFS 64

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           I  H  +GM  I  DY+  + +++    + +   LLL+ + ++++
Sbjct: 65  ILWHAWIGMWTIFTDYVKNKPIRLA---LETLVCLLLVGYFVWAI 106


>gi|94311421|ref|YP_584631.1| succinate dehydrogenase subunit D [Cupriavidus metallidurans CH34]
 gi|93355273|gb|ABF09362.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Cupriavidus metallidurans CH34]
          Length = 121

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 47/101 (46%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+  + F +   A ++ +G+  YE    + +N  +  +  L  +S+
Sbjct: 15  AHYGLKDWLAQRVTAVIMVVFTVVLAAVYLAFGNPSYEGWSGLFANQWMKILTFLTILSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DY+    ++++   +   +++    +  
Sbjct: 75  LFHAWIGVRDIWMDYVKPMAVRLVLQVLTILWLVGCAGYAA 115


>gi|212218999|ref|YP_002305786.1| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           CbuK_Q154]
 gi|212013261|gb|ACJ20641.1| succinate dehydrogenase membrane anchor subunit [Coxiella burnetii
           CbuK_Q154]
          Length = 115

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   +  QR TA+ +  + +F I F + +    Y Q  ++ S++ +     +   SI
Sbjct: 8   SRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFTLIVIFSI 67

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
             H  +GM  I  DY+  + +++    + +   LLL+ + ++++
Sbjct: 68  LWHAWIGMWTIFTDYVKNKPIRLA---LETLVCLLLVGYFVWAI 108


>gi|237730686|ref|ZP_04561167.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Citrobacter sp. 30_2]
 gi|226906225|gb|EEH92143.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Citrobacter sp. 30_2]
          Length = 115

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWTGFFSSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    ++++        +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAVRLILQLAIVVALVVYVIYGFVVV 112


>gi|254994784|ref|ZP_05276974.1| succinate dehyrdrogenase subunit D [Anaplasma marginale str.
           Mississippi]
 gi|255002909|ref|ZP_05277873.1| succinate dehyrdrogenase subunit D [Anaplasma marginale str. Puerto
           Rico]
 gi|255004037|ref|ZP_05278838.1| succinate dehyrdrogenase subunit D [Anaplasma marginale str.
           Virginia]
          Length = 109

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 42/98 (42%), Gaps = 3/98 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
           +  QR   +  +P    F  F+  YG   +E + +       +       ++   H  LG
Sbjct: 9   WWMQRIAGLVMLPVPFLFAFFYRSYG---FESVHAADYGFCASVSAIALLVAAFYHGVLG 65

Query: 85  MQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +QV++EDY+H  +L+   +     F L+ +     ++L
Sbjct: 66  VQVVLEDYVHSEVLRAFMITFFRLFALVTVCAVTLAML 103


>gi|71082949|ref|YP_265668.1| membrane portion of succinate dehydrogenase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062062|gb|AAZ21065.1| possible membrane portion of succinate dehydrogenase [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 108

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 46/103 (44%)

Query: 22  TGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           T  ++  + +++  +P +I+FI   +   D  Y ++V+  +      ++ L  +      
Sbjct: 5   TKKWLFMKISSVILVPLMIWFILNLVSIFDKDYIEVVNFFTTQPSKILVSLTLVFAYFFS 64

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
            L +  + EDYI    +K     + + F +++ I  +  +L +
Sbjct: 65  TLSISEVFEDYIQNEKIKNAANKVLNIFAIIMPIITITVILNL 107


>gi|15800426|ref|NP_286438.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 EDL933]
 gi|15830001|ref|NP_308774.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. Sakai]
 gi|168750653|ref|ZP_02775675.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|168757175|ref|ZP_02782182.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|168764003|ref|ZP_02789010.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|168767162|ref|ZP_02792169.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|168779205|ref|ZP_02804212.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|168786875|ref|ZP_02811882.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC869]
 gi|168801369|ref|ZP_02826376.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC508]
 gi|195939063|ref|ZP_03084445.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. EC4024]
 gi|208807233|ref|ZP_03249570.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208815555|ref|ZP_03256734.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208823090|ref|ZP_03263408.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209398560|ref|YP_002269345.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|217325246|ref|ZP_03441330.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254791868|ref|YP_003076705.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. TW14359]
 gi|261224423|ref|ZP_05938704.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254586|ref|ZP_05947119.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291281654|ref|YP_003498472.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Escherichia coli O55:H7 str. CB9615]
 gi|81170423|sp|Q8X9A9|DHSD_ECO57 RecName: Full=Succinate dehydrogenase hydrophobic membrane anchor
           subunit
 gi|12513637|gb|AAG55046.1|AE005250_5 succinate dehydrogenase, hydrophobic subunit [Escherichia coli
           O157:H7 str. EDL933]
 gi|13360205|dbj|BAB34170.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli
           O157:H7 str. Sakai]
 gi|188015182|gb|EDU53304.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|189002984|gb|EDU71970.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|189355801|gb|EDU74220.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|189363457|gb|EDU81876.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|189365920|gb|EDU84336.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373110|gb|EDU91526.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC869]
 gi|189376492|gb|EDU94908.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC508]
 gi|208727034|gb|EDZ76635.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208732203|gb|EDZ80891.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208737283|gb|EDZ84967.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209159960|gb|ACI37393.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|209776528|gb|ACI86576.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776530|gb|ACI86577.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776532|gb|ACI86578.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776534|gb|ACI86579.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|209776536|gb|ACI86580.1| succinate dehydrogenase hydrophobic subunit [Escherichia coli]
 gi|217321467|gb|EEC29891.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254591268|gb|ACT70629.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Escherichia coli O157:H7 str. TW14359]
 gi|290761527|gb|ADD55488.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Escherichia coli O55:H7 str. CB9615]
 gi|320193116|gb|EFW67756.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. EC1212]
 gi|320637969|gb|EFX07738.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. G5101]
 gi|320643364|gb|EFX12544.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H- str. 493-89]
 gi|320648713|gb|EFX17346.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H- str. H 2687]
 gi|320654297|gb|EFX22350.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320659930|gb|EFX27472.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664754|gb|EFX31892.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Escherichia coli O157:H7 str. LSU-61]
 gi|326341540|gb|EGD65330.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. 1044]
 gi|326345758|gb|EGD69497.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Escherichia coli O157:H7 str. 1125]
          Length = 115

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 48/103 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L++M   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|153207682|ref|ZP_01946329.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Coxiella burnetii 'MSU Goat Q177']
 gi|165918983|ref|ZP_02219069.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Coxiella burnetii RSA 334]
 gi|120576378|gb|EAX33002.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Coxiella burnetii 'MSU Goat Q177']
 gi|165917308|gb|EDR35912.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Coxiella burnetii RSA 334]
          Length = 113

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   +  QR TA+ +  + +F I F + +    Y Q  ++ S++ +     +   SI
Sbjct: 6   SRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFTLIVIFSI 65

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
             H  +GM  I  DY+  + +++    + +   LLL+ + ++++
Sbjct: 66  LWHAWIGMWTIFTDYVKNKPIRLA---LETLVCLLLVGYFVWAI 106


>gi|152969293|ref|YP_001334402.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206580925|ref|YP_002239653.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella pneumoniae 342]
 gi|238893760|ref|YP_002918494.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Klebsiella pneumoniae NTUH-K2044]
 gi|262041215|ref|ZP_06014427.1| succinate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936495|ref|YP_003440554.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella variicola At-22]
 gi|290510450|ref|ZP_06549820.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. 1_1_55]
 gi|329998779|ref|ZP_08303214.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. MS 92-3]
 gi|150954142|gb|ABR76172.1| hypothetical protein KPN_00729 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206569983|gb|ACI11759.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella pneumoniae 342]
 gi|238546076|dbj|BAH62427.1| succinate dehydrogenase hydrophobic subunit [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259041444|gb|EEW42503.1| succinate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891204|gb|ADC59522.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella variicola At-22]
 gi|289777166|gb|EFD85164.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. 1_1_55]
 gi|328538565|gb|EGF64670.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Klebsiella sp. MS 92-3]
          Length = 115

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  +E      ++        L  +SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFASGFTKVFTLLALVSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L+++        ++  +++    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLVLQLAIVVALVAYVLYGFVVV 112


>gi|283784478|ref|YP_003364343.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Citrobacter rodentium ICC168]
 gi|282947932|emb|CBG87496.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Citrobacter rodentium ICC168]
          Length = 115

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  +E      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGNLTWEAWTGFFSSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    +++         +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAIRLGLQLAIVVALVVYVIYGFVVV 112


>gi|134094983|ref|YP_001100058.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Herminiimonas arsenicoxydans]
 gi|133738886|emb|CAL61933.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Herminiimonas arsenicoxydans]
          Length = 121

 Score = 58.1 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 2/100 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TAI  I + +  +  F+   D  YE    + +         +  +++
Sbjct: 15  AHYGLKDWLAQRVTAIIMIVYTVVLLVAFLLASDFSYEGWAGLFAQQWFKMFTFVTFLAL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
             H  +GM+ I  DYI    ++++        V L+    
Sbjct: 75  FYHAWVGMRNIWMDYIKPVSIRLILQVAT--IVWLVACAG 112


>gi|16759672|ref|NP_455289.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|16764103|ref|NP_459718.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|29142555|ref|NP_805897.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56414150|ref|YP_151225.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|161615041|ref|YP_001589006.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|167552849|ref|ZP_02346600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167993009|ref|ZP_02574104.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168230611|ref|ZP_02655669.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168238876|ref|ZP_02663934.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168240584|ref|ZP_02665516.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168264336|ref|ZP_02686309.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168467711|ref|ZP_02701548.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168820139|ref|ZP_02832139.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194443367|ref|YP_002039970.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194447545|ref|YP_002044763.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194471846|ref|ZP_03077830.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194733964|ref|YP_002113839.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197247879|ref|YP_002145691.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197265977|ref|ZP_03166051.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197363072|ref|YP_002142709.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|198246230|ref|YP_002214701.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200389482|ref|ZP_03216093.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204930109|ref|ZP_03221130.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|207856177|ref|YP_002242828.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|213053348|ref|ZP_03346226.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213425382|ref|ZP_03358132.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E02-1180]
 gi|213581388|ref|ZP_03363214.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213615565|ref|ZP_03371391.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
 gi|213646452|ref|ZP_03376505.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           J185]
 gi|213851936|ref|ZP_03381468.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|224582548|ref|YP_002636346.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|289824380|ref|ZP_06543973.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-3139]
 gi|25284587|pir||AI0590 succinate dehydrogenase hydrophobic membrane anchor protein
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16419243|gb|AAL19677.1| succinate dehydrogenase, hydrophobic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16501965|emb|CAD05195.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138186|gb|AAO69757.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56128407|gb|AAV77913.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|161364405|gb|ABX68173.1| hypothetical protein SPAB_02801 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402030|gb|ACF62252.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194405849|gb|ACF66068.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194458210|gb|EDX47049.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194709466|gb|ACF88687.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195629226|gb|EDX48594.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197094549|emb|CAR60069.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197211582|gb|ACH48979.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197244232|gb|EDY26852.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197288373|gb|EDY27754.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197940746|gb|ACH78079.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199601927|gb|EDZ00473.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204321103|gb|EDZ06304.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205322595|gb|EDZ10434.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205328887|gb|EDZ15651.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205334665|gb|EDZ21429.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205340151|gb|EDZ26915.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205343043|gb|EDZ29807.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205347147|gb|EDZ33778.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206707980|emb|CAR32269.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224467075|gb|ACN44905.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261245996|emb|CBG23798.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267992471|gb|ACY87356.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|301157324|emb|CBW16813.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312911759|dbj|BAJ35733.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320085001|emb|CBY94790.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321226308|gb|EFX51359.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322615834|gb|EFY12752.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322621230|gb|EFY18087.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322623650|gb|EFY20488.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322628922|gb|EFY25702.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322634902|gb|EFY31632.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322636570|gb|EFY33274.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322641779|gb|EFY38412.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322647811|gb|EFY44291.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322651859|gb|EFY48228.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322652644|gb|EFY48993.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322658452|gb|EFY54715.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322664945|gb|EFY61136.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322668385|gb|EFY64541.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322670527|gb|EFY66660.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322675267|gb|EFY71343.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322679693|gb|EFY75734.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322684831|gb|EFY80830.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|322713776|gb|EFZ05347.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323129043|gb|ADX16473.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|323193149|gb|EFZ78368.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323200600|gb|EFZ85675.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323202272|gb|EFZ87320.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323205461|gb|EFZ90427.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323213500|gb|EFZ98293.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323215334|gb|EGA00079.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323220912|gb|EGA05346.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323228079|gb|EGA12215.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323231015|gb|EGA15131.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323234152|gb|EGA18241.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323238153|gb|EGA22211.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323243588|gb|EGA27606.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323247388|gb|EGA31347.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2009159199]
 gi|323251376|gb|EGA35248.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008282]
 gi|323258485|gb|EGA42157.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008283]
 gi|323260639|gb|EGA44248.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323264711|gb|EGA48213.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008285]
 gi|323270975|gb|EGA54410.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008287]
 gi|326622457|gb|EGE28802.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|332987670|gb|AEF06653.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 115

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  +E      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    ++++   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVV 112


>gi|213023775|ref|ZP_03338222.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           404ty]
          Length = 110

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  +E      S+        L   SI 
Sbjct: 5   RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVFTLLALFSIL 64

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    ++++   +    +++ +I+    +
Sbjct: 65  IHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVV 107


>gi|311280403|ref|YP_003942634.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Enterobacter cloacae SCF1]
 gi|308749598|gb|ADO49350.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Enterobacter cloacae SCF1]
          Length = 115

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G   +E      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATTGTVTWEVWTGFFSSSFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    ++++        +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAVRLVLQLAIVVALVVYVIYGFVVV 112


>gi|73666823|ref|YP_302839.1| succinate dehydrogenase subunit D [Ehrlichia canis str. Jake]
 gi|72393964|gb|AAZ68241.1| succinate dehydrogenase subunit D [Ehrlichia canis str. Jake]
          Length = 118

 Score = 57.8 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIA---FFIKYGDAPYEQIVSVLSNVAVA--SIMGLGT 74
               H++ QR TA   +P  ++F+      +         +    S++ +    ++    
Sbjct: 4   HSVYHWLIQRATAFVLLPLSMWFLFKFVAVVSLIFKSLPDLHLCFSSIGITDLVVLLCFF 63

Query: 75  ISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +    H  LG+QVI+EDYIH  +L+     +    V+L ++F +F +L
Sbjct: 64  VFAFYHGVLGIQVILEDYIHSSILRTSVFLVIKVIVVLTVLFLVFIVL 111


>gi|170769071|ref|ZP_02903524.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia albertii TW07627]
 gi|170122143|gb|EDS91074.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Escherichia albertii TW07627]
          Length = 115

 Score = 57.8 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ ++FF   G+  Y+  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVSFFATSGELTYDVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +GM  ++ DY+    L+   L +    V+ L  + ++
Sbjct: 70  IHAWIGMWQVLTDYVKPLALR---LMLQLVIVVALGGYVIY 107


>gi|292490835|ref|YP_003526274.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosococcus halophilus Nc4]
 gi|291579430|gb|ADE13887.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosococcus halophilus Nc4]
          Length = 109

 Score = 57.8 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 47/104 (45%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G   ++ QR TA+  +  ++ F    ++     YE+    +    ++ ++ L   ++ +
Sbjct: 6   TGLRAWLVQRVTAVFMLVVLLLFFIRLVQDPFESYEEWQRWVGEPLISVLVTLFFGALLL 65

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
           H  +G++ +I DY+H   L++    +       +  + +  LL+
Sbjct: 66  HAWVGLRDVILDYVHSTPLRLFAHSLVVIGYSGIAFWIVRILLR 109


>gi|241663420|ref|YP_002981780.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12D]
 gi|240865447|gb|ACS63108.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12D]
          Length = 121

 Score = 57.8 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 45/101 (44%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   F+ QR TA+    + I  +A F+   D  Y+    + SN  +  +  L  +S+
Sbjct: 15  AHYGLKDFLAQRVTAVIMAVYTIVLLAAFLLSKDTSYQSWAGLFSNQWMKMLTFLAFVSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H  +G++ I  DY+    +++    +   +++    +  
Sbjct: 75  TYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAA 115


>gi|146310881|ref|YP_001175955.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Enterobacter sp. 638]
 gi|145317757|gb|ABP59904.1| succinate dehydrogenase subunit D [Enterobacter sp. 638]
          Length = 115

 Score = 57.8 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 44/103 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ I FF   G+  +E       +        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMIGFFATSGELTWEIWSGFFGSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    +++         +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAIRLPLQLAIVVALVVYVIYGFVVV 112


>gi|296103349|ref|YP_003613495.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|29418060|gb|AAO39686.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Enterobacter cloacae]
 gi|295057808|gb|ADF62546.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 115

 Score = 57.8 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 43/103 (41%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ I FF   G   +E       +        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWEIWSGFFGSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    +++         +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAIRLPLQLAIVVALVVYVIYGFVVV 112


>gi|187733765|ref|YP_001879377.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Shigella boydii CDC 3083-94]
 gi|187430757|gb|ACD10031.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shigella boydii CDC 3083-94]
          Length = 115

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY     L++M   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYAKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|300722383|ref|YP_003711669.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Xenorhabdus nematophila ATCC 19061]
 gi|297628886|emb|CBJ89469.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Xenorhabdus nematophila ATCC 19061]
          Length = 115

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 39/86 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI  + ++++ + F     D  YE   S  S+        L  ISI 
Sbjct: 10  RTGIQDWLLLRASAIIIVLYVLYLVGFVATTSDMTYEVWRSFFSSSLTKVFTVLTLISIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           VH  +GM  ++ DY+    L+++   
Sbjct: 70  VHAWIGMWQVLTDYVKPVALRLVLQL 95


>gi|187926534|ref|YP_001892879.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12J]
 gi|187929229|ref|YP_001899716.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12J]
 gi|241666045|ref|YP_002984404.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12D]
 gi|309783486|ref|ZP_07678187.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia sp. 5_7_47FAA]
 gi|187726119|gb|ACD27284.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12J]
 gi|187728288|gb|ACD29452.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12J]
 gi|240868072|gb|ACS65732.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia pickettii 12D]
 gi|308917744|gb|EFP63440.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ralstonia sp. 5_7_47FAA]
          Length = 121

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 45/101 (44%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   F+ QR TA+    + +  +A F+   D  Y+    + SN  +  +  L  +S+
Sbjct: 15  AHYGLKDFLAQRVTAVIMAVYTVVLLAAFLLSKDTSYQSWAGLFSNQWMKMLTFLAFVSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H  +G++ I  DY+    +++    +   +++    +  
Sbjct: 75  TYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAA 115


>gi|205351997|ref|YP_002225798.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205271778|emb|CAR36612.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326627037|gb|EGE33380.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 115

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  +E      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFAASGELTFEAWTGFFSSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DYI    ++++   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYIKPLAVRLILQLVIVVALVVYVIYGFVVV 112


>gi|85711266|ref|ZP_01042325.1| Succinate dehydrogenase, hydrophobic anchor subunit [Idiomarina
           baltica OS145]
 gi|85694767|gb|EAQ32706.1| Succinate dehydrogenase, hydrophobic anchor subunit [Idiomarina
           baltica OS145]
          Length = 115

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 47/101 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+  + +++F + FF    D  Y     + SN+ +     L    + 
Sbjct: 10  RSGPHDFILLRASAVVMLLYVLFMVGFFASTADVTYANWTGLFSNLWMKVFTLLALTGVL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+    ++    F+ S  ++++ +  LF
Sbjct: 70  VHGWIGIWQVLTDYVKASGVRAFIQFVFSVGLIIVWLTGLF 110


>gi|261341309|ref|ZP_05969167.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Enterobacter cancerogenus ATCC 35316]
 gi|288316613|gb|EFC55551.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Enterobacter cancerogenus ATCC 35316]
          Length = 115

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 43/103 (41%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ I FF   G   +E       +        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWELWSGFFGSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    +++         +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAIRLPLQLAIVVALVVYVIYGFVVV 112


>gi|56416568|ref|YP_153642.1| succinate dehyrdrogenase subunit D [Anaplasma marginale str. St.
           Maries]
 gi|222474935|ref|YP_002563350.1| succinate dehyrdrogenase subunit D [Anaplasma marginale str.
           Florida]
 gi|56387800|gb|AAV86387.1| succinate dehyrdrogenase subunit D [Anaplasma marginale str. St.
           Maries]
 gi|222419071|gb|ACM49094.1| succinate dehyrdrogenase subunit D [Anaplasma marginale str.
           Florida]
          Length = 116

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 42/98 (42%), Gaps = 3/98 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
           +  QR   +  +P    F  F+  YG   +E + +       +       ++   H  LG
Sbjct: 16  WWMQRIAGLVMLPVPFLFAFFYRSYG---FESVHAADYGFCASVSAIALLVAAFYHGVLG 72

Query: 85  MQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +QV++EDY+H  +L+   +     F L+ +     ++L
Sbjct: 73  VQVVLEDYVHSEVLRAFMITFFRLFALVTVCAVTLAML 110


>gi|114332435|ref|YP_748657.1| succinate dehydrogenase, cytochrome b subunit [Nitrosomonas
           eutropha C91]
 gi|114309449|gb|ABI60692.1| succinate dehydrogenase subunit D [Nitrosomonas eutropha C91]
          Length = 117

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 2/102 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    +    I   + Y    YE+  S+ S   V     L    +
Sbjct: 12  AHYGLRDWLVQRVTAVIMAVYTGLLIVLVVVYQPEGYEEFKSLFSIQWVKIASLLCFAGL 71

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             H  +G++ ++ DY+H   +++    M  C V LL     F
Sbjct: 72  CWHAWVGVRNVLMDYVHPMFIRLTLQVM--CIVALLGYLIWF 111


>gi|283833992|ref|ZP_06353733.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Citrobacter youngae ATCC 29220]
 gi|291070126|gb|EFE08235.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Citrobacter youngae ATCC 29220]
          Length = 115

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  +E      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEVWTGFFSSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    ++++        +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAVRLILQLAIVVALVVYVIYGFVVV 112


>gi|119897841|ref|YP_933054.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Azoarcus sp. BH72]
 gi|119670254|emb|CAL94167.1| probable succinate dehydrogenase, hydrophobic membrane anchor
           subunit [Azoarcus sp. BH72]
          Length = 114

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 38/97 (39%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TA+    + + F    +   +  Y     + SN  +     L  +S+
Sbjct: 8   AHYGLKDWIAQRATAVFMAIYTVVFAICALTLPELSYSAWSGLFSNGLMKFASFLFFLSV 67

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
             H  +G++ I  DY+    L++    +    ++   
Sbjct: 68  FYHAWIGVRDIWMDYVKPDGLRLSLHLITLFLLVGYA 104


>gi|329903474|ref|ZP_08273493.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548349|gb|EGF33034.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 121

 Score = 57.0 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 36/97 (37%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +  F K  +  Y     + S         +  +++
Sbjct: 15  AHYGLKDWLAQRITAAVMAVYTVILLVVFFKAQNFSYAGWAGMFSQQWFKIATFVTFLAL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
             H  +GM+ I  DY+    ++I        +++   
Sbjct: 75  FYHAWVGMRDIWMDYVKPVSIRISLQVATILWLIACA 111


>gi|187477681|ref|YP_785705.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Bordetella avium 197N]
 gi|115422267|emb|CAJ48791.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Bordetella avium 197N]
          Length = 127

 Score = 57.0 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 42/108 (38%), Gaps = 7/108 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVS-----VLSNVAVASIMGL 72
           A  GT  FI QR TA+    + +  I   +      YE   +     V +      +  L
Sbjct: 16  AHYGTIDFIAQRLTAVIMAVYTLVLIIGLLIMPAYNYENWKALFTFHVFAIPLGQILASL 75

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
              +++ H  +G++ I  DYI    L+++   +      L+     F+
Sbjct: 76  AFFALAWHAWIGVRDIWMDYIRPVGLRLLLQVLTVL--WLVGSVVYFA 121


>gi|17546714|ref|NP_520116.1| transmembrane succinate dehydrogenase (hydrophobic membrane anchor
           subunit) oxidoreductase [Ralstonia solanacearum GMI1000]
 gi|17429013|emb|CAD15697.1| putative transmembrane succinate dehydrogenase (hydrophobic
           membrane anchor subunit) oxidoreductase protein
           [Ralstonia solanacearum GMI1000]
          Length = 121

 Score = 57.0 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 45/101 (44%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   F+ QR TA+    + I  +A F+   D  Y+    + +N  +  +  L  +S+
Sbjct: 15  AHYGLKDFLAQRVTAVIMAVYTIVLLAAFLFSKDTSYQSWAGLFANQWMKLLTFLAFLSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H  +G++ I  DY+    +++    +   +++    +  
Sbjct: 75  TYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAA 115


>gi|225023988|ref|ZP_03713180.1| hypothetical protein EIKCOROL_00855 [Eikenella corrodens ATCC
           23834]
 gi|224943013|gb|EEG24222.1| hypothetical protein EIKCOROL_00855 [Eikenella corrodens ATCC
           23834]
          Length = 115

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  I F +      Y    +      V     +
Sbjct: 6   RKLTGAHYGLRDWAMQRATAVLMLIYTVALIVFLLALPG-DYAAWQAFFGQTWVKVFTQI 64

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    L++        ++   +++ +
Sbjct: 65  SFIALFLHAWVGIRDLWMDYIKPFGLRLFLQVATIVWLAGCMVYSV 110


>gi|295096571|emb|CBK85661.1| succinate dehydrogenase subunit D [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 115

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 44/103 (42%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ I FF   G   +E       +        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWEIWSGFFGSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIM--FLFMNSCFVLLLIIFCLF 119
           +H  +GM  ++ DY+    +++    + + +  V ++  F + 
Sbjct: 70  IHAWIGMWQVLTDYVKPLAIRLPLQLIIVVALLVYVIYGFVVV 112


>gi|92113340|ref|YP_573268.1| succinate dehydrogenase subunit D [Chromohalobacter salexigens DSM
           3043]
 gi|91796430|gb|ABE58569.1| succinate dehydrogenase subunit D [Chromohalobacter salexigens DSM
           3043]
          Length = 115

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 43/100 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR +A+    + +F + + + +    Y     + S   +     L  ISI+
Sbjct: 10  RSGLSDWLIQRISAVILAVYALFMVLYLLFHPGLDYATWSGLFSQTWMRVFSLLAFISIA 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+  +  DY+    ++  F  +    + + +++ +
Sbjct: 70  AHAWVGLWTVSTDYLKQTGVRFAFQAVVMLAIFVFLVWGV 109


>gi|304445615|pdb|2WS3|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
 gi|304445619|pdb|2WS3|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
 gi|304445623|pdb|2WS3|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
          Length = 115

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 48/103 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ D++    L++M   +    +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDFVKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|238911663|ref|ZP_04655500.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
          Length = 115

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 47/103 (45%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  +E      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIM--FLFMNSCFVLLLIIFCLF 119
           +H  +GM  ++ DY+    ++++   + + +  V ++  F + 
Sbjct: 70  IHAWIGMWQVLTDYVKPLAVRLILQLIIVVALVVYVIYGFVVV 112


>gi|114047207|ref|YP_737757.1| succinate dehydrogenase subunit D [Shewanella sp. MR-7]
 gi|113888649|gb|ABI42700.1| succinate dehydrogenase subunit D [Shewanella sp. MR-7]
          Length = 115

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  +++ 
Sbjct: 10  RSGVHDFILLRASAVILACYTIFMVGFIACSSPLTYDVWHGLFSALPMKVFTLLALVALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DY+    L+ +    F+ + F  L     + 
Sbjct: 70  IHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIV 112


>gi|299066397|emb|CBJ37582.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Ralstonia solanacearum CMR15]
          Length = 121

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 45/101 (44%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   F+ QR TA+    + +  +A F+   D  Y+    + +N  +  +  L  +S+
Sbjct: 15  AHYGLKDFLAQRVTAVIMAVYTVVLLAAFLFSKDTSYQSWAGLFANQWMKLLTFLAFLSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H  +G++ I  DY+    +++    +   +++    +  
Sbjct: 75  TYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAA 115


>gi|83748082|ref|ZP_00945111.1| Succinate dehydrogenase membrane anchor subunit [Ralstonia
           solanacearum UW551]
 gi|207723906|ref|YP_002254304.1| transmembrane succinate dehydrogenase (hydrophobic membrane anchor
           protein subunit) [Ralstonia solanacearum MolK2]
 gi|207742802|ref|YP_002259194.1| transmembrane succinate dehydrogenase (hydrophobic membrane anchor
           protein subunit) [Ralstonia solanacearum IPO1609]
 gi|300703705|ref|YP_003745307.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhc [Ralstonia solanacearum CFBP2957]
 gi|83725268|gb|EAP72417.1| Succinate dehydrogenase membrane anchor subunit [Ralstonia
           solanacearum UW551]
 gi|206589112|emb|CAQ36074.1| transmembrane succinate dehydrogenase (hydrophobic membrane anchor
           protein subunit) [Ralstonia solanacearum MolK2]
 gi|206594196|emb|CAQ61123.1| transmembrane succinate dehydrogenase (hydrophobic membrane anchor
           protein subunit) [Ralstonia solanacearum IPO1609]
 gi|299071368|emb|CBJ42687.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Ralstonia solanacearum CFBP2957]
          Length = 121

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 45/101 (44%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   F+ QR TA+    + I  +A F+   D  Y+    + +N  +  +  L  +S+
Sbjct: 15  AHYGLKDFLAQRVTAVVMAVYTIVLLAAFLFSKDTSYQSWAGLFANQWMKLLTFLAFLSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H  +G++ I  DY+    +++    +   +++    +  
Sbjct: 75  TYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAA 115


>gi|242238587|ref|YP_002986768.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Dickeya dadantii Ech703]
 gi|242130644|gb|ACS84946.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Dickeya dadantii Ech703]
          Length = 115

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++++ + F    G   YE      +         L  ISI 
Sbjct: 10  RNGVHDWLLLRASAIVIVLYVLYIVGFIASAGGITYEIWRGFFAMHLTKVFTLLTLISIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DYI    ++++        +++ +I+    +
Sbjct: 70  VHAWIGMWQVLTDYIKPLAIRLVLQLAIVVVLVVYVIYGTVVV 112


>gi|50120297|ref|YP_049464.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium atrosepticum SCRI1043]
 gi|49610823|emb|CAG74268.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Pectobacterium atrosepticum SCRI1043]
          Length = 115

 Score = 56.2 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 44/103 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++I+ I F    GD  YE      +         L   SI 
Sbjct: 10  RNGVHDWLLIRASAIVIVLYVIYLIGFIATAGDITYEIWRGFFAMALTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DYI    L++         +L+ +I+    +
Sbjct: 70  VHAWIGMWQVLTDYIKPLALRLTLQLAIVIALLVYVIYGTIVV 112


>gi|163802539|ref|ZP_02196431.1| succinate dehydrogenase flavoprotein subunit [Vibrio sp. AND4]
 gi|159173622|gb|EDP58441.1| succinate dehydrogenase flavoprotein subunit [Vibrio sp. AND4]
          Length = 114

 Score = 56.2 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 41/101 (40%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R +AI    + I+ ++FF  + D  Y       S         L  +S+ 
Sbjct: 10  RNGVHDFLLIRASAIIMTLYTIYLVSFFA-FSDISYASWTQFFSGSFTKIFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DY+    L+   L      +   +   LF
Sbjct: 69  IHAWIGLWQVLTDYVKCAKLRGALLLGVIAVLFGYVFSGLF 109


>gi|307545705|ref|YP_003898184.1| succinate dehydrogenase, D subunit [Halomonas elongata DSM 2581]
 gi|307217729|emb|CBV42999.1| succinate dehydrogenase, D subunit [Halomonas elongata DSM 2581]
          Length = 115

 Score = 56.2 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/100 (15%), Positives = 42/100 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR +AI    + +F + + +      Y     + +   +     L  +S+S
Sbjct: 10  RSGLSDWLVQRASAIVLALYTLFIVGYLLFSPGLDYATWSGLFAQTWMRIFSLLAFVSLS 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+  +  DYI    +++    +    + + +++ +
Sbjct: 70  AHAWVGLWTVTTDYIKPTGIRVAAQSIIILAIFVFLVWGI 109


>gi|148652074|ref|YP_001279167.1| succinate dehydrogenase, hydrophobic membrane anchor [Psychrobacter
           sp. PRwf-1]
 gi|148571158|gb|ABQ93217.1| succinate dehydrogenase subunit D [Psychrobacter sp. PRwf-1]
          Length = 127

 Score = 56.2 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  ++ QR +A+    + +  + FF+  GD  Y+Q VS + ++ +  +  +  I
Sbjct: 13  GLTGSGSRDWVMQRISAVVLAIYAVVMVGFFLINGDVSYQQWVSFIMSLPMRLLSLVAII 72

Query: 76  SISVHMQLGMQVIIEDYIHYRLLKIMFLFMN--SCFVLLLIIFCLF 119
           +++ H  +GM  +  DY+    L+++       +  V L     +F
Sbjct: 73  ALAAHAWVGMWTVFTDYVKSTGLRLVLQAAMIIAILVYLFWGVMIF 118


>gi|54308238|ref|YP_129258.1| putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium profundum SS9]
 gi|46912666|emb|CAG19456.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium profundum SS9]
          Length = 115

 Score = 56.2 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 43/103 (41%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    + I+ + FF    D  +E   +    ++      L  +SI 
Sbjct: 10  RNGIHDFILIRATAIILTLYTIYMVGFFAFGPDLSFETWTAFWGQLSTKVFTMLALVSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +G+  ++ DYI    L+    F     + + +    F +
Sbjct: 70  VHAWIGLWQVLTDYIKCAALRAGIQFGVVVVLFVYLFSGFFIV 112


>gi|288941678|ref|YP_003443918.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Allochromatium vinosum DSM 180]
 gi|288897050|gb|ADC62886.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Allochromatium vinosum DSM 180]
          Length = 114

 Score = 56.2 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 51/109 (46%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G   ++ QR TAI       + +  FI    A + ++V+ +++  VA  + LG   +  
Sbjct: 6   SGLMAWLLQRTTAIYLSFLAGYLLLKFIFDAPADHAELVAWVAHPLVAMALMLGVPLVLA 65

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILG 128
           H  +G++ ++ DY+    L++  +      ++   ++ + +++   I G
Sbjct: 66  HAWVGIRDVLIDYVRLTNLRVGLMTWFVFIIVASGLWFVKAIITAGIGG 114


>gi|294671246|ref|ZP_06736099.1| hypothetical protein NEIELOOT_02956 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307074|gb|EFE48317.1| hypothetical protein NEIELOOT_02956 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 114

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 1/91 (1%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMG 71
           R +  A  G   +  QR TA+  I + + F  F +    A  Y Q  +      V     
Sbjct: 4   RKLAGAHYGLRDWAAQRITAVIMIIYAVVFFLFLLGMAGAEDYSQWQAFFGKTWVKVFTQ 63

Query: 72  LGTISISVHMQLGMQVIIEDYIHYRLLKIMF 102
              I++ +H  +G++ +  DY+    L++  
Sbjct: 64  TTLIALLLHAWVGIRDLWMDYVKPFGLRLTL 94


>gi|171463738|ref|YP_001797851.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171193276|gb|ACB44237.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 121

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 44/101 (43%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I Q  TAI  + F +  +  +   G A YE    + S+  +  +  L  IS+
Sbjct: 15  AHYGLKEWIIQCVTAIVMVVFTVVLLVDYCITGSATYEGWSGLFSSQVMKLLTLLAFISL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DYI    +++    +   +++    + +
Sbjct: 75  FYHAWIGVRDIWMDYIKPVSVRLTLQVLTVLYLVACAAYAV 115


>gi|253687627|ref|YP_003016817.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754205|gb|ACT12281.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 115

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 37/87 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++I+ I F    GD  YE      S         L   SI 
Sbjct: 10  RNGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYEIWRGFFSMALTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DYI    L++     
Sbjct: 70  VHAWIGMWQVLTDYIKPLALRLTLQLA 96


>gi|256822761|ref|YP_003146724.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Kangiella koreensis DSM 16069]
 gi|256796300|gb|ACV26956.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Kangiella koreensis DSM 16069]
          Length = 117

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 45/100 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I QR +A+  + ++I+   F     +  +     + ++  +     L  +S+ 
Sbjct: 12  RSGLHDWIIQRVSALVMLAYVIYLGYFLCTTPELTFPVWQELFASTFMKVFSLLALLSVI 71

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+ ++  DY+    ++ +F  +     L L+++ +
Sbjct: 72  GHAWIGLWIVSTDYMPKLAIRFIFQVLVILICLTLLVWGI 111


>gi|28897618|ref|NP_797223.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838595|ref|ZP_01991262.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus AQ3810]
 gi|260365983|ref|ZP_05778468.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus K5030]
 gi|260878227|ref|ZP_05890582.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus AN-5034]
 gi|260895664|ref|ZP_05904160.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus Peru-466]
 gi|260901292|ref|ZP_05909687.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus AQ4037]
 gi|28805830|dbj|BAC59107.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748013|gb|EDM58872.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus AQ3810]
 gi|308088170|gb|EFO37865.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus Peru-466]
 gi|308090108|gb|EFO39803.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus AN-5034]
 gi|308109847|gb|EFO47387.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus AQ4037]
 gi|308111270|gb|EFO48810.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus K5030]
 gi|328473398|gb|EGF44246.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio parahaemolyticus 10329]
          Length = 114

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 35/101 (34%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L   S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLV-SFCAFSDISYASWTQFFGGTFTKVFTMLALASVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +GM  +  DYI    L+          +   +   LF
Sbjct: 69  IHAWIGMWQVFTDYIKCAKLRGALQLGVIAVLFGYVFSGLF 109


>gi|157146671|ref|YP_001453990.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Citrobacter koseri ATCC BAA-895]
 gi|157083876|gb|ABV13554.1| hypothetical protein CKO_02437 [Citrobacter koseri ATCC BAA-895]
          Length = 115

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +I++ + FF   G+  ++      S+        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIVYMVGFFAISGELTFDVWSGFFSSAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L+++        +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLVLQLAIVVALVVYVIYGFVVV 112


>gi|293397237|ref|ZP_06641510.1| succinate dehydrogenase [Serratia odorifera DSM 4582]
 gi|291420257|gb|EFE93513.1| succinate dehydrogenase [Serratia odorifera DSM 4582]
          Length = 115

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 37/87 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++++ + F     D  YE      +         L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVITLYVLYILGFVATAPDMTYEIWRGFFATSITKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DYI    L++M    
Sbjct: 70  VHAWIGMWQVLTDYIKPLALRLMLQLA 96


>gi|153835348|ref|ZP_01988015.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio harveyi HY01]
 gi|156973649|ref|YP_001444556.1| hypothetical protein VIBHAR_01352 [Vibrio harveyi ATCC BAA-1116]
 gi|269960706|ref|ZP_06175078.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           harveyi 1DA3]
 gi|148868139|gb|EDL67298.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio harveyi HY01]
 gi|156525243|gb|ABU70329.1| hypothetical protein VIBHAR_01352 [Vibrio harveyi ATCC BAA-1116]
 gi|269834783|gb|EEZ88870.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           harveyi 1DA3]
          Length = 114

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 37/101 (36%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R +AI    + I+ +  F  + D  Y                 L  +SI 
Sbjct: 10  RNGVHDFLLIRASAIIMTLYTIYLV-SFCAFSDISYASWTQFFGGTFTKVFTMLALVSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          +   +   LF
Sbjct: 69  IHAWIGLWQVLTDYIKCAKLRGALQLGVIAVLFGYVFSGLF 109


>gi|149191109|ref|ZP_01869368.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio shilonii AK1]
 gi|148835037|gb|EDL52015.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio shilonii AK1]
          Length = 115

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 39/98 (39%), Gaps = 2/98 (2%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ ++F    GD  Y    +            L   S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLVSFCAFAGDISYVSWTNFFGGTFTKVFTMLALASVL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIF 116
           +H  +G+  ++ DYI    L+       +   +LL  F
Sbjct: 70  IHAWIGLWQVLTDYIKCAKLRGALQL--TFIAVLLGYF 105


>gi|332306146|ref|YP_004433997.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173475|gb|AEE22729.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 115

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 45/101 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   ++  R TAI    F ++   FF+      YE    + S++ +        +S+ 
Sbjct: 10  RDGVQDYVTVRATAIIMTVFSLYMAWFFLSTETVTYEIWRGLFSSLGMKVFTFAALVSVM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H+++G   ++ DY+    L+ +  F  +    + +   LF
Sbjct: 70  LHIRIGFWQVLTDYVKSTGLRAVVQFFINLVAFVYVAVGLF 110


>gi|91762627|ref|ZP_01264592.1| possible membrane portion of succinate dehydrogenase [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718429|gb|EAS85079.1| possible membrane portion of succinate dehydrogenase [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 98

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 43/97 (44%)

Query: 28  QRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQV 87
            + +++  +P +I+FI   +   D  Y ++V+  +      ++ L  +       L +  
Sbjct: 1   MKISSVILVPLMIWFILNLVSIFDKDYIEVVNFFTTQPSKILVSLTLVFAYFFSALSISE 60

Query: 88  IIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           + EDYI    +K     + + F +++ I  +  +L +
Sbjct: 61  VFEDYIQNEKIKNAANKVLNIFAIIMPIITITVILNL 97


>gi|300691092|ref|YP_003752087.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Ralstonia solanacearum PSI07]
 gi|299078152|emb|CBJ50795.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Ralstonia solanacearum PSI07]
          Length = 121

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 44/101 (43%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   F+ QR TA+    + +  +  F+   D  Y+    + +N  +  +  +  +S+
Sbjct: 15  AHYGLKDFLAQRVTAVVMAVYTVVLLVAFLLSKDTSYQSWAGLFANQWMKLLTFVAFLSL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H  +G++ I  DY+    +++    +   +++    +  
Sbjct: 75  TYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAA 115


>gi|90021754|ref|YP_527581.1| succinate dehydrogenase subunit D [Saccharophagus degradans 2-40]
 gi|89951354|gb|ABD81369.1| succinate dehydrogenase subunit D [Saccharophagus degradans 2-40]
          Length = 122

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QRF+A+    + IF +A+ + +    YE+   +   + V     L  ISI+
Sbjct: 10  RSGLSDWVAQRFSAVVLAAYTIFIVAYLVMHPGLTYEEWSGLFQQLWVRIFTLLVLISIA 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
            H  +G+  ++ DYI  R++    LF+ +      +   +++++  A
Sbjct: 70  AHGWIGLWGVLTDYITTRMIGSSALFLRT------VALSVYAIITFA 110


>gi|297183594|gb|ADI19721.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 109

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 43/97 (44%)

Query: 22  TGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           T  +I  + +++  IP +++FI   +   +  Y  IVS  S      +  L  I    + 
Sbjct: 5   TKKWIFLKVSSVILIPLMVWFIINLVSIYEKDYIDIVSFFSTQPSKFLTSLLMIVAFFYS 64

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            L +  I EDYIH + +K +   +     +++ +  +
Sbjct: 65  SLSISEIFEDYIHDKKIKKIANKVLYILSIIIPLITI 101


>gi|227114760|ref|ZP_03828416.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
 gi|227327542|ref|ZP_03831566.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 115

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 37/87 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++I+ I F    GD  YE      +         L   SI 
Sbjct: 10  RNGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYEIWRGFFAMALTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DYI    L++     
Sbjct: 70  VHAWIGMWQVLTDYIKPLALRLTLQLA 96


>gi|161504117|ref|YP_001571229.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Salmonella enterica subsp. arizonae serovar
          62:z4,z23:-- str. RSK2980]
 gi|160865464|gb|ABX22087.1| hypothetical protein SARI_02215 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
          Length = 115

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          ++G   FI  R TAI    +II+ + FF   G+  +E   S  S+        L   SI 
Sbjct: 10 RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEVWTSFFSSAFTKVFTLLALFSIL 69

Query: 79 VHMQLGMQVIIEDYI 93
          +H  +GM  ++ DY+
Sbjct: 70 IHAWIGMWQVLTDYV 84


>gi|261822346|ref|YP_003260452.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Pectobacterium wasabiae WPP163]
 gi|261606359|gb|ACX88845.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pectobacterium wasabiae WPP163]
          Length = 115

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 37/87 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++I+ I F    GD  YE      +         L   SI 
Sbjct: 10  RNGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYEIWRGFFAMALTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DYI    L++     
Sbjct: 70  VHAWIGMWQVLTDYIKPLALRLTLQLA 96


>gi|84393481|ref|ZP_00992237.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio splendidus 12B01]
 gi|86147664|ref|ZP_01065973.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio sp. MED222]
 gi|218710214|ref|YP_002417835.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           splendidus LGP32]
 gi|84375909|gb|EAP92800.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio splendidus 12B01]
 gi|85834575|gb|EAQ52724.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio sp. MED222]
 gi|218323233|emb|CAV19410.1| Succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           splendidus LGP32]
          Length = 115

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 38/101 (37%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R TAI    + I+ ++F    GD  Y                 L   SI 
Sbjct: 10  RNGVHDYLLIRATAIIMTLYTIYLVSFCAFSGDISYASWTQFFGGTFTKVFTMLALTSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DYI    L++         +L      LF
Sbjct: 70  VHAWIGLWQVLTDYIKCAKLRVGLQVGVVAVLLGYFFSGLF 110


>gi|326794792|ref|YP_004312612.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas mediterranea MMB-1]
 gi|326545556|gb|ADZ90776.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas mediterranea MMB-1]
          Length = 115

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 45/100 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR +AI    + +F I + +   D  YEQ   +     +     +  +SI 
Sbjct: 10  RSGLYDWMMQRISAIVLALYSVFIIGYLVLNPDLTYEQWSGLFETTWMRIFSLMTLLSIG 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           +H  +G+  +  DYI    ++ +F  +    + + +++ +
Sbjct: 70  IHSWIGLWSVSTDYIKATGVRFLFQAVCGFAMFVYVVWGI 109


>gi|257093960|ref|YP_003167601.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257046484|gb|ACV35672.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 115

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 42/101 (41%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TAI    + + F+          +E    + +N  +     L  IS+
Sbjct: 9   AHYGLKDWIIQRATAIIMAIYTVIFLVVAGAVAPDSFEAWRGIFANGFMKFATFLFFISV 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DYI    L+++ + +    ++    + +
Sbjct: 69  FYHAWIGVRDIWMDYIKPAGLRLLMMIVTVAVLVGYAGWAV 109


>gi|146307529|ref|YP_001187994.1| succinate dehydrogenase subunit D [Pseudomonas mendocina ymp]
 gi|145575730|gb|ABP85262.1| succinate dehydrogenase subunit D [Pseudomonas mendocina ymp]
          Length = 122

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F + + I      Y +   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYTLFLLGYVICNPGMGYAEWHGLFSNTAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           SVH  +GM  I  DY+    L              +    +F++ 
Sbjct: 69  SVHAWVGMWTISTDYLTPMALGKWA-TGVRFLFQAVCGIAMFAMF 112


>gi|290474114|ref|YP_003466991.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Xenorhabdus bovienii SS-2004]
 gi|289173424|emb|CBJ80201.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           SdhC [Xenorhabdus bovienii SS-2004]
          Length = 115

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 39/86 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI  + ++++ + F     D  YE   S  S+        L  +SI 
Sbjct: 10  RTGIQDWLLLRASAIVIVLYVLYLVGFVATTSDITYEVWRSFFSSSLTKVFTVLALLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           VH  +GM  ++ DY+    L+++   
Sbjct: 70  VHAWIGMWQVLTDYVKPLALRLVLQL 95


>gi|262281275|ref|ZP_06059057.1| succinate dehydrogenase hydrophobic subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|299768984|ref|YP_003731010.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Acinetobacter sp. DR1]
 gi|262257506|gb|EEY76242.1| succinate dehydrogenase hydrophobic subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|298699072|gb|ADI89637.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Acinetobacter sp. DR1]
          Length = 121

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 46/110 (41%), Gaps = 4/110 (3%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +  + + +  G   Y+Q    +  + +     L  +
Sbjct: 6   GLTGSGSRDWFIQRVSAVVLAAYTVVLLGWILCKGGFDYQQWAGFMMTLPMKIFSLLAIL 65

Query: 76  SISVHMQLGMQVIIEDYIH----YRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  H  +GM  +  DY+         K + L + +  ++ + ++ ++ +
Sbjct: 66  SLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGI 115


>gi|325266126|ref|ZP_08132810.1| succinate dehydrogenase cytochrome b small subunit [Kingella
           denitrificans ATCC 33394]
 gi|324982356|gb|EGC17984.1| succinate dehydrogenase cytochrome b small subunit [Kingella
           denitrificans ATCC 33394]
          Length = 132

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 48/110 (43%), Gaps = 1/110 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAP-YEQIVSVLSNVAVASIMG 71
           R +  A  G   +  QR TA+  + + +FF  F +    A  Y +  +    V V     
Sbjct: 21  RKLAGAHYGVRDWAMQRATAVIMLLYTVFFFFFLLGLIGADDYTEWQAFFGKVWVKVFTQ 80

Query: 72  LGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +  +++ +H  +G++ +  DYI    L++        +++   I+  F++
Sbjct: 81  VTFLALFLHAWVGVRDLWMDYIKPFYLRLFLQCATVTWLVGCTIYSFFAI 130


>gi|109898116|ref|YP_661371.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with SdhC [Pseudoalteromonas atlantica T6c]
 gi|109700397|gb|ABG40317.1| succinate dehydrogenase subunit D [Pseudoalteromonas atlantica T6c]
          Length = 115

 Score = 55.5 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 46/101 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   ++  R TAI    F ++ + FF+      YE    + S++ +        +S+ 
Sbjct: 10  RDGVQDYVTVRATAIIMTAFTLYMLWFFLSTPTVTYEIWHELFSSLGMKVFTFAALVSVM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H+++G   ++ DY+    L+ +  F  +    + +   LF
Sbjct: 70  LHIRIGFWQVLTDYVKSTALRAVVQFFINLVAFVYVAVGLF 110


>gi|269959018|ref|YP_003328807.1| putative succinate dehydrogenase SdhD [Anaplasma centrale str.
           Israel]
 gi|269848849|gb|ACZ49493.1| putative succinate dehydrogenase SdhD [Anaplasma centrale str.
           Israel]
          Length = 118

 Score = 55.5 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
           +  QR   +  +P    F+ F+  YG   +E + +       +       ++   H  LG
Sbjct: 16  WWMQRIAGLVMLPVPFLFVFFYRSYG---FESVYAADYGFCASISGIALLVAAFYHGVLG 72

Query: 85  MQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           +QV++EDY+   + +   +     F  + I   + +L 
Sbjct: 73  VQVVLEDYVQSEVARAFMVTFFRLFSAVTIGAVVLALF 110


>gi|91228425|ref|ZP_01262350.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio alginolyticus 12G01]
 gi|262394886|ref|YP_003286740.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           sp. Ex25]
 gi|269966049|ref|ZP_06180140.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           alginolyticus 40B]
 gi|91188009|gb|EAS74316.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio alginolyticus 12G01]
 gi|262338480|gb|ACY52275.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           sp. Ex25]
 gi|269829356|gb|EEZ83599.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           alginolyticus 40B]
          Length = 114

 Score = 55.5 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 37/101 (36%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ I  F  + D  Y                 L  +SI 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLI-SFCAFSDISYASWTQFFGGTFTKVFTMLALVSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          +   +   LF
Sbjct: 69  IHAWVGLWQVLTDYIKCAKLRGALQLGVIAVLFGYVFSGLF 109


>gi|163856131|ref|YP_001630429.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella petrii DSM 12804]
 gi|163259859|emb|CAP42160.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella petrii]
          Length = 127

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 41/108 (37%), Gaps = 7/108 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVS-----VLSNVAVASIMGL 72
           A  G   FI QR TA+    + +  I   +      YE   +     V +      +  L
Sbjct: 16  AHYGVVDFIAQRLTAVIMAVYTLVLIIGVLVMPSFSYENWKALFTFHVYALPLGQILATL 75

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
              +++ H  +G++ I  DY+    ++++   +      L+     F+
Sbjct: 76  FFFALAWHAWIGVRDIWMDYVRPAGVRMLLQVLTIL--WLVGSIVYFA 121


>gi|271499748|ref|YP_003332773.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Dickeya dadantii Ech586]
 gi|270343303|gb|ACZ76068.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Dickeya dadantii Ech586]
          Length = 115

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 37/87 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++++ + F    G+  YE      +         L   +I 
Sbjct: 10  RNGVHDWLLLRASAIVIVLYVLYIVGFVASAGNLTYEVWRGFFAMHLTKVFTLLTLFAIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DYI    +++     
Sbjct: 70  VHAWIGMWQVLTDYIKPLAIRLTLQLA 96


>gi|152996815|ref|YP_001341650.1| succinate dehydrogenase hydrophobic membrane anchor [Marinomonas
           sp. MWYL1]
 gi|150837739|gb|ABR71715.1| Succinate dehydrogenase hydrophobic membrane anchor [Marinomonas
           sp. MWYL1]
          Length = 115

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 44/100 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR +A+    + IF I + +   D  Y+Q  ++     +     +  +SI 
Sbjct: 10  RSGLYDWMMQRVSAVVLSLYTIFIIGYLLLNPDLTYDQWSALYEATWMRIFSLMVLLSIG 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           +H  +G+  I  DYI     +  F  +    + + I++ +
Sbjct: 70  MHSWIGLWSISTDYIKATGARFFFQSLCGLVMFVYIVWGV 109


>gi|169632621|ref|YP_001706357.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter
           baumannii SDF]
 gi|169794943|ref|YP_001712736.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter
           baumannii AYE]
 gi|184159279|ref|YP_001847618.1| succinate dehydrogenase, hydrophobic anchor subunit [Acinetobacter
           baumannii ACICU]
 gi|213157652|ref|YP_002320450.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii AB0057]
 gi|215482490|ref|YP_002324676.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii AB307-0294]
 gi|239502288|ref|ZP_04661598.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii AB900]
 gi|260549002|ref|ZP_05823224.1| succinate dehydrogenase hydrophobic subunit [Acinetobacter sp.
           RUH2624]
 gi|260557309|ref|ZP_05829525.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii ATCC 19606]
 gi|293610900|ref|ZP_06693199.1| succinate dehydrogenase [Acinetobacter sp. SH024]
 gi|301346638|ref|ZP_07227379.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Acinetobacter baumannii AB056]
 gi|301512216|ref|ZP_07237453.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Acinetobacter baumannii AB058]
 gi|301595937|ref|ZP_07240945.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Acinetobacter baumannii AB059]
 gi|169147870|emb|CAM85733.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter
           baumannii AYE]
 gi|169151413|emb|CAP00144.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter
           baumannii]
 gi|183210873|gb|ACC58271.1| Succinate dehydrogenase, hydrophobic anchor subunit [Acinetobacter
           baumannii ACICU]
 gi|193078178|gb|ABO13125.2| succinate dehydrogenase hydrophobic subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|213056812|gb|ACJ41714.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii AB0057]
 gi|213986477|gb|ACJ56776.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii AB307-0294]
 gi|260408170|gb|EEX01641.1| succinate dehydrogenase hydrophobic subunit [Acinetobacter sp.
           RUH2624]
 gi|260409415|gb|EEX02717.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii ATCC 19606]
 gi|292826552|gb|EFF84918.1| succinate dehydrogenase [Acinetobacter sp. SH024]
 gi|322509192|gb|ADX04646.1| sdhD [Acinetobacter baumannii 1656-2]
 gi|323519220|gb|ADX93601.1| succinate dehydrogenase, hydrophobic anchor subunit [Acinetobacter
           baumannii TCDC-AB0715]
 gi|325123217|gb|ADY82740.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 121

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 45/110 (40%), Gaps = 4/110 (3%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +    + +  G   Y+Q    +  + +     L  +
Sbjct: 6   GLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFSLLAIL 65

Query: 76  SISVHMQLGMQVIIEDYIH----YRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  H  +GM  +  DY+         K + L + +  ++ + ++ ++ +
Sbjct: 66  SLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGI 115


>gi|332854232|ref|ZP_08435252.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii 6013150]
 gi|332866325|ref|ZP_08436930.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii 6013113]
 gi|332872540|ref|ZP_08440509.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii 6014059]
 gi|332728157|gb|EGJ59545.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii 6013150]
 gi|332734673|gb|EGJ65777.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii 6013113]
 gi|332739226|gb|EGJ70084.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter baumannii 6014059]
          Length = 126

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 45/110 (40%), Gaps = 4/110 (3%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +    + +  G   Y+Q    +  + +     L  +
Sbjct: 11  GLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFSLLAIL 70

Query: 76  SISVHMQLGMQVIIEDYIH----YRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  H  +GM  +  DY+         K + L + +  ++ + ++ ++ +
Sbjct: 71  SLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGI 120


>gi|329120252|ref|ZP_08248920.1| succinate dehydrogenase cytochrome b small subunit [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327462593|gb|EGF08916.1| succinate dehydrogenase cytochrome b small subunit [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 114

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 35/91 (38%), Gaps = 1/91 (1%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFI-IFFIAFFIKYGDAPYEQIVSVLSNVAVASIMG 71
           R +  A  G   +  QR TA+  I +  +FF+      G   Y Q  +      V     
Sbjct: 4   RKLAGAHYGLRDWAAQRITAVIMIVYAAVFFLFLIGMAGAQDYSQWQAFFGKTWVKVFTQ 63

Query: 72  LGTISISVHMQLGMQVIIEDYIHYRLLKIMF 102
               ++  H  +G++ +  DYI    L++  
Sbjct: 64  TTLFALLFHAWVGIRDLWMDYIKPFGLRLTL 94


>gi|304445643|pdb|2WU5|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
 gi|304445647|pdb|2WU5|H Chain H, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
 gi|304445651|pdb|2WU5|L Chain L, Crystal Structure Of The E. Coli Succinate:quinone
           Oxidoreductase (Sqr) Sdhd His71met Mutant
          Length = 115

 Score = 55.1 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI 
Sbjct: 10  RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +   +GM  ++ DY+    L++M   +    +++ +I+    +
Sbjct: 70  IMAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVV 112


>gi|33593354|ref|NP_880998.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella pertussis Tohama I]
 gi|33597754|ref|NP_885397.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella parapertussis 12822]
 gi|33602656|ref|NP_890216.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella bronchiseptica RB50]
 gi|33572710|emb|CAE42634.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella pertussis Tohama I]
 gi|33574183|emb|CAE38514.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella parapertussis]
 gi|33577098|emb|CAE35654.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella bronchiseptica RB50]
 gi|332382763|gb|AEE67610.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Bordetella pertussis CS]
          Length = 127

 Score = 55.1 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 41/108 (37%), Gaps = 7/108 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVS-----VLSNVAVASIMGL 72
           A  G   FI QR TA+    + +  I   +      YE   +     V +      +  L
Sbjct: 16  AHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFTFHVFALPVGQILASL 75

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
              +++ H  +G++ I  DY+    ++++   +      L+     F+
Sbjct: 76  AFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTIL--WLVGSVVYFA 121


>gi|307130094|ref|YP_003882110.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Dickeya dadantii 3937]
 gi|306527623|gb|ADM97553.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Dickeya dadantii 3937]
          Length = 115

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 37/87 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++++ + F    G+  YE      +         L   +I 
Sbjct: 10  RNGVHDWLLLRASAIVIVLYVLYIVGFVASAGNITYEVWRGFFAMHLTKVFTLLTLFAIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DYI    +++     
Sbjct: 70  VHAWIGMWQVLTDYIKPLAVRLTLQLA 96


>gi|56460612|ref|YP_155893.1| succinate dehydrogenase, hydrophobic anchor subunit [Idiomarina
           loihiensis L2TR]
 gi|56179622|gb|AAV82344.1| Succinate dehydrogenase, hydrophobic anchor subunit [Idiomarina
           loihiensis L2TR]
          Length = 115

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 46/101 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G+  FI  R +AI  + + +F   FF+   D  Y+    + +N+ +     L   S+ 
Sbjct: 10  RSGSHDFILLRASAIVMVLYSLFMAGFFLSTPDVTYQVWSGLFANIWMKVFTMLALSSVL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  +  DY+    L+     + S  ++ + +  LF
Sbjct: 70  IHGWIGIWQVSTDYVKASGLRAFIQLVFSVGLIAVWLTGLF 110


>gi|167948441|ref|ZP_02535515.1| Succinate dehydrogenase, cytochrome b subunit [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 127

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 41/82 (50%)

Query: 21  GTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           G   ++ QR +A+    +    + +FI      Y +    L++  V S + L  +++ VH
Sbjct: 7   GLQAWLFQRISAVYLGLYTPLLLLYFIVMPPQSYAEWHVFLASPWVNSSILLFALALLVH 66

Query: 81  MQLGMQVIIEDYIHYRLLKIMF 102
             +G++ ++ DY+H  LL++  
Sbjct: 67  AWVGVRDVVLDYVHPYLLRLAI 88


>gi|167566430|ref|ZP_02359346.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia oklahomensis EO147]
 gi|167573541|ref|ZP_02366415.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia oklahomensis C6786]
          Length = 122

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTATVMAIYTVILLVWFFTARDFSYEGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|311694409|gb|ADP97282.1| succinate dehydrogenase, hydrophobic membrane anchor [marine
           bacterium HP15]
          Length = 115

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 45/100 (45%), Gaps = 1/100 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   +I QR +A     + +F + FFI   D  Y+   ++     V     L  +SI+
Sbjct: 11  RNGIQDWIIQRVSAYVLALYTLFLLGFFIS-TDVDYQTWSALFDQAWVKIFTLLALLSIA 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+  +  DY+     +++   +    V + +++ +
Sbjct: 70  GHAWVGLWTVTTDYMKSAGQRLLAQAVVILGVFVYVVWGI 109


>gi|167583943|ref|ZP_02376331.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia ubonensis Bu]
          Length = 122

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + I  +  F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTAAIMAVYTIILLVLFFGAHDFSYEGWASIFAAQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWIGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|90411596|ref|ZP_01219606.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium profundum 3TCK]
 gi|90327486|gb|EAS43839.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium profundum 3TCK]
          Length = 115

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 42/103 (40%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    + I+ + F     D  +E   +    ++      L  +SI 
Sbjct: 10  RNGIHDFILIRATAIILTLYTIYMVGFIAFGPDLSFETWTAFWGQLSTKVFTMLALLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +G+  ++ DYI    L+    F     + + +    F +
Sbjct: 70  VHAWIGLWQVLTDYIKCAALRAGIQFGVVAVLFVYLFSGFFIV 112


>gi|322833846|ref|YP_004213873.1| succinate dehydrogenase [Rahnella sp. Y9602]
 gi|321169047|gb|ADW74746.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rahnella sp. Y9602]
          Length = 115

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/103 (15%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    +I++ + F +   +  ++      S+        L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIILTLYILYILGFVVLAQELTFDVWHGFFSSSITKVFTLLALLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    +++M        +++ +++    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLAVRLMLQLAIVVVLVVYLLYGTIVV 112


>gi|302878558|ref|YP_003847122.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Gallionella capsiferriformans ES-2]
 gi|302581347|gb|ADL55358.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Gallionella capsiferriformans ES-2]
          Length = 115

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 50/104 (48%), Gaps = 3/104 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+      +   A+ +   D  Y++   + S+  V +   L  IS+
Sbjct: 9   AHYGLRDWLFQRVTAVVMAISSVTLAAYLLWQSDMDYDRWTGLFSSQPVRAFALLFLISL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
             H  +G++ I+ DY+    +++    +    VL LI++ ++S+
Sbjct: 69  FFHAWVGIRDIVMDYVKPAAVRLAIHIL---VVLALIMYSIWSV 109


>gi|30249046|ref|NP_841116.1| succinate dehydrogenase, cytochrome b subunit [Nitrosomonas
           europaea ATCC 19718]
 gi|30138663|emb|CAD84958.1| Succinate dehydrogenase, cytochrome b subunit [Nitrosomonas
           europaea ATCC 19718]
          Length = 117

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 41/102 (40%), Gaps = 2/102 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    +    I     Y    +E+  ++ S   +     L    +
Sbjct: 12  AHYGLKDWLVQRITAVLMAAYTGLLIILITVYQPESHEEFKALFSIQWMKIASLLFFAGL 71

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             H  +G++ ++ DY+H   +++      +C V LL     F
Sbjct: 72  CWHAWVGVRNVLMDYVHPMPVRLTLQI--TCIVALLGYLIWF 111


>gi|37525381|ref|NP_928725.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36784808|emb|CAE13720.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 115

 Score = 54.7 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 37/87 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +A+  + ++++ + F +   D  YE      ++        L   SI 
Sbjct: 10  RTGIHDWLLLRASAMIIVLYVLYMLGFIVTTPDITYEVWRGFFASSITKVFTVLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
            H  +GM  ++ DY+    L++M    
Sbjct: 70  AHAWIGMWQVLTDYVKPLALRLMLQLA 96


>gi|296390044|ref|ZP_06879519.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas aeruginosa PAb1]
          Length = 122

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYVIFLLGYLITHPNISYADWHGLFSQGWMRIFSLLTLVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           SVH  +GM  I  DY+    L      +       +    +F+
Sbjct: 69  SVHAWVGMWTISTDYLTSMALGKAA-TVVRFLFQAVCGMAMFA 110


>gi|251790497|ref|YP_003005218.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Dickeya zeae Ech1591]
 gi|247539118|gb|ACT07739.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Dickeya zeae Ech1591]
          Length = 115

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 36/87 (41%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++++ + F    G   YE      +         L   +I 
Sbjct: 10  RNGVHDWLLIRASAIVIVLYVLYIVGFVASAGHITYEVWRGFFAMHLTKVFTLLTLFAIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DYI    +++     
Sbjct: 70  VHAWIGMWQVLTDYIKPLAIRLTLQLA 96


>gi|330811090|ref|YP_004355552.1| succinate dehydrogenase (succinate dehydrogenase hydrophobic
           membrane anchor subunit) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327379198|gb|AEA70548.1| Succinate dehydrogenase (Succinate dehydrogenase hydrophobic
           membrane anchor subunit) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 122

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 38/103 (36%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + +      Y Q   + +N  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYVVANPGLGYAQWHELFANNWMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+                   +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMAFGKSA-TAVRFLFQAVCGVAMFA 110


>gi|15596779|ref|NP_250273.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa PAO1]
 gi|116049527|ref|YP_791669.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892461|ref|YP_002441328.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa LESB58]
 gi|254234683|ref|ZP_04928006.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa C3719]
 gi|254239931|ref|ZP_04933253.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 2192]
 gi|9947545|gb|AAG04971.1|AE004586_9 succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa PAO1]
 gi|115584748|gb|ABJ10763.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166614|gb|EAZ52125.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa C3719]
 gi|126193309|gb|EAZ57372.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 2192]
 gi|218772687|emb|CAW28472.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa LESB58]
          Length = 122

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           SVH  +GM  I  DY+    L      +       +    +F+
Sbjct: 69  SVHAWVGMWTISTDYLTSMALGKAA-TVVRFLFQAVCGMAMFA 110


>gi|167840399|ref|ZP_02467083.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia thailandensis MSMB43]
          Length = 122

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTAAVMAIYTVILLVWFFTARDFSYEGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DYI    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYIKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|313106595|ref|ZP_07792822.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 39016]
 gi|310879324|gb|EFQ37918.1| succinate dehydrogenase (D subunit) [Pseudomonas aeruginosa 39016]
          Length = 124

 Score = 53.9 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 11  SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 70

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           SVH  +GM  I  DY+    L      +       +    +F+
Sbjct: 71  SVHAWVGMWTISTDYLTSMALGKAA-TVVRFLFQAVCGMAMFA 112


>gi|295700756|ref|YP_003608649.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1002]
 gi|295439969|gb|ADG19138.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1002]
          Length = 122

 Score = 53.9 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 43/101 (42%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    + +  +A+F    D  Y+   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTAVVMAVYTVILLAWFFLARDFSYDGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DY+     +++   +   ++L    +  
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGTRLVLQALTILWLLACAGYAA 116


>gi|238024242|ref|YP_002908474.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia glumae
           BGR1]
 gi|237878907|gb|ACR31239.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia glumae
           BGR1]
          Length = 122

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 44/103 (42%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    + +  +A+F    D  Y+   S+ S   +     +  +++
Sbjct: 16  AHYGLRDWLAQRITAVIMAVYTVILLAWFFSARDFSYDGWASIFSTQWMKLATFVTLLAL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGVRLVLQSLT--IVWLLACAGYAA 116


>gi|49077572|gb|AAT49694.1| PA1582 [synthetic construct]
          Length = 123

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 44/103 (42%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           SVH  +GM  I  DY+    L      +    +  +    +F+
Sbjct: 69  SVHAWVGMWTISTDYLTSMALGKAA-TVVRFLLQAVCGMAMFA 110


>gi|300715875|ref|YP_003740678.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia billingiae Eb661]
 gi|299061711|emb|CAX58827.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia billingiae Eb661]
          Length = 115

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 43/103 (41%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R  A+    ++I+ + F +  G   Y+      ++        L   SI 
Sbjct: 10  RNGVHDWLLLRAAAMIMTLYVIYILGFVVMSGTLTYDIWRGFFASNFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DYI    +++M   +    + +  I+    +
Sbjct: 70  VHGWIGMWQVLTDYIKPVAIRLMLQLVVVVALFVYAIYGTVVV 112


>gi|209520501|ref|ZP_03269259.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. H160]
 gi|209499039|gb|EDZ99136.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. H160]
          Length = 122

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 40/103 (38%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +F    D  Y+   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITAAVMAIYTVILLVWFFGAQDFSYDGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    +++         V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGVRLFLQAAT--IVWLLACAGYAA 116


>gi|270263769|ref|ZP_06192038.1| hypothetical protein SOD_e03990 [Serratia odorifera 4Rx13]
 gi|270042653|gb|EFA15748.1| hypothetical protein SOD_e03990 [Serratia odorifera 4Rx13]
          Length = 115

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++++ + FF+   D  YE      +         L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVITLYVLYILGFFVTAPDLTYEIWRGFFATSITKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +G+  ++ DY+    ++++        +L+ +++    +
Sbjct: 70  VHAWVGLWQVLTDYVKPLAVRLVLQLAIVVVLLVYLLYGTIVV 112


>gi|261210019|ref|ZP_05924318.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           sp. RC341]
 gi|260840965|gb|EEX67502.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           sp. RC341]
          Length = 114

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 39/101 (38%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R +AI  + + I+ I  F  + D  Y        +        L  +S+ 
Sbjct: 10  RNGVHDFLLIRASAIIMVLYTIY-IVSFCAFTDISYVAWTQFFGSTFTKVFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+     +    +       LF
Sbjct: 69  IHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLFGYFFSGLF 109


>gi|126668308|ref|ZP_01739267.1| Succinate dehydrogenase, hydrophobic anchor subunit [Marinobacter
           sp. ELB17]
 gi|126627225|gb|EAZ97863.1| Succinate dehydrogenase, hydrophobic anchor subunit [Marinobacter
           sp. ELB17]
          Length = 117

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/103 (15%), Positives = 38/103 (36%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR +A     + +    F I      Y+    +     +  +  +  +SI 
Sbjct: 12  RSGVADWLMQRVSAYVLALYTVVLFVFIIANPGMSYDTWAGLFGQTWMRIVTLMALLSIG 71

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM--NSCFVLLLIIFCLF 119
            H  +G+  +  DY+   L + +       + FV ++    + 
Sbjct: 72  AHAWVGLWTVTTDYMKSALPRFLVQAACGLTMFVYVVWGIQIL 114


>gi|83716544|ref|YP_438860.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia thailandensis E264]
 gi|257141947|ref|ZP_05590209.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia thailandensis E264]
 gi|83650369|gb|ABC34433.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia thailandensis E264]
          Length = 122

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTASVMAIYTVILLVWFFTARDFSYEGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|15676842|ref|NP_273987.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis MC58]
 gi|161869862|ref|YP_001599031.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria meningitidis 053442]
 gi|7226188|gb|AAF41355.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis MC58]
 gi|161595415|gb|ABX73075.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria meningitidis 053442]
 gi|308389612|gb|ADO31932.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria meningitidis alpha710]
 gi|325136115|gb|EGC58724.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis M0579]
 gi|325207984|gb|ADZ03436.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis NZ-05/33]
          Length = 113

 Score = 53.9 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 43/106 (40%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   ++ QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFSLP-KEYSAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|152984268|ref|YP_001349046.1| succinate dehydrogenase subunit D [Pseudomonas aeruginosa PA7]
 gi|150959426|gb|ABR81451.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas aeruginosa PA7]
          Length = 124

 Score = 53.9 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    ++IF + + I + +  Y     + S   +     L  +++
Sbjct: 11  SRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVAL 70

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           SVH  +GM  I  DY+    L      +       +    +F+
Sbjct: 71  SVHAWVGMWTISTDYLTPMALGKAA-TVVRFLFQAVCGMAMFA 112


>gi|70729105|ref|YP_258841.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens Pf-5]
 gi|68343404|gb|AAY91010.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens Pf-5]
          Length = 122

 Score = 53.9 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 39/103 (37%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + +      Y Q   + +N  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYLVANPGIDYTQWHGLFANNWMRIFSLLAMVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+    L              +    +F+
Sbjct: 69  GAHAWVGMWTISTDYLTPMALGKSA-TAVRFLFQAVCGVAMFA 110


>gi|332283674|ref|YP_004415585.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Pusillimonas sp. T7-7]
 gi|330427627|gb|AEC18961.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Pusillimonas sp. T7-7]
          Length = 126

 Score = 53.9 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 42/108 (38%), Gaps = 7/108 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV-----LSNVAVASIMGL 72
           A  GT  FI QR TAI    + +  +   +   +  YE    +     LS      +  L
Sbjct: 15  AHYGTLDFIAQRVTAIIMAVYTLVLLGGILFTPELNYEGWRGLFTFTCLSLPVGQMLATL 74

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             +S+  H  +G++ I  DY+    L++    +      L+     F+
Sbjct: 75  AFMSLVWHAWIGVRDIWMDYVRSAGLRLFLQVLTIL--WLVGALVYFA 120


>gi|186473181|ref|YP_001860523.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia phymatum STM815]
 gi|184195513|gb|ACC73477.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia phymatum STM815]
          Length = 122

 Score = 53.5 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 40/103 (38%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    + +  + +F       Y+    + +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITAVIMAVYTVILLGWFFGAQAFSYDGWAGIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DYI     +++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYIKPVGTRLVLQALT--IVWLLACAGYAA 116


>gi|186470390|ref|YP_001861708.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia phymatum STM815]
 gi|184196699|gb|ACC74662.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia phymatum STM815]
          Length = 122

 Score = 53.5 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 40/103 (38%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    + +  + +F       Y+    + +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITAVIMAVYTLILLGWFFGAQAFSYDGWAGIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DYI     +++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYIKPVGTRLVLQALT--IVWLLACAGYAA 116


>gi|157369507|ref|YP_001477496.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Serratia proteamaculans 568]
 gi|157321271|gb|ABV40368.1| Succinate dehydrogenase hydrophobic membrane anchor [Serratia
           proteamaculans 568]
          Length = 115

 Score = 53.5 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++++ + FF+   D  YE      +         L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVITLYVLYILGFFVTAPDLTYEIWRGFFATSITKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            H  +G+  ++ DY+    ++++        +L+ +++    +
Sbjct: 70  AHAWIGLWQVLTDYVKPVAVRLVLQLAIVVVLLVYLLYGTIVV 112


>gi|291616725|ref|YP_003519467.1| SdhD [Pantoea ananatis LMG 20103]
 gi|291151755|gb|ADD76339.1| SdhD [Pantoea ananatis LMG 20103]
 gi|327393150|dbj|BAK10572.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Pantoea ananatis AJ13355]
          Length = 115

 Score = 53.5 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 42/103 (40%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R TAI    +II+ + F +      Y+      ++        L   SI 
Sbjct: 10  RNGIQDWLLLRATAILITLYIIYLLGFVVMTDTLTYDIWRGFFASAFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+     +++   +    +L   I+    +
Sbjct: 70  IHGWIGMWQVLTDYVKPLATRLLLQLVIVVALLSYAIYGFVVV 112


>gi|145299316|ref|YP_001142157.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852088|gb|ABO90409.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 114

 Score = 53.5 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 3/103 (2%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I  R TA+    ++++ + F   + D  YE      +         L  + + 
Sbjct: 10  RSGVHDYILIRATALIMTAYVLYLVGFVA-FNDISYEVWTGFFAKTFTKVFTLLTLLCVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM--NSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+    F      FV L+  F + 
Sbjct: 69  IHAWIGLWQVLTDYIKPVGLRGALQFALVVVLFVYLMTGFVVL 111


>gi|91777243|ref|YP_552451.1| succinate dehydrogenase subunit D [Burkholderia xenovorans LB400]
 gi|91689903|gb|ABE33101.1| succinate dehydrogenase subunit D [Burkholderia xenovorans LB400]
          Length = 122

 Score = 53.5 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 40/103 (38%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITACVMAIYTVILLVWFFGARDFSYEGWSSIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+     ++    +    V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGTRLFLQALT--IVWLLACAGYAA 116


>gi|134293106|ref|YP_001116842.1| succinate dehydrogenase subunit D [Burkholderia vietnamiensis G4]
 gi|161521190|ref|YP_001584617.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|161522865|ref|YP_001585794.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|189348300|ref|YP_001941496.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|189352634|ref|YP_001948261.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|221196967|ref|ZP_03570014.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans CGD2M]
 gi|221203640|ref|ZP_03576658.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans CGD2]
 gi|221212431|ref|ZP_03585408.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans CGD1]
 gi|254253641|ref|ZP_04946958.1| Succinate dehydrogenase cytochrome b subunit [Burkholderia dolosa
           AUO158]
 gi|124898286|gb|EAY70129.1| Succinate dehydrogenase cytochrome b subunit [Burkholderia dolosa
           AUO158]
 gi|134136263|gb|ABO57377.1| succinate dehydrogenase subunit D [Burkholderia vietnamiensis G4]
 gi|160345240|gb|ABX18325.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|160346418|gb|ABX19502.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|189336656|dbj|BAG45725.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|189338438|dbj|BAG47506.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Burkholderia multivorans ATCC 17616]
 gi|221167530|gb|EED99999.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans CGD1]
 gi|221175806|gb|EEE08235.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans CGD2]
 gi|221183521|gb|EEE15921.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia multivorans CGD2M]
 gi|325525108|gb|EGD02999.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. TJI49]
          Length = 122

 Score = 53.5 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +  F    D  YE   S+ S   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFSAQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|330829372|ref|YP_004392324.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Aeromonas veronii B565]
 gi|328804508|gb|AEB49707.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Aeromonas veronii B565]
          Length = 114

 Score = 53.5 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 3/103 (2%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I  R TA+    ++++ + F   + D  YE      +         L  + + 
Sbjct: 10  RSGVHDYILIRATALIMTCYVLYLVGFVA-FNDITYEVWAGFFAKTFTKVFTLLTLLCVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM--NSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+    F      FV L+  F + 
Sbjct: 69  IHAWIGLWQVLTDYIKPVGLRGALQFALVVVLFVYLMTGFVVL 111


>gi|270157996|ref|ZP_06186653.1| succinate dehydrogenase [Legionella longbeachae D-4968]
 gi|289163738|ref|YP_003453876.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella longbeachae NSW150]
 gi|269990021|gb|EEZ96275.1| succinate dehydrogenase [Legionella longbeachae D-4968]
 gi|288856911|emb|CBJ10725.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella longbeachae NSW150]
          Length = 115

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 42/90 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
            +G   ++ QR TA+    + IF I F + +    + Q  ++ SN+ V     +   ++S
Sbjct: 10  GNGLKDWLIQRVTAVYFAVYTIFIIGFLLSHPGLSFAQWHALFSNIVVQIASIIALFALS 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSC 108
           +H  +G+  +  DY+   +L++    +   
Sbjct: 70  LHAWIGLWTVTTDYMKCTVLRVSVQMIVVL 99


>gi|123443161|ref|YP_001007135.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|238757976|ref|ZP_04619157.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Yersinia aldovae ATCC 35236]
 gi|122090122|emb|CAL12985.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|238703730|gb|EEP96266.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Yersinia aldovae ATCC 35236]
 gi|318604820|emb|CBY26318.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 115

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 38/88 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    +I++ + F +   D  YE      ++        L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVITLYILYILGFVVIVPDITYEIWRGFFASHITKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
            H  +G+  ++ DYI    ++++     
Sbjct: 70  AHAWIGLWQVLTDYIKPLAVRLVLQLAV 97


>gi|261252261|ref|ZP_05944834.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           orientalis CIP 102891]
 gi|260935652|gb|EEX91641.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           orientalis CIP 102891]
          Length = 114

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 36/101 (35%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L  +S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLV-SFCAFTDISYVSWTQFFGGTFTKVFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          +       LF
Sbjct: 69  IHAWIGLWQVLTDYIKCAKLRGGLQLAVIAVLFGYFFSGLF 109


>gi|304415183|ref|ZP_07395898.1| succinate dehydrogenase membrane subunit 2 that binds cytochrome
           b556 [Candidatus Regiella insecticola LSR1]
 gi|304282965|gb|EFL91413.1| succinate dehydrogenase membrane subunit 2 that binds cytochrome
           b556 [Candidatus Regiella insecticola LSR1]
          Length = 115

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 40/88 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++++ + F     D  YE   +  + +       L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVIFLYVLYIVGFIAIAPDITYEIWHNFFALIFTKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
           VH  +G+  ++ DY+    L+++   M 
Sbjct: 70  VHAWIGLWQVLTDYVKPLALRLVLQLMV 97


>gi|240115519|ref|ZP_04729581.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID18]
 gi|268601194|ref|ZP_06135361.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID18]
 gi|268585325|gb|EEZ50001.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID18]
          Length = 113

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 43/106 (40%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   ++ QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFALP-KEYPAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|77165930|ref|YP_344455.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosococcus oceani ATCC 19707]
 gi|76884244|gb|ABA58925.1| succinate dehydrogenase subunit D [Nitrosococcus oceani ATCC 19707]
          Length = 105

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 49/104 (47%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G   ++ QR TA+  +  ++FF+A  ++     YE     +S+  V+ ++ L    + +
Sbjct: 2   TGLRAWLVQRGTAVIMLVLLLFFLARLMQGSFKTYEAWREWISDPLVSIMVALFFGVLLL 61

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
           H  +G++ II DY+    L++    +       +  + +  LL+
Sbjct: 62  HSWVGLRDIILDYVRPVSLRLFAHSLIVVVYSGIGFWVIRILLR 105


>gi|307726506|ref|YP_003909719.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1003]
 gi|307726615|ref|YP_003909828.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1003]
 gi|307587031|gb|ADN60428.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1003]
 gi|307587140|gb|ADN60537.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1003]
          Length = 122

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +A+F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRLTACVMAIYTVILLAWFFGARDFSYEGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+     +++   +    V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGTRLLLQALT--IVWLLACAGYAA 116


>gi|117618674|ref|YP_856455.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560081|gb|ABK37029.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 114

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 3/103 (2%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I  R TA+    ++++ + F   + D  YE      +         L  + + 
Sbjct: 10  RSGVHDYILIRATALIMTCYVLYLVGFVA-FNDISYEVWTGFFAKTFTKVFTLLALLCVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM--NSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+    F      FV L+  F + 
Sbjct: 69  IHAWIGLWQVLTDYIKPVGLRGALQFALVVVLFVYLMTGFVVL 111


>gi|120598553|ref|YP_963127.1| putative succinate dehydrogenase, hydrophobic subunit [Shewanella
           sp. W3-18-1]
 gi|146293368|ref|YP_001183792.1| putative succinate dehydrogenase, hydrophobic subunit [Shewanella
           putrefaciens CN-32]
 gi|120558646|gb|ABM24573.1| succinate dehydrogenase subunit D [Shewanella sp. W3-18-1]
 gi|145565058|gb|ABP75993.1| succinate dehydrogenase subunit D [Shewanella putrefaciens CN-32]
 gi|319426670|gb|ADV54744.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella putrefaciens 200]
          Length = 115

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  +++ 
Sbjct: 10  RSGVHDFILLRASAVILACYTIFLVGFIACSSPLTYDVWHGLFSALPMKVFTLLALVALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+    L+ +    F+ + F  L     + 
Sbjct: 70  VHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIV 112


>gi|89073517|ref|ZP_01160040.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium sp. SKA34]
 gi|89050781|gb|EAR56262.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Photobacterium sp. SKA34]
          Length = 115

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 47/103 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    + ++ + FF    +  +E   +  S ++      L  +SI 
Sbjct: 10  RNGIHDFILIRATAIILTLYTVYMVGFFAFGPELTFETWSAFFSQISTKVFTMLALVSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +G+  ++ DYI   +L++   F+    + + +    F +
Sbjct: 70  VHAWIGLWQVLTDYIKPAVLRVGLQFVVVAVLFVYLFAGFFIV 112


>gi|260776542|ref|ZP_05885437.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607765|gb|EEX34030.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 114

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 36/101 (35%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L  +S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLV-SFCAFSDISYVSWTQFFGGTFTKVFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          +       LF
Sbjct: 69  IHAWIGLWQVLTDYIKCAKLRGFLQLGIIAVLFGYFFSGLF 109


>gi|120554078|ref|YP_958429.1| succinate dehydrogenase, hydrophobic anchor subunit [Marinobacter
           aquaeolei VT8]
 gi|120323927|gb|ABM18242.1| succinate dehydrogenase subunit D [Marinobacter aquaeolei VT8]
          Length = 113

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   +I QR TA     + +F + FF+   D  Y+   ++ +         L  +SI+
Sbjct: 9   RNGIQDWIIQRVTAYVLALYTLFLLGFFVT-TDVDYQAWSALFAQGWFKIFSLLALLSIA 67

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+  +  DYI   + + +        + + +++ +
Sbjct: 68  GHAWVGLWTVSTDYIKSAMPRFLLQAACVLVMFVYVVWGI 107


>gi|332970370|gb|EGK09362.1| succinate dehydrogenase cytochrome b small subunit [Kingella kingae
           ATCC 23330]
          Length = 115

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 45/110 (40%), Gaps = 1/110 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMG 71
           R +  A  G   +  QR TA+  + + +FF  F I    A  Y +  S      V     
Sbjct: 4   RKLAGAGYGLRDWAMQRATAVLMLLYTVFFFFFLIGLLGAKDYTEWQSFFGTTWVKVFTQ 63

Query: 72  LGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
              +++ +H  +G++ +  DYI    +++        +++   ++  + +
Sbjct: 64  TTFLALFLHAWVGIRDLWMDYIKPFGIRLFLQCATIIWLVACTVYSFYVI 113


>gi|170702917|ref|ZP_02893758.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia ambifaria IOP40-10]
 gi|170132176|gb|EDT00663.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia ambifaria IOP40-10]
          Length = 122

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +A F    D  YE   S+ S   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTAAIMAVYTVILLALFFGAHDFSYEGWASIFSAQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|187921486|ref|YP_001890518.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia phytofirmans PsJN]
 gi|187719924|gb|ACD21147.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia phytofirmans PsJN]
          Length = 122

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +A+F    D  Y+   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITAAVMAIYTVILLAWFFGARDFSYDGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGIRLLLQALT--IVWLLACAGYAA 116


>gi|312796840|ref|YP_004029762.1| succinate dehydrogenase membrane anchor subunit [Burkholderia
           rhizoxinica HKI 454]
 gi|312168615|emb|CBW75618.1| Succinate dehydrogenase membrane anchor subunit (EC 1.3.99.1)
           [Burkholderia rhizoxinica HKI 454]
          Length = 122

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 40/89 (44%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TA+    + +  + +F   G+  Y+   ++ S   +     +  +++
Sbjct: 16  AHYGLRDWIAQRATAMIMAIYTVILLVWFFLAGNFSYDGWAAIFSIQWMKLATFVTLLAL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
             H  +G++ I  DY+    ++++   + 
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLVLQVLT 104


>gi|115358063|ref|YP_775201.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia
           ambifaria AMMD]
 gi|171316068|ref|ZP_02905294.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia ambifaria MEX-5]
 gi|172062860|ref|YP_001810511.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia ambifaria MC40-6]
 gi|115283351|gb|ABI88867.1| succinate dehydrogenase subunit D [Burkholderia ambifaria AMMD]
 gi|171098770|gb|EDT43563.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia ambifaria MEX-5]
 gi|171995377|gb|ACB66295.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia ambifaria MC40-6]
          Length = 122

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +A F    D  YE   S+ S   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTATIMAVYTVILLALFFGAHDFSYEGWASIFSAQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|323495091|ref|ZP_08100178.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio brasiliensis LMG 20546]
 gi|323310642|gb|EGA63819.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio brasiliensis LMG 20546]
          Length = 114

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 36/101 (35%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L  +S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLV-SFCAFTDISYVSWTQFFGGTFTKVFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          +       LF
Sbjct: 69  IHAWIGLWQVLTDYIKCAKLRGGLQLGVIAVLFGYFFSGLF 109


>gi|114775455|ref|ZP_01451023.1| hypothetical protein SPV1_03983 [Mariprofundus ferrooxydans PV-1]
 gi|114553566|gb|EAU55947.1| hypothetical protein SPV1_03983 [Mariprofundus ferrooxydans PV-1]
          Length = 120

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIF-FIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLG 73
           GSA+ G   +  QR +A+     +   F+   + Y        ++ ++ +     +  + 
Sbjct: 8   GSARSGFRDWYLQRLSAVVLAVLLPLPFVVLILVYAGVVDQFGLLDIVDHFVSRLLHTIL 67

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFL 103
             ++ +H  +G++V+IEDY+     ++  +
Sbjct: 68  IFALIIHAYMGLKVMIEDYVPAIGWRVSLI 97


>gi|323498612|ref|ZP_08103604.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio sinaloensis DSM 21326]
 gi|323316310|gb|EGA69329.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio sinaloensis DSM 21326]
          Length = 114

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 36/101 (35%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L  +S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLV-SFCAFTDISYVSWTQFFGGTFTKVFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          +       LF
Sbjct: 69  IHAWIGLWQVLTDYIKCAKLRGGLQLGVIAVLFAYFFSGLF 109


>gi|107026776|ref|YP_624287.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia AU 1054]
 gi|116692032|ref|YP_837565.1| succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia HI2424]
 gi|170735975|ref|YP_001777235.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia cenocepacia MC0-3]
 gi|206562823|ref|YP_002233586.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Burkholderia cenocepacia J2315]
 gi|105896150|gb|ABF79314.1| succinate dehydrogenase subunit D [Burkholderia cenocepacia AU
           1054]
 gi|116650032|gb|ABK10672.1| succinate dehydrogenase subunit D [Burkholderia cenocepacia HI2424]
 gi|169818163|gb|ACA92745.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia cenocepacia MC0-3]
 gi|198038863|emb|CAR54825.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Burkholderia cenocepacia J2315]
          Length = 122

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +  F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFAAQWMKLATFVMLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|160872782|ref|ZP_02062914.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rickettsiella grylli]
 gi|159121581|gb|EDP46919.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rickettsiella grylli]
          Length = 127

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           + +G   ++ QR T++    +I+F +A+   +    +     + S++++     L   S+
Sbjct: 12  SGNGLRDWLIQRVTSLVLAAYILFLLAYIGYHHPLDFTTWQHLFSHLSMRLFSTLFLFSL 71

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIM--FLFMNSCFVLLLIIFCLF 119
             H  +G+  I+ DYI +  L++M     + + F+ L+    +F
Sbjct: 72  FWHAWVGLWTIVTDYIRWASLRLMVQLFIIMTLFLYLIWGLAIF 115


>gi|71892106|ref|YP_277838.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|71796212|gb|AAZ40963.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 115

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 45/102 (44%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G   ++  R +A+  + +I++   F I   +  Y++     S         +  +S   
Sbjct: 11  HGVYEWLLVRISAVWMLLYIVYISIFIISANNLSYDKWYDFFSKNTTKIFSIMVLLSALN 70

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           H  +GM+ I+EDYI   +L+ + +++    +   + F +  +
Sbjct: 71  HAWIGMRHILEDYITLPVLRQLGVWITGSILFAYLFFGMIII 112


>gi|311104830|ref|YP_003977683.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Achromobacter xylosoxidans A8]
 gi|310759519|gb|ADP14968.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Achromobacter xylosoxidans A8]
          Length = 127

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 42/108 (38%), Gaps = 7/108 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN-----VAVASIMGL 72
           A  G   FI QR TA+    + +  +   +      YE   ++ +           +  L
Sbjct: 16  AHYGVMDFIIQRITAVIMAVYTLVLLIGILMMPAFTYEHWTALFNFYVGVLPVGQILATL 75

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             I+++ H  +G++ I  DY+    ++++   +      L+     F+
Sbjct: 76  AFIALAWHAWIGVRDIWMDYVKSVGVRLLLQVLTIL--WLVGSVVYFA 121


>gi|85058851|ref|YP_454553.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Sodalis glossinidius str. 'morsitans']
 gi|84779371|dbj|BAE74148.1| succinate dehydrogenase hydrophobic subunit [Sodalis glossinidius
          str. 'morsitans']
          Length = 115

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 32/75 (42%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          ++G   ++  R +AI    +II+ + F +      Y+      +         L   SI 
Sbjct: 10 RNGVHEWLLVRASAIVICLYIIYLLGFILLADTLTYDVWRGFFATPMTKVFTLLTLFSIL 69

Query: 79 VHMQLGMQVIIEDYI 93
          VH  +GM  ++ DYI
Sbjct: 70 VHTWIGMWQVLTDYI 84


>gi|332160915|ref|YP_004297492.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665145|gb|ADZ41789.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862921|emb|CBX73056.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Yersinia enterocolitica W22703]
          Length = 115

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 38/88 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++++ + F +   D  YE      ++        L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVITLYVLYILGFVVIVPDITYEIWRGFFASHITKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
            H  +G+  ++ DYI    ++++     
Sbjct: 70  AHAWIGLWQVLTDYIKPLAVRLVLQLAV 97


>gi|330445466|ref|ZP_08309118.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489657|dbj|GAA03615.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 115

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    + ++ + FF    +  +E   +  S ++      L  +SI 
Sbjct: 10  RNGIHDFILIRATAIILTLYTVYMVGFFAFGPELTFETWSAFFSQISTKVFTMLALVSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +G+  ++ DYI   +L+    F+    + + +    F +
Sbjct: 70  VHAWIGLWQVLTDYIKPAVLRAGLQFVVVAVLFVYLFAGFFIV 112


>gi|114563517|ref|YP_751030.1| succinate dehydrogenase, cytochrome b subunit [Shewanella
           frigidimarina NCIMB 400]
 gi|2239248|emb|CAA74086.1| putative membrane anchor protein subunit [Shewanella frigidimarina
           NCIMB 400]
 gi|114334810|gb|ABI72192.1| succinate dehydrogenase subunit D [Shewanella frigidimarina NCIMB
           400]
          Length = 115

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 42/103 (40%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I  R +A+    + IF + F        +E    + +++ +     +  I++ 
Sbjct: 10  RSGVHDYILLRASAVILACYTIFLVGFIACSAPLTFEIWNGLFASLPMKVFTLITLIALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +G+  ++ DY+ +  L+ +  F         +   +  +
Sbjct: 70  IHAWIGVWQVLTDYVKHTALRGVLQFTFVLIAFSYLASGIVIV 112


>gi|325982598|ref|YP_004295000.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosomonas sp. AL212]
 gi|325532117|gb|ADZ26838.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosomonas sp. AL212]
          Length = 117

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 38/89 (42%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G+  ++ QR TAI  I ++I  ++         Y +   +     +     +  + +
Sbjct: 12  AHYGSRDWLLQRVTAILMIIYLIVLVSVLCVAAPQNYAEWKGLFQLQWLRIATFVFFMGM 71

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
             H  +G++ ++ DY+H   +++M     
Sbjct: 72  FWHAWVGVRNVLMDYVHSTPIRLMMHIAV 100


>gi|258621143|ref|ZP_05716177.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           mimicus VM573]
 gi|258626218|ref|ZP_05721066.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           mimicus VM603]
 gi|262170920|ref|ZP_06038598.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           mimicus MB-451]
 gi|262404440|ref|ZP_06080995.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           sp. RC586]
 gi|258581573|gb|EEW06474.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           mimicus VM603]
 gi|258586531|gb|EEW11246.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           mimicus VM573]
 gi|261891996|gb|EEY37982.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           mimicus MB-451]
 gi|262349472|gb|EEY98610.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           sp. RC586]
          Length = 114

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 40/101 (39%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R +AI  + + I+ I  F  + D  Y        +        L  +S+ 
Sbjct: 10  RNGVHDFLLIRASAIIMVLYTIY-IVSFCAFTDISYVAWTQFFGSTFTKVFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+     +    +L      LF
Sbjct: 69  IHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLF 109


>gi|229589334|ref|YP_002871453.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Pseudomonas fluorescens SBW25]
 gi|312959840|ref|ZP_07774356.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens WH6]
 gi|229361200|emb|CAY48064.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Pseudomonas fluorescens SBW25]
 gi|311286006|gb|EFQ64571.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas fluorescens WH6]
          Length = 122

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + +      YEQ   + S+ A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYLVANPGIGYEQWHGLFSHNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+    L              +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSA-TAVRFLFQAVCGVAMFA 110


>gi|171059386|ref|YP_001791735.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Leptothrix cholodnii SP-6]
 gi|170776831|gb|ACB34970.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Leptothrix cholodnii SP-6]
          Length = 120

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 43/101 (42%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    F +  +   +  G   YE+   + S   +  +  +  IS+
Sbjct: 14  AHYGLRDWLAQRVTAVLMALFTVALLLQVLFGGPIGYERWSGIFSQQWMKVLTFVLIISL 73

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H  +GM+ I  DYI    L++        +++    + +
Sbjct: 74  AWHAWVGMRDIWMDYIKPVGLRLSLQVFTLVWLVGTAGWAI 114


>gi|113969972|ref|YP_733765.1| succinate dehydrogenase subunit D [Shewanella sp. MR-4]
 gi|117920154|ref|YP_869346.1| succinate dehydrogenase subunit D [Shewanella sp. ANA-3]
 gi|113884656|gb|ABI38708.1| succinate dehydrogenase subunit D [Shewanella sp. MR-4]
 gi|117612486|gb|ABK47940.1| succinate dehydrogenase subunit D [Shewanella sp. ANA-3]
          Length = 115

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  +++ 
Sbjct: 10  RSGVHDFILLRASAVILACYTIFMVGFIACSSPLTYDVWHGLFSALPMKVFTLLALVALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+    L+ +    F+ + F  L     + 
Sbjct: 70  VHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIV 112


>gi|124267356|ref|YP_001021360.1| succinate dehydrogenase subunit D [Methylibium petroleiphilum PM1]
 gi|124260131|gb|ABM95125.1| succinate dehydrogenase subunit D [Methylibium petroleiphilum PM1]
          Length = 120

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 42/100 (42%), Gaps = 2/100 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     F I  IA  +      YE+   + S+  +  +  +  +S+
Sbjct: 14  AHYGLRDWLSQRVTAALMAIFTIVLIAQVLFGAPMGYERWAGIFSSQWMKVLTFVVIVSL 73

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           + H  +G++ I  DY+    ++++   +      L+    
Sbjct: 74  AWHAWVGVRDIWMDYVKPVGVRLLLQVLT--ISWLVGCAG 111


>gi|27363643|ref|NP_759171.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio vulnificus CMCP6]
 gi|37679213|ref|NP_933822.1| succinate dehydrogenase, hydrophobic anchor subunit [Vibrio
           vulnificus YJ016]
 gi|320157044|ref|YP_004189423.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           vulnificus MO6-24/O]
 gi|27359759|gb|AAO08698.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio vulnificus CMCP6]
 gi|37197956|dbj|BAC93793.1| succinate dehydrogenase, hydrophobic anchor subunit [Vibrio
           vulnificus YJ016]
 gi|319932356|gb|ADV87220.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           vulnificus MO6-24/O]
          Length = 114

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 35/101 (34%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L   S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLV-SFCAFTDINYASWTQFFGGTFTKVFTMLALASVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          +       LF
Sbjct: 69  IHAWIGLWQVLTDYIKCAKLRGGLQLGVIALLFGYFFSGLF 109


>gi|238765259|ref|ZP_04626188.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Yersinia kristensenii ATCC 33638]
 gi|238696531|gb|EEP89319.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Yersinia kristensenii ATCC 33638]
          Length = 115

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 38/88 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++++ + F +   D  YE      ++        L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVITLYVLYILGFVVIVPDITYEIWRGFFASHITKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
            H  +G+  ++ DYI    ++++     
Sbjct: 70  AHAWIGLWQVLTDYIKPIAIRLVLQLAV 97


>gi|264679526|ref|YP_003279433.1| succinate dehydrogenase, cytochrome b subunit [Comamonas
           testosteroni CNB-2]
 gi|262210039|gb|ACY34137.1| succinate dehydrogenase, cytochrome b subunit [Comamonas
           testosteroni CNB-2]
          Length = 121

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 44/105 (41%), Gaps = 6/105 (5%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTIS 76
           A  GT  F+ QR TA+    + +  +  F+  G    YEQ   + +   +  +     ++
Sbjct: 14  AHYGTRDFLAQRSTAVLMALYTVVLLVRFLTVGGPVGYEQWAGIFAPQWMKFLTLALFVA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMF-----LFMNSCFVLLLIIF 116
           +  H  +G++ I  DY+    L++       +++  C    + + 
Sbjct: 74  LGWHAWIGVRDIWMDYVKPVGLRLALQVVTIVWLVGCISWGIQVL 118


>gi|313680397|ref|YP_004058136.1| succinate dehydrogenase subunit d [Oceanithermus profundus DSM
           14977]
 gi|313153112|gb|ADR36963.1| succinate dehydrogenase subunit D [Oceanithermus profundus DSM
           14977]
          Length = 133

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 37/96 (38%), Gaps = 3/96 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIA---FFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           ++  R + +  +  ++  I      I      Y+ + S  S   +     +      +H 
Sbjct: 24  WVFMRVSGVLLVFLVLGHIYMNNIMISNTSIDYDYVASRFSQPLIKVYDLVMLALAMLHG 83

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
             G++ +I+DY+H+   +    F+    V LLI   
Sbjct: 84  TNGLRYVIDDYVHHAGWRSFIKFVLYFLVALLIATG 119


>gi|259909081|ref|YP_002649437.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Erwinia pyrifoliae Ep1/96]
 gi|224964703|emb|CAX56220.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia pyrifoliae Ep1/96]
 gi|283479107|emb|CAY75023.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia pyrifoliae DSM 12163]
 gi|310767019|gb|ADP11969.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Erwinia sp. Ejp617]
          Length = 115

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R  A+    ++++ +AF +  G   Y+      ++        L   SI 
Sbjct: 10  RNGIHDWLLLRAAAMIMTLYVLYILAFIVMSGSLTYDIWRGFFASSFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DYI    L++M   +    +L+  I+    +
Sbjct: 70  VHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVV 112


>gi|296159710|ref|ZP_06842533.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. Ch1-1]
 gi|295890154|gb|EFG69949.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. Ch1-1]
          Length = 122

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +A+F    D  Y+   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITATIMAVYTVILLAWFFGARDFSYDGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGIRLLLQALT--IVWLLACAGYAA 116


>gi|157961609|ref|YP_001501643.1| succinate dehydrogenase hydrophobic membrane anchor [Shewanella
           pealeana ATCC 700345]
 gi|157846609|gb|ABV87108.1| Succinate dehydrogenase hydrophobic membrane anchor [Shewanella
           pealeana ATCC 700345]
          Length = 117

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 41/103 (39%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  +++ 
Sbjct: 12  RSGVHDFILIRASAVVLACYTIFLVGFIACSSPLTYDVWHGLFSTLPMKVFTLLALVAVL 71

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +G+  ++ DY+    L+ +  F+        +   +  +
Sbjct: 72  VHAWIGIWQVLTDYVKCVALRGVLQFVFVIAAFSYLAAGILIV 114


>gi|146282235|ref|YP_001172388.1| succinate dehydrogenase (D subunit) [Pseudomonas stutzeri A1501]
 gi|145570440|gb|ABP79546.1| succinate dehydrogenase (D subunit) [Pseudomonas stutzeri A1501]
 gi|327480483|gb|AEA83793.1| succinate dehydrogenase (D subunit) [Pseudomonas stutzeri DSM 4166]
          Length = 122

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 40/102 (39%), Gaps = 1/102 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F + + I      Y Q  ++ S   +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFLFLLGYLIANPGLEYTQWHALFSANWMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           SVH  +GM  I  DY+    +              +    +F
Sbjct: 69  SVHAWVGMWTISTDYLTNMAIGKWA-TGVRFLFQAVCGIAMF 109


>gi|254804832|ref|YP_003083053.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria meningitidis alpha14]
 gi|254668374|emb|CBA05464.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria meningitidis alpha14]
 gi|254671328|emb|CBA08734.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria meningitidis alpha153]
 gi|254672873|emb|CBA07132.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria meningitidis alpha275]
 gi|261392703|emb|CAX50276.1| succinate dehydrogenase membrane anchor protein [Neisseria
           meningitidis 8013]
 gi|316985352|gb|EFV64301.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis H44/76]
 gi|319410282|emb|CBY90624.1| succinate dehydrogenase membrane anchor protein [Neisseria
           meningitidis WUE 2594]
 gi|325128092|gb|EGC50987.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis N1568]
 gi|325132168|gb|EGC54864.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis M6190]
 gi|325134134|gb|EGC56786.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis M13399]
 gi|325138100|gb|EGC60673.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis ES14902]
 gi|325140161|gb|EGC62688.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis CU385]
 gi|325142229|gb|EGC64647.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis 961-5945]
 gi|325144259|gb|EGC66564.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis M01-240013]
 gi|325200366|gb|ADY95821.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis H44/76]
 gi|325204021|gb|ADY99474.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis M01-240355]
 gi|325206220|gb|ADZ01673.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis M04-240196]
          Length = 113

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLP-KEYSAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSI 108


>gi|170691024|ref|ZP_02882190.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia graminis C4D1M]
 gi|170691141|ref|ZP_02882307.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia graminis C4D1M]
 gi|323529178|ref|YP_004231330.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1001]
 gi|323529266|ref|YP_004231418.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1001]
 gi|170144273|gb|EDT12435.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia graminis C4D1M]
 gi|170144390|gb|EDT12552.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia graminis C4D1M]
 gi|323386180|gb|ADX58270.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1001]
 gi|323386268|gb|ADX58358.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. CCGE1001]
          Length = 122

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +A+F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITACVMALYTVILLAWFFGARDFSYEGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGVRLLLQALT--IVWLLACAGYAA 116


>gi|78062998|ref|YP_372906.1| succinate dehydrogenase subunit D [Burkholderia sp. 383]
 gi|77970883|gb|ABB12262.1| succinate dehydrogenase subunit D [Burkholderia sp. 383]
          Length = 122

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +  F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRITATIMAVYTVILLVLFFGAHDFSYEGWASIFAAQWMKLATFVMLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|270157617|ref|ZP_06186274.1| succinate dehydrogenase [Legionella longbeachae D-4968]
 gi|289164010|ref|YP_003454148.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella longbeachae NSW150]
 gi|269989642|gb|EEZ95896.1| succinate dehydrogenase [Legionella longbeachae D-4968]
 gi|288857183|emb|CBJ11001.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella longbeachae NSW150]
          Length = 119

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 40/103 (38%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
            +G   ++ QR +A+    +      FFI +    Y  +    +   +     +   S+ 
Sbjct: 13  GNGLRDWLVQRISALILAGYFFVVFGFFILHPHLDYMGLRQFFATTWMQVFTLIALFSLF 72

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM--NSCFVLLLIIFCLF 119
           VH  +G+  +I DY+H   L++    +   + F+       + 
Sbjct: 73  VHAWVGIWTVITDYVHPVALRLSIQVLVIVTLFIYFFWGVEIL 115


>gi|330820917|ref|YP_004349779.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           gladioli BSR3]
 gi|327372912|gb|AEA64267.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           gladioli BSR3]
          Length = 122

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR T +    + +  +A+F    D  Y+   S+ +   +     +  +++
Sbjct: 16  AHYGLRDWLAQRITGVIMAVYTVILLAWFFAARDFSYDGWASIFATQWMKLATFVTLLAL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|294141509|ref|YP_003557487.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Shewanella violacea DSS12]
 gi|293327978|dbj|BAJ02709.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Shewanella violacea DSS12]
          Length = 115

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 42/103 (40%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +AI    + IF + F        Y+    + S + +     L  ++I 
Sbjct: 10  RSGVHDFILIRASAIILALYTIFVVGFIALSSPLTYDAWHGLFSALPMKVFTLLALVAIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +G+  ++ DY+   +L+ +  F+        +   +  +
Sbjct: 70  IHAWIGVWQVLTDYVKPLMLRGLLQFVVVVAAFSYLAAGILIV 112


>gi|53716138|ref|YP_106307.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei ATCC 23344]
 gi|53722740|ref|YP_111725.1| succinate dehydrogenase [Burkholderia pseudomallei K96243]
 gi|67642754|ref|ZP_00441506.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei GB8 horse 4]
 gi|76817271|ref|YP_335951.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia pseudomallei 1710b]
 gi|121597322|ref|YP_991216.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei SAVP1]
 gi|124382804|ref|YP_001025627.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei NCTC 10229]
 gi|126445800|ref|YP_001077701.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei NCTC 10247]
 gi|126458135|ref|YP_001076366.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1106a]
 gi|167000016|ref|ZP_02265843.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei PRL-20]
 gi|167724523|ref|ZP_02407759.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei DM98]
 gi|167743481|ref|ZP_02416255.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 14]
 gi|167820667|ref|ZP_02452347.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 91]
 gi|167829027|ref|ZP_02460498.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 9]
 gi|167850503|ref|ZP_02476011.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei B7210]
 gi|167899098|ref|ZP_02486499.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 7894]
 gi|167907443|ref|ZP_02494648.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei NCTC 13177]
 gi|167915781|ref|ZP_02502872.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 112]
 gi|167923620|ref|ZP_02510711.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei BCC215]
 gi|217422123|ref|ZP_03453626.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 576]
 gi|226195689|ref|ZP_03791276.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei Pakistan 9]
 gi|237509002|ref|ZP_04521717.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia pseudomallei MSHR346]
 gi|242313245|ref|ZP_04812262.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1106b]
 gi|254175975|ref|ZP_04882633.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei ATCC 10399]
 gi|254184976|ref|ZP_04891565.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1655]
 gi|254186203|ref|ZP_04892721.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254194328|ref|ZP_04900760.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei S13]
 gi|254203288|ref|ZP_04909649.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei FMH]
 gi|254205167|ref|ZP_04911520.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei JHU]
 gi|254262820|ref|ZP_04953685.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1710a]
 gi|254301257|ref|ZP_04968701.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 406e]
 gi|254359293|ref|ZP_04975565.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei 2002721280]
 gi|52213154|emb|CAH39193.1| putative succinate dehydrogenase [Burkholderia pseudomallei K96243]
 gi|52422108|gb|AAU45678.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei ATCC 23344]
 gi|76581744|gb|ABA51218.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia pseudomallei 1710b]
 gi|121225120|gb|ABM48651.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei SAVP1]
 gi|126231903|gb|ABN95316.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1106a]
 gi|126238654|gb|ABO01766.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei NCTC 10247]
 gi|147745527|gb|EDK52606.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei FMH]
 gi|147754753|gb|EDK61817.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei JHU]
 gi|148028480|gb|EDK86440.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei 2002721280]
 gi|157811301|gb|EDO88471.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 406e]
 gi|157933889|gb|EDO89559.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160697017|gb|EDP86987.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei ATCC 10399]
 gi|169651079|gb|EDS83772.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei S13]
 gi|184215568|gb|EDU12549.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1655]
 gi|217394354|gb|EEC34373.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 576]
 gi|225932174|gb|EEH28174.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei Pakistan 9]
 gi|235001207|gb|EEP50631.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia pseudomallei MSHR346]
 gi|238523945|gb|EEP87380.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei GB8 horse 4]
 gi|242136484|gb|EES22887.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1106b]
 gi|243063969|gb|EES46155.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei PRL-20]
 gi|254213822|gb|EET03207.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 1710a]
 gi|261826987|gb|ABM99623.2| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia mallei NCTC 10229]
          Length = 122

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DYI    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYIKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|170726187|ref|YP_001760213.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella woodyi ATCC 51908]
 gi|169811534|gb|ACA86118.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella woodyi ATCC 51908]
          Length = 115

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 45/103 (43%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  +++ 
Sbjct: 10  RSGVHDFILIRSSAVVLAIYTIFLVGFIACSSPLTYDAWHGLFSALPMKVFTLLALVAVL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DY+   +L+  + F+F+ + F  L     + 
Sbjct: 70  IHAWIGIWQVLTDYVKPLMLRGVLQFVFVVAAFSYLAAGILIV 112


>gi|104782664|ref|YP_609162.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas entomophila L48]
 gi|95111651|emb|CAK16372.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas entomophila L48]
          Length = 122

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 39/103 (37%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I +   +    Y Q   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYLAAHPGIDYAQWHGLFSNNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+                   +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMSFGKSA-TAIRFLFQAVCGVAMFA 110


>gi|91793540|ref|YP_563191.1| succinate dehydrogenase, cytochrome b subunit [Shewanella
           denitrificans OS217]
 gi|91715542|gb|ABE55468.1| succinate dehydrogenase subunit D [Shewanella denitrificans OS217]
          Length = 115

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I  R +A+    + IF + F        ++    + S + +     +  I++ 
Sbjct: 10  RSGVHDYILLRASAVILACYTIFLVGFIACSSPLTFDIWHGLFSTLPMKVFTLVTLIALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DY+    L+ +    F+ + F  L     + 
Sbjct: 70  IHAWIGIWQVLTDYVKSTALRGVLQFTFVVTAFSYLAAGIIIV 112


>gi|167624414|ref|YP_001674708.1| succinate dehydrogenase hydrophobic membrane anchor [Shewanella
           halifaxensis HAW-EB4]
 gi|167354436|gb|ABZ77049.1| Succinate dehydrogenase hydrophobic membrane anchor [Shewanella
           halifaxensis HAW-EB4]
          Length = 115

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 46/103 (44%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S +++     L  I++ 
Sbjct: 10  RSGVHDFILIRASAVVLAFYTIFLVGFIACSSPVTYDVWHGLFSTLSMKVFTVLALIAVL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+    L+  + F+F+ + F  L+    + 
Sbjct: 70  VHAWIGIWQVLTDYVKCISLRGVLQFVFVIAAFCYLVAGILIV 112


>gi|126174731|ref|YP_001050880.1| putative succinate dehydrogenase, hydrophobic subunit [Shewanella
           baltica OS155]
 gi|153001030|ref|YP_001366711.1| succinate dehydrogenase hydrophobic membrane anchor [Shewanella
           baltica OS185]
 gi|160875743|ref|YP_001555059.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica OS195]
 gi|217973010|ref|YP_002357761.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica OS223]
 gi|304409108|ref|ZP_07390729.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica OS183]
 gi|307303111|ref|ZP_07582866.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica BA175]
 gi|125997936|gb|ABN62011.1| succinate dehydrogenase subunit D [Shewanella baltica OS155]
 gi|151365648|gb|ABS08648.1| Succinate dehydrogenase hydrophobic membrane anchor [Shewanella
           baltica OS185]
 gi|160861265|gb|ABX49799.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica OS195]
 gi|217498145|gb|ACK46338.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica OS223]
 gi|304352929|gb|EFM17326.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica OS183]
 gi|306913471|gb|EFN43893.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica BA175]
 gi|315267932|gb|ADT94785.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Shewanella baltica OS678]
          Length = 115

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I  R +A+    + IF + F        Y+   S+ S + +     L  +++ 
Sbjct: 10  RSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVFTLLALVALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+    L+ +    F+ + F  L     + 
Sbjct: 70  VHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIV 112


>gi|317491183|ref|ZP_07949619.1| succinate dehydrogenase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920730|gb|EFV42053.1| succinate dehydrogenase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 120

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/117 (14%), Positives = 45/117 (38%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           M +   +       ++G   ++  R  AI    ++++ + F        Y       ++ 
Sbjct: 1   MVTPNSKSSASALGRNGVHDWLLLRAAAIVITLYVLYILGFIFTADSLTYGIWRGFFASN 60

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
                  L  +SI  H  +GM  ++ DYI    L+++   +    +++ +++    +
Sbjct: 61  ITKVFTVLTLVSILAHAWIGMWQVLTDYIKPLALRLILQLVIVVALVVYLVYGTLVV 117


>gi|88860186|ref|ZP_01134825.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Pseudoalteromonas tunicata D2]
 gi|88818180|gb|EAR27996.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Pseudoalteromonas tunicata D2]
          Length = 117

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 47/101 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   F+  R TA+    + +F + +FI   +  +E    + +N+A+        + + 
Sbjct: 12  RDGVQDFVSLRATALVLAAYALFILGYFIATPEVTFEAWQGLFANLAMKVFTLAALVCMM 71

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H ++G+  ++ DYI    L+ +  F+ +      +   LF
Sbjct: 72  IHTRIGLWQVLTDYIKCAKLRAILSFVLNLMAFAYVAVGLF 112


>gi|292487650|ref|YP_003530523.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia amylovora CFBP1430]
 gi|292898887|ref|YP_003538256.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia amylovora ATCC 49946]
 gi|291198735|emb|CBJ45844.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia amylovora ATCC 49946]
 gi|291553070|emb|CBA20115.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia amylovora CFBP1430]
 gi|312171758|emb|CBX80016.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia amylovora ATCC BAA-2158]
          Length = 116

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R  A+    ++++ +AF +  G   Y+      ++        L   SI 
Sbjct: 10  RNGIHDWLLLRAAAMIMTLYVLYILAFIVMSGTLTYDIWRGFFASSFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DYI    L++M   +    +L+  I+    +
Sbjct: 70  VHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVV 112


>gi|59801318|ref|YP_208030.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria gonorrhoeae FA 1090]
 gi|194098443|ref|YP_002001502.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae NCCP11945]
 gi|239998842|ref|ZP_04718766.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae 35/02]
 gi|240014243|ref|ZP_04721156.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae DGI18]
 gi|240016679|ref|ZP_04723219.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae FA6140]
 gi|240080868|ref|ZP_04725411.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae FA19]
 gi|240112768|ref|ZP_04727258.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae MS11]
 gi|240117814|ref|ZP_04731876.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID1]
 gi|240121806|ref|ZP_04734768.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID24-1]
 gi|240123369|ref|ZP_04736325.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID332]
 gi|240125617|ref|ZP_04738503.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae SK-92-679]
 gi|240128073|ref|ZP_04740734.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae SK-93-1035]
 gi|254493628|ref|ZP_05106799.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae 1291]
 gi|260440670|ref|ZP_05794486.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae DGI2]
 gi|268594685|ref|ZP_06128852.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae 35/02]
 gi|268596985|ref|ZP_06131152.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae FA19]
 gi|268598836|ref|ZP_06133003.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae MS11]
 gi|268603514|ref|ZP_06137681.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID1]
 gi|268681994|ref|ZP_06148856.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID332]
 gi|268684206|ref|ZP_06151068.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae SK-92-679]
 gi|268686462|ref|ZP_06153324.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae SK-93-1035]
 gi|291043979|ref|ZP_06569695.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae DGI2]
 gi|293399178|ref|ZP_06643343.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae F62]
 gi|59718213|gb|AAW89618.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria gonorrhoeae FA 1090]
 gi|193933733|gb|ACF29557.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae NCCP11945]
 gi|226512668|gb|EEH62013.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae 1291]
 gi|268548074|gb|EEZ43492.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae 35/02]
 gi|268550773|gb|EEZ45792.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae FA19]
 gi|268582967|gb|EEZ47643.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae MS11]
 gi|268587645|gb|EEZ52321.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID1]
 gi|268622278|gb|EEZ54678.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae PID332]
 gi|268624490|gb|EEZ56890.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae SK-92-679]
 gi|268626746|gb|EEZ59146.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae SK-93-1035]
 gi|291012442|gb|EFE04431.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae DGI2]
 gi|291610592|gb|EFF39702.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria gonorrhoeae F62]
 gi|317164129|gb|ADV07670.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 113

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 43/106 (40%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   ++ QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFALP-KEYPAWQAFFSQAWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|325130093|gb|EGC52878.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis OX99.30304]
          Length = 113

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLP-KEYSAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|212635739|ref|YP_002312264.1| succinate dehydrogenase, hydrophobic subunit [Shewanella
           piezotolerans WP3]
 gi|212557223|gb|ACJ29677.1| Succinate dehydrogenase, hydrophobic subunit, putative [Shewanella
           piezotolerans WP3]
          Length = 115

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 44/103 (42%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  ++I 
Sbjct: 10  RSGVHDFILIRASAVILACYTIFMVGFIACSSPLTYDAWHGLFSALPMKVFTLLALVAIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+    L+  + F+F+ + F  L     + 
Sbjct: 70  VHAWIGIWQVLTDYVKCVSLRGVLQFVFVVAAFSYLAAGILIV 112


>gi|221065941|ref|ZP_03542046.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Comamonas testosteroni KF-1]
 gi|220710964|gb|EED66332.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Comamonas testosteroni KF-1]
          Length = 121

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 41/101 (40%), Gaps = 3/101 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTIS 76
           A  GT  F+ QR TA+    + +  +  F+       YEQ   + S   +  +     ++
Sbjct: 14  AHYGTRDFLAQRSTAVLMALYTVVLLVRFLTVSGPVGYEQWAGIFSPQWMKFLTLALFVA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           +  H  +G++ I  DY+    L++    +    V L+    
Sbjct: 74  LGWHAWIGVRDIWMDYVKPVGLRLALQVVT--IVWLVGCIG 112


>gi|28275225|ref|NP_783480.1| succinate dehydrogenase hydrophobic subunit [Shewanella oneidensis
           MR-1]
          Length = 117

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  +++ 
Sbjct: 12  RSGVHDFILLRASAVILACYTIFMVGFIACSSPLTYDAWHGLFSALPMKVFTLLTLVALL 71

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+    L+ +    F+ + F  L     + 
Sbjct: 72  VHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIV 114


>gi|119945915|ref|YP_943595.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Psychromonas ingrahamii 37]
 gi|119864519|gb|ABM03996.1| succinate dehydrogenase subunit D [Psychromonas ingrahamii 37]
          Length = 114

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 44/101 (43%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + ++++ + F   + D  Y   V   S            I++ 
Sbjct: 10  RNGVHDYVLTRASAIIILAYVLYLVGFV-TFADIDYFTWVDFFSLTLTKVFTLFALIAML 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DY+   LL+    F+ +    + +IF   
Sbjct: 69  VHSWIGLWQVLTDYVKNALLRAALQFLLTSTAFVYVIFGFV 109


>gi|254468528|ref|ZP_05081934.1| succinate dehydrogenase, hydrophobic membrane anchor protein [beta
           proteobacterium KB13]
 gi|207087338|gb|EDZ64621.1| succinate dehydrogenase, hydrophobic membrane anchor protein [beta
           proteobacterium KB13]
          Length = 115

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 49/105 (46%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G   ++ QRF+A     FI + I  +++     Y+  V    ++   SI+ +  +    
Sbjct: 11  GGMTQWLYQRFSAFCLYFFIGYLIFNWVQIDHLDYQAWVDFFQSIIHRSIITILFLITFF 70

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           H  +G+Q +I+DYI  + +      +    ++L IIF +  LL I
Sbjct: 71  HGWIGVQHVIDDYIKNKWMNQTIYLILLFSMVLQIIFLVLFLLDI 115


>gi|134278534|ref|ZP_01765248.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 305]
 gi|134250318|gb|EBA50398.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 305]
          Length = 122

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 42/103 (40%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFATRWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DYI    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYIKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|317401833|gb|EFV82443.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Achromobacter xylosoxidans C54]
          Length = 127

 Score = 52.0 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 42/108 (38%), Gaps = 7/108 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN-----VAVASIMGL 72
           A  G   FI QR TA+    + +  +   +      YE   ++ +           +  L
Sbjct: 16  AHYGVMDFIIQRITAVIMAVYTLVLLIGILLMPAFTYESWHALFTFYVGVLPVGQILATL 75

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             ++++ H  +G++ I  DY+    L+++   +      L+     F+
Sbjct: 76  AFVALAWHAWIGVRDIWMDYVKPVGLRLLLQVLTIL--WLIGSVVYFA 121


>gi|299530385|ref|ZP_07043808.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Comamonas testosteroni S44]
 gi|298721610|gb|EFI62544.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Comamonas testosteroni S44]
          Length = 121

 Score = 52.0 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 3/101 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTIS 76
           A  GT  F+ QR TA+    + +  +  F+  G    YEQ   + +   +  +     ++
Sbjct: 14  AHYGTRDFLAQRSTAVLMALYTVVLLVRFLTVGGPVGYEQWAGIFAPQWMKFLTLALFVA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           +  H  +G++ I  DY+    L++    +    V L+    
Sbjct: 74  LGWHAWIGVRDIWMDYVKPVGLRLALQVVT--IVWLVGCIG 112


>gi|148978235|ref|ZP_01814753.1| succinate dehydrogenase, hydrophobic anchor subunit [Vibrionales
           bacterium SWAT-3]
 gi|145962536|gb|EDK27813.1| succinate dehydrogenase, hydrophobic anchor subunit [Vibrionales
           bacterium SWAT-3]
          Length = 114

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 37/101 (36%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L   S+ 
Sbjct: 10  RNGVHDFLLIRATAIIMTLYTIYLV-SFCAFTDISYVSWTQFFGGTFTKVFTMLALTSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DYI    L++         +L      LF
Sbjct: 69  VHAWIGLWQVLTDYIKCAKLRVGLQVGVVAVLLGYFFSGLF 109


>gi|325275375|ref|ZP_08141321.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas sp. TJI-51]
 gi|324099492|gb|EGB97392.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas sp. TJI-51]
          Length = 122

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 40/103 (38%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYVVAHPGIDYTQWHGLFSNNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+                   +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMSFGKSA-TAIRFLFQAVCGVAMFA 110


>gi|308186068|ref|YP_003930199.1| succinate dehydrogenase, hydrophobic subunit [Pantoea vagans C9-1]
 gi|308056578|gb|ADO08750.1| succinate dehydrogenase, hydrophobic subunit [Pantoea vagans C9-1]
          Length = 115

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 37/86 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R TAI    +I++ + F +      Y+      ++        L   SI 
Sbjct: 10  RNGIQDWLLLRATAILITLYIVYILGFVVMTDTLTYDLWRGFFASAFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           +H  +GM  ++ DY+     +++  F
Sbjct: 70  IHGWIGMWQVLTDYVKSLPTRLLLQF 95


>gi|296314765|ref|ZP_06864706.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria polysaccharea ATCC 43768]
 gi|296838409|gb|EFH22347.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria polysaccharea ATCC 43768]
          Length = 113

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVTLLVVLFALP-KEYSAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSI 108


>gi|77457838|ref|YP_347343.1| succinate dehydrogenase subunit D [Pseudomonas fluorescens Pf0-1]
 gi|77381841|gb|ABA73354.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Pseudomonas fluorescens Pf0-1]
          Length = 122

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 39/103 (37%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I +        Y+Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYLAANPGIGYDQWHGLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+    L              +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSA-TAVRFLFQAVCGVAMFA 110


>gi|220934638|ref|YP_002513537.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995948|gb|ACL72550.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 115

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 46/106 (43%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G G ++ QR TA+    +I+  +   +  G          +++        L   +  +
Sbjct: 6   SGMGAWLWQRLTALYLGVYILVLLLALVLSGGPSAGAWQGWMTHPGALLASALFLGAWLM 65

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
           H  +G++ ++ DY+H    ++  L   + F+L   I+  F L++ A
Sbjct: 66  HAWIGLRDVVVDYVHPFGARVTVLVAVALFLLSCGIWGTFILIQAA 111


>gi|120610877|ref|YP_970555.1| succinate dehydrogenase subunit D [Acidovorax citrulli AAC00-1]
 gi|120589341|gb|ABM32781.1| succinate dehydrogenase subunit D [Acidovorax citrulli AAC00-1]
          Length = 121

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 42/102 (41%), Gaps = 1/102 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  GT  +I QR TA     F +  +A  +       Y++   + +   +  +     + 
Sbjct: 14  AHYGTRDWISQRVTAALMAVFTLVVLAQLVLTKGPIGYDRWAGIFAAQWMKVLTFSVIVG 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           ++ H  +GM+ +  DY+    L++    +   +++    + +
Sbjct: 74  LAWHAWVGMRDVWMDYVKPVGLRLALQAVTIFWLVGCAGWGI 115


>gi|26990884|ref|NP_746309.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida KT2440]
 gi|148546900|ref|YP_001267002.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida F1]
 gi|167034758|ref|YP_001669989.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida GB-1]
 gi|170722679|ref|YP_001750367.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida W619]
 gi|24985897|gb|AAN69773.1|AE016613_8 succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida KT2440]
 gi|148510958|gb|ABQ77818.1| succinate dehydrogenase subunit D [Pseudomonas putida F1]
 gi|166861246|gb|ABY99653.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida GB-1]
 gi|169760682|gb|ACA73998.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas putida W619]
 gi|313497962|gb|ADR59328.1| SdhD [Pseudomonas putida BIRD-1]
          Length = 122

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 40/103 (38%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F I + + +    Y Q   + SN A+     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+                   +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMSFGKSA-TAIRFLFQAVCGVAMFA 110


>gi|218768033|ref|YP_002342545.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria meningitidis Z2491]
 gi|121052041|emb|CAM08350.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria meningitidis Z2491]
          Length = 113

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFALP-KEYSAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSI 108


>gi|312884959|ref|ZP_07744649.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367436|gb|EFP94998.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 114

 Score = 52.0 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 36/101 (35%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+  R TAI    + I+ +  F  + D  Y                 L   S+ 
Sbjct: 10  RNGVHDFLLVRATAIIMTLYTIYLV-SFCAFTDISYVSWTQFFGGTFTKVFTMLALASLL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+          VL      LF
Sbjct: 69  IHAWIGLWQVLTDYIKSTKLRGGLQLGVIAVVLSYFFSGLF 109


>gi|126444145|ref|YP_001063465.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 668]
 gi|126223636|gb|ABN87141.1| succinate dehydrogenase, hydrophobic membrane anchor subunit
           [Burkholderia pseudomallei 668]
          Length = 122

 Score = 51.6 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + +     D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTASVMAIYTVILLVWLFIARDFSYEGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DYI    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYIKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|304395704|ref|ZP_07377587.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pantoea sp. aB]
 gi|304356998|gb|EFM21362.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pantoea sp. aB]
          Length = 115

 Score = 51.6 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 38/86 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R TAI    +I++ + F +      Y+      ++        L   SI 
Sbjct: 10  RNGIQDWLLLRATAILITLYIVYILGFVVMTDTLTYDLWRGFFASAFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           VH  +GM  ++ DY+    ++++  F
Sbjct: 70  VHGWIGMWQVLTDYVKSLPVRLLLQF 95


>gi|15642090|ref|NP_231722.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121586933|ref|ZP_01676713.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae 2740-80]
 gi|121727376|ref|ZP_01680515.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae V52]
 gi|147674183|ref|YP_001217615.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae O395]
 gi|153213702|ref|ZP_01948954.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae 1587]
 gi|153801974|ref|ZP_01956560.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae MZO-3]
 gi|153818373|ref|ZP_01971040.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae NCTC 8457]
 gi|153821671|ref|ZP_01974338.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae B33]
 gi|153831295|ref|ZP_01983962.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae 623-39]
 gi|227082216|ref|YP_002810767.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae M66-2]
 gi|229507821|ref|ZP_04397326.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae BX 330286]
 gi|229511942|ref|ZP_04401421.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae B33]
 gi|229513745|ref|ZP_04403207.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae TMA 21]
 gi|229519078|ref|ZP_04408521.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae RC9]
 gi|229522047|ref|ZP_04411464.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae TM 11079-80]
 gi|229524096|ref|ZP_04413501.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae bv. albensis VL426]
 gi|229528894|ref|ZP_04418284.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae 12129(1)]
 gi|229607366|ref|YP_002878014.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae MJ-1236]
 gi|254286793|ref|ZP_04961746.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae AM-19226]
 gi|254849176|ref|ZP_05238526.1| succinate dehydrogenase [Vibrio cholerae MO10]
 gi|255745167|ref|ZP_05419116.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholera CIRS 101]
 gi|262155975|ref|ZP_06029096.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae INDRE 91/1]
 gi|262167709|ref|ZP_06035412.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae RC27]
 gi|262190296|ref|ZP_06048564.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae CT 5369-93]
 gi|297579594|ref|ZP_06941522.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae RC385]
 gi|298497884|ref|ZP_07007691.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae MAK 757]
 gi|9656639|gb|AAF95236.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548869|gb|EAX58912.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae 2740-80]
 gi|121630268|gb|EAX62666.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae V52]
 gi|124115763|gb|EAY34583.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae 1587]
 gi|124122488|gb|EAY41231.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae MZO-3]
 gi|126511063|gb|EAZ73657.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae NCTC 8457]
 gi|126520769|gb|EAZ77992.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae B33]
 gi|146316066|gb|ABQ20605.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae O395]
 gi|148873226|gb|EDL71361.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae 623-39]
 gi|150423084|gb|EDN15032.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae AM-19226]
 gi|227010104|gb|ACP06316.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae M66-2]
 gi|227013987|gb|ACP10197.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae O395]
 gi|229332668|gb|EEN98154.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae 12129(1)]
 gi|229337677|gb|EEO02694.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae bv. albensis VL426]
 gi|229340972|gb|EEO05977.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae TM 11079-80]
 gi|229343767|gb|EEO08742.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae RC9]
 gi|229348926|gb|EEO13883.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae TMA 21]
 gi|229351907|gb|EEO16848.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae B33]
 gi|229355326|gb|EEO20247.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae BX 330286]
 gi|229370021|gb|ACQ60444.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae MJ-1236]
 gi|254844881|gb|EET23295.1| succinate dehydrogenase [Vibrio cholerae MO10]
 gi|255736997|gb|EET92393.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholera CIRS 101]
 gi|262023914|gb|EEY42612.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae RC27]
 gi|262030286|gb|EEY48929.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae INDRE 91/1]
 gi|262033825|gb|EEY52297.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae CT 5369-93]
 gi|297537188|gb|EFH76021.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae RC385]
 gi|297542217|gb|EFH78267.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio cholerae MAK 757]
 gi|327484622|gb|AEA79029.1| Succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           cholerae LMA3894-4]
          Length = 114

 Score = 51.6 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 40/101 (39%), Gaps = 1/101 (0%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI  + + I+ I  F  + D  Y        +        L  +S+ 
Sbjct: 10  RNGVHDYLLIRASAIILVLYTIY-IVSFCAFTDISYVAWTQFFGSTFTKVFTMLALVSVL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DYI    L+     +    +L      LF
Sbjct: 69  IHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLF 109


>gi|317047342|ref|YP_004114990.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pantoea sp. At-9b]
 gi|316948959|gb|ADU68434.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pantoea sp. At-9b]
          Length = 115

 Score = 51.6 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 42/103 (40%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R  AI    +I++ + F +  G   Y+      ++        L   SI 
Sbjct: 10  RNGIHDWLLLRAAAILITLYILYILGFVVMTGTLTYDVWRGFFASSFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+     +++   +    +L   I+    +
Sbjct: 70  IHGWIGMWQVLTDYVKPLATRLVLQLVIVVALLSYAIYGTVVV 112


>gi|209521207|ref|ZP_03269930.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. H160]
 gi|209498349|gb|EDZ98481.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Burkholderia sp. H160]
          Length = 122

 Score = 51.6 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 41/101 (40%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +A+F    D  Y+   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTACVMAVYTVILLAWFFLARDFSYDGWASIFATQWMKLATFVTLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I  DY+     ++    +   ++L    +  
Sbjct: 76  FYHAWVGIRDIWMDYVKPVGARLFLQALTILWLLASAGYAA 116


>gi|304310234|ref|YP_003809832.1| Succinate dehydrogenase, membrane anchor subunit [gamma
           proteobacterium HdN1]
 gi|301795967|emb|CBL44168.1| Succinate dehydrogenase, membrane anchor subunit [gamma
           proteobacterium HdN1]
          Length = 122

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 2/104 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A+ G   ++ QR +A+    + +F + +        Y    ++ S   +     L  ISI
Sbjct: 9   ARSGLYDWMAQRVSAVVIAAYSLFLMGYLFFGATPDYAAWHALFSQTWMRIFSLLALISI 68

Query: 78  SVHMQLGMQVIIEDYIHYRLL--KIMFLFMNSCFVLLLIIFCLF 119
           +VH  +GM  I  DY+  RLL  K   L   +  V  ++ F +F
Sbjct: 69  AVHAWVGMWTITTDYLTTRLLGPKGTALRFGAQVVCGILNFVVF 112


>gi|87119171|ref|ZP_01075069.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas sp. MED121]
 gi|86165562|gb|EAQ66829.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas sp. MED121]
          Length = 115

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 39/87 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR +AI    + +F I + +   +  Y+Q  ++     +     +  +SI 
Sbjct: 10  RSGLYDWMVQRVSAIVLSLYTVFIIGYLVMNPELTYDQWSALFEATWMRIFTLMTLLSIG 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +G+  I  DY+    ++  F  +
Sbjct: 70  VHSWIGLWSISTDYLKATGVRFFFQSL 96


>gi|254248723|ref|ZP_04942043.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia PC184]
 gi|124875224|gb|EAY65214.1| Succinate dehydrogenase, cytochrome b subunit [Burkholderia
           cenocepacia PC184]
          Length = 122

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 2/103 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  +  F    D  YE   S+ +   +     +  +S+
Sbjct: 16  AHYGLRDWLAQRVTATITAVYTVILLVLFFGAHDFSYEGWASIFAAQWMKLATFVMLLSL 75

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +G++ I  DY+    ++++   +    V LL      +
Sbjct: 76  FYHAWVGVRDIWMDYVKPVGVRLLLQSLT--IVWLLACAGYAA 116


>gi|22126946|ref|NP_670369.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis KIM 10]
 gi|45440880|ref|NP_992419.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis biovar Microtus str. 91001]
 gi|51595488|ref|YP_069679.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pseudotuberculosis IP 32953]
 gi|108806585|ref|YP_650501.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis Antiqua]
 gi|108813048|ref|YP_648815.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis Nepal516]
 gi|145599852|ref|YP_001163928.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis Pestoides F]
 gi|149366890|ref|ZP_01888924.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Yersinia pestis CA88-4125]
 gi|153949963|ref|YP_001401847.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pseudotuberculosis IP 31758]
 gi|162421861|ref|YP_001605907.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis Angola]
 gi|165924328|ref|ZP_02220160.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938275|ref|ZP_02226833.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011542|ref|ZP_02232440.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166211707|ref|ZP_02237742.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400068|ref|ZP_02305586.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419680|ref|ZP_02311433.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423845|ref|ZP_02315598.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167468942|ref|ZP_02333646.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis FV-1]
 gi|170025193|ref|YP_001721698.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pseudotuberculosis YPIII]
 gi|186894541|ref|YP_001871653.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pseudotuberculosis PB1/+]
 gi|218928278|ref|YP_002346153.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis CO92]
 gi|229841046|ref|ZP_04461205.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843150|ref|ZP_04463296.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229893987|ref|ZP_04509173.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis Pestoides A]
 gi|229903489|ref|ZP_04518602.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis Nepal516]
 gi|270487271|ref|ZP_06204345.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis KIM D27]
 gi|294503117|ref|YP_003567179.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis Z176003]
 gi|21959987|gb|AAM86620.1|AE013908_3 succinate dehydrogenase, hydrophobic subunit [Yersinia pestis KIM
           10]
 gi|45435738|gb|AAS61296.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Yersinia pestis biovar Microtus str. 91001]
 gi|51588770|emb|CAH20384.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Yersinia pseudotuberculosis IP 32953]
 gi|108776696|gb|ABG19215.1| succinate dehydrogenase subunit D [Yersinia pestis Nepal516]
 gi|108778498|gb|ABG12556.1| succinate dehydrogenase subunit D [Yersinia pestis Antiqua]
 gi|115346889|emb|CAL19776.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Yersinia pestis CO92]
 gi|145211548|gb|ABP40955.1| succinate dehydrogenase subunit D [Yersinia pestis Pestoides F]
 gi|149291264|gb|EDM41339.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Yersinia pestis CA88-4125]
 gi|152961458|gb|ABS48919.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pseudotuberculosis IP 31758]
 gi|162354676|gb|ABX88624.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis Angola]
 gi|165913653|gb|EDR32272.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923388|gb|EDR40520.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989490|gb|EDR41791.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207478|gb|EDR51958.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962421|gb|EDR58442.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167050776|gb|EDR62184.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056694|gb|EDR66457.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169751727|gb|ACA69245.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pseudotuberculosis YPIII]
 gi|186697567|gb|ACC88196.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pseudotuberculosis PB1/+]
 gi|229679259|gb|EEO75362.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis Nepal516]
 gi|229689497|gb|EEO81558.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229697412|gb|EEO87459.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229703872|gb|EEO90885.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis Pestoides A]
 gi|262361153|gb|ACY57874.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis D106004]
 gi|262365293|gb|ACY61850.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis D182038]
 gi|270335775|gb|EFA46552.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Yersinia pestis KIM D27]
 gi|294353576|gb|ADE63917.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Yersinia pestis Z176003]
 gi|320014249|gb|ADV97820.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 115

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 38/88 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++ + + F +   D  YE      ++        L  +SI 
Sbjct: 10  RNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVFTLLTLLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
            H  +G+  ++ DYI    ++++   + 
Sbjct: 70  AHAWIGLWQVLTDYIKPLAIRLVLQLVV 97


>gi|329295933|ref|ZP_08253269.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Plautia stali symbiont]
          Length = 115

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 42/103 (40%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R  AI    +I++ + F +  G   Y+      ++        L   SI 
Sbjct: 10  RNGIHDWLLLRAAAILITLYILYILGFVVMTGTLTYDVWRGFFASSFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DY+     +++   +    +L   I+    +
Sbjct: 70  VHGWIGMWQVLTDYVKPLATRLLLQLVIVVALLSYAIYGTVVV 112


>gi|83647435|ref|YP_435870.1| succinate dehydrogenase, hydrophobic anchor subunit [Hahella
           chejuensis KCTC 2396]
 gi|83635478|gb|ABC31445.1| Succinate dehydrogenase, hydrophobic anchor subunit [Hahella
           chejuensis KCTC 2396]
          Length = 115

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 39/103 (37%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR +A+    +  F +   +   D  YE   ++ +   +        +++ 
Sbjct: 10  RSGAYDWMVQRVSAVVLALYTAFMVGVLVFTPDLTYEVWSALFAKTWMRIFSLAALVALG 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM--NSCFVLLLIIFCLF 119
            H  +G+  I  DY+   +++ +         FV  +    + 
Sbjct: 70  AHAWIGLWTITTDYMKNGVIRFVAQAACGTIMFVYFIWGVQIL 112


>gi|293604091|ref|ZP_06686501.1| succinate dehydrogenase cytochrome b small subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292817515|gb|EFF76586.1| succinate dehydrogenase cytochrome b small subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 127

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 42/108 (38%), Gaps = 7/108 (6%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN-----VAVASIMGL 72
           A  G   FI QR TA+    + +  +   +      YE  V + +           +  L
Sbjct: 16  AHYGVMDFIVQRITAVIMAVYTLVLLVGILMMPAFTYEHWVKLFTFYVGIIPVGQILASL 75

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             I+++ H  +G++ I  DY+    L+++   +      L+     F+
Sbjct: 76  AFIALAWHAWIGVRDIWMDYVKPVGLRLLLQVLTIL--WLVGTVVYFA 121


>gi|238793883|ref|ZP_04637503.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
          [Yersinia intermedia ATCC 29909]
 gi|238726786|gb|EEQ18320.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
          [Yersinia intermedia ATCC 29909]
          Length = 115

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 33/75 (44%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          ++G   ++  R +AI    +I++ + F     D  YE      ++        L  +SI 
Sbjct: 10 RNGVHDWLLLRASAIVITLYILYILGFVAIVPDITYEVWRGFFASHITKVFTLLTLLSIL 69

Query: 79 VHMQLGMQVIIEDYI 93
           H  +G+  ++ DYI
Sbjct: 70 AHAWIGLWQVLTDYI 84


>gi|326317738|ref|YP_004235410.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374574|gb|ADX46843.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 121

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 41/102 (40%), Gaps = 1/102 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  GT  ++ QR TA     F +  +A  +       Y++   +     +  +     + 
Sbjct: 14  AHYGTRDWLSQRVTAALMAVFTLVVLAQLVLTKGPIGYDRWAGIFGAQWMKVLTFSVIVG 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           ++ H  +GM+ +  DY+    L++    +   +++    + +
Sbjct: 74  LAWHAWVGMRDVWMDYVKPVGLRLALQAVTIFWLVGCAGWGI 115


>gi|224824512|ref|ZP_03697619.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Lutiella nitroferrum 2002]
 gi|224603005|gb|EEG09181.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Lutiella nitroferrum 2002]
          Length = 114

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 40/104 (38%), Gaps = 3/104 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+    +    + F +    + YE   +      V  +     +++
Sbjct: 9   AHYGLRDWVLQRVTAVIMAIYTFALVLFLLAMP-SSYEGWKAFFGQTWVQVLTQTTLLAV 67

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMF--LFMNSCFVLLLIIFCLF 119
            +H  +G++ +  DYI    +++    L +      ++    + 
Sbjct: 68  FMHAWVGIRDLWMDYIKPVGVRLTLHVLTLVWLVSCVIYSIKVV 111


>gi|157375952|ref|YP_001474552.1| putative succinate dehydrogenase, hydrophobic subunit [Shewanella
           sediminis HAW-EB3]
 gi|157318326|gb|ABV37424.1| conserved hypothetical succinate dehydrogenase, hydrophobic subunit
           [Shewanella sediminis HAW-EB3]
          Length = 115

 Score = 51.6 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 45/103 (43%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +AI    + IF + F        Y+    + S +++     L  +S+ 
Sbjct: 10  RSGVHDFILIRASAIILTCYTIFLVGFVACSSPLTYDAWHGLFSTLSMKVFTLLALVSVL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLK--IMFLFMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DY+    L+  + F+F+ + F  L     + 
Sbjct: 70  IHSWIGIWQVLTDYVKPLALRGVLQFVFVVAAFSYLAAGILIV 112


>gi|296112296|ref|YP_003626234.1| succinate dehydrogenase subunit D [Moraxella catarrhalis RH4]
 gi|295919990|gb|ADG60341.1| succinate dehydrogenase subunit D [Moraxella catarrhalis RH4]
 gi|326561804|gb|EGE12139.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis 7169]
 gi|326563241|gb|EGE13508.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis 46P47B1]
 gi|326563355|gb|EGE13620.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis 12P80B1]
 gi|326565893|gb|EGE16054.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis 103P14B1]
 gi|326568970|gb|EGE19039.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis BC1]
 gi|326569269|gb|EGE19330.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis BC7]
 gi|326571946|gb|EGE21951.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis BC8]
 gi|326575457|gb|EGE25382.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis 101P30B1]
 gi|326576454|gb|EGE26362.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis CO72]
 gi|326577925|gb|EGE27789.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Moraxella catarrhalis O35E]
          Length = 117

 Score = 51.2 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR++ G     G    G+  +I QR +A+    + +  + FF+ + D  +E     + ++
Sbjct: 1   MRNNSGIKSATGLTGSGSRDWILQRISAVVLAVYSVVMVGFFL-FNDVNFESWQGFMLSL 59

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSC--FVLLLIIFCLF 119
            +     +  +S+  H  +GM  ++ DY+    L+++   +      V L     +F
Sbjct: 60  PMKLFSLVAILSLVFHAWVGMWTVLTDYVKSSGLRLVIQSLVIIAVLVYLFWGVMIF 116


>gi|90406984|ref|ZP_01215174.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Psychromonas sp. CNPT3]
 gi|90311855|gb|EAS39950.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Psychromonas sp. CNPT3]
          Length = 114

 Score = 51.2 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   +I  R +A+  + +I++ I  FI + D  Y    S  S++          +S+ 
Sbjct: 10  RSGVHDYILLRASAVILLAYILY-IVGFIAFNDVNYLVWRSFFSSLCTQVFSLFALLSML 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           VH  +G+  I+ DYI    L+    F+ +     + +F  F +L
Sbjct: 69  VHAWIGLWQILTDYIKCTRLRGTLQFLLTSVAF-IYVFSGFVIL 111


>gi|325202263|gb|ADY97717.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis M01-240149]
          Length = 108

 Score = 51.2 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 41/101 (40%), Gaps = 1/101 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA+  + + +  +          Y    +  S   V     +  I++
Sbjct: 4   AHYGLRDWVMQRATAVIMLIYTVALLVVLFSLP-KEYSAWQAFFSQTWVKVFTQVSFIAV 62

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  FLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 103


>gi|296136776|ref|YP_003644018.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thiomonas intermedia K12]
 gi|295796898|gb|ADG31688.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thiomonas intermedia K12]
          Length = 121

 Score = 51.2 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 46/101 (45%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     F +  + +F+  G   YE+   + +   +  +  +  +++
Sbjct: 15  AHYGLRDWMAQRVTAAVIAVFTLVLLVYFLAPGPLSYERWHDLFAQQWMKLLTFVTVLAL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + H+ +GM+ I  DY+    ++++       ++L    + L
Sbjct: 75  TYHVWVGMRDIWMDYVKPVGVRLLLQIGTILWLLACAGWAL 115


>gi|127512581|ref|YP_001093778.1| putative succinate dehydrogenase, hydrophobic subunit [Shewanella
           loihica PV-4]
 gi|126637876|gb|ABO23519.1| succinate dehydrogenase subunit D [Shewanella loihica PV-4]
          Length = 115

 Score = 51.2 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 41/102 (40%), Gaps = 5/102 (4%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF + F        Y+    + S + +     L  ++I 
Sbjct: 10  RSGVHDFILLRASAVILTCYTIFLVGFIAASAPLTYDVWHGLFSALPMKVFTLLALVAIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           VH  +G+  ++ DY+     K + +     FV ++      +
Sbjct: 70  VHAWIGIWQVLTDYV-----KPVAVRGVLQFVFVVAALSYLA 106


>gi|295698448|ref|YP_003603103.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Candidatus Riesia pediculicola USDA]
 gi|291157033|gb|ADD79478.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Candidatus Riesia pediculicola USDA]
          Length = 110

 Score = 50.8 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 49/107 (45%), Gaps = 5/107 (4%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            GT ++I  R T+I ++ + +F+I  F    +  +  +        V  +      S  V
Sbjct: 9   SGTKNWIILRITSIISLIY-LFYILIFFSEREIDHTSLQEFFLKRPVKILTIFAVFSTVV 67

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
           H  +G Q I+ DYI  + LKI  L  ++ +V L   F LF L KI  
Sbjct: 68  HFLIGTQNILTDYIKNKKLKI--LIYSTLYVFL--AFHLFYLKKIIF 110


>gi|332141294|ref|YP_004427032.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551316|gb|AEA98034.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 115

 Score = 50.8 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 46/101 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   ++  R TA     + +F   FFI   +  + +   + S +A+        +++ 
Sbjct: 10  RDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVFTLAALVAVM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H+++G+  ++ DY+    L+ +  ++ +      +   LF
Sbjct: 70  IHVRIGLWQVLTDYVKATGLRAVLQYILNIIAFGYVAVGLF 110


>gi|226330951|ref|ZP_03806469.1| hypothetical protein PROPEN_04874 [Proteus penneri ATCC 35198]
 gi|225201746|gb|EEG84100.1| hypothetical protein PROPEN_04874 [Proteus penneri ATCC 35198]
          Length = 114

 Score = 50.8 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 36/86 (41%), Gaps = 1/86 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI  + ++++ + F        YE      S+        L  +SI 
Sbjct: 10  RTGIQDWLFLRASAIIIVLYVLYLVGFIATTE-ITYEVWRGFFSSSLTKVFTILTLLSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           +H  +GM  ++ DYI    L++    
Sbjct: 69  IHAWIGMWQVLTDYIKPLALRLTLQL 94


>gi|297537887|ref|YP_003673656.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylotenera sp. 301]
 gi|297257234|gb|ADI29079.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylotenera sp. 301]
          Length = 114

 Score = 50.8 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query: 21  GTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           G   ++ QR +A+    + IF +A F+    + Y   V     +       L  IS+ +H
Sbjct: 12  GMRAWLTQRLSALVMAVYSIFAVARFLIVQPSNYGAWVDFFQPLWWRIATLLFWISLCIH 71

Query: 81  MQLGMQVIIEDYIHYRLLKIMF--LFMNSCFVLLLII 115
             LG++ + +DY+    ++ +   L + S +V L+  
Sbjct: 72  AWLGIRDVFKDYVPNPSVRDVLDKLLVVSLWVYLVWA 108


>gi|89900589|ref|YP_523060.1| succinate dehydrogenase, cytochrome b subunit [Rhodoferax
           ferrireducens T118]
 gi|89345326|gb|ABD69529.1| succinate dehydrogenase subunit D [Rhodoferax ferrireducens T118]
          Length = 121

 Score = 50.8 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 1/86 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA+    F +  +A  I       Y Q   + S   + ++     +S
Sbjct: 14  AHYGMRDWLSQRVTAVLMALFTVLVLAELIFTKGPIGYAQWAGIFSPQWMKALTFTVILS 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMF 102
           +  H+ +GM+ I +DY+H   ++ + 
Sbjct: 74  LLYHVWVGMRNIFQDYVHPYGVRFVL 99


>gi|315126698|ref|YP_004068701.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhC [Pseudoalteromonas sp. SM9913]
 gi|315015212|gb|ADT68550.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhC [Pseudoalteromonas sp. SM9913]
          Length = 115

 Score = 50.8 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 47/101 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   F+  R TA+    + IF I +F+   +  YE    + SN+A+     +  + I 
Sbjct: 10  RDGVQDFVSLRTTALIISAYAIFIIGYFLAMPEVTYEAWTGLFSNLAMKGATLITLVCIM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH ++G+  ++ DY+    L+    F+ +   +  +   L 
Sbjct: 70  VHTRIGLWQVLTDYVKNAKLRAFLGFVLNLMAVAYVAVGLI 110


>gi|309380088|emb|CBX21499.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 113

 Score = 50.4 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 35/94 (37%), Gaps = 1/94 (1%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFALP-KEYSAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
             +++ +H  +G++ +  DYI    +++      
Sbjct: 63  SFLAVFLHAWVGIRDLWMDYIKPFGVRLFLQVAT 96


>gi|255318871|ref|ZP_05360097.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter radioresistens SK82]
 gi|255304127|gb|EET83318.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter radioresistens SK82]
          Length = 126

 Score = 50.4 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 42/110 (38%), Gaps = 7/110 (6%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +  + + +  G   YEQ    +  V +     L  +
Sbjct: 11  GLTGSGSRDWYIQRISAVVLAAYTVVVLGWILLNGGFTYEQWSGFMMTVPMKIFSLLAIL 70

Query: 76  SISVHMQLGMQVIIEDYI-------HYRLLKIMFLFMNSCFVLLLIIFCL 118
           S+  H  +GM  +  DY+           L+++        V +  I+ +
Sbjct: 71  SLIGHAWIGMWQVFTDYVTTRQMGPSANGLRLVLTSAVIIAVFVYAIWGI 120


>gi|262378872|ref|ZP_06072029.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter radioresistens SH164]
 gi|262300157|gb|EEY88069.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter radioresistens SH164]
          Length = 121

 Score = 50.4 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 42/110 (38%), Gaps = 7/110 (6%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +  + + +  G   YEQ    +  V +     L  +
Sbjct: 6   GLTGSGSRDWYIQRISAVVLAAYTVVVLGWILLNGGFTYEQWSGFMMTVPMKIFSLLAIL 65

Query: 76  SISVHMQLGMQVIIEDYI-------HYRLLKIMFLFMNSCFVLLLIIFCL 118
           S+  H  +GM  +  DY+           L+++        V +  I+ +
Sbjct: 66  SLIGHAWIGMWQVFTDYVTTRQMGPSANGLRLVLTSAVIIAVFVYAIWGI 115


>gi|28869398|ref|NP_792017.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|71734632|ref|YP_274201.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213968187|ref|ZP_03396332.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato T1]
 gi|237803490|ref|ZP_04591075.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|257485478|ref|ZP_05639519.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289624404|ref|ZP_06457358.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289646682|ref|ZP_06478025.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|301383808|ref|ZP_07232226.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302059586|ref|ZP_07251127.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302133375|ref|ZP_07259365.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28852639|gb|AAO55712.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|71555185|gb|AAZ34396.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213927167|gb|EEB60717.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tomato T1]
 gi|320324893|gb|EFW80965.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329259|gb|EFW85256.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330867442|gb|EGH02151.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330875699|gb|EGH09848.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330880845|gb|EGH14994.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330888151|gb|EGH20812.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330967013|gb|EGH67273.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|330987438|gb|EGH85541.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331010659|gb|EGH90715.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331018600|gb|EGH98656.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
 gi|331025472|gb|EGI05528.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 122

 Score = 50.4 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 40/103 (38%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+    L              +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSA-TAVRFLFQAVCGVLMFA 110


>gi|332526163|ref|ZP_08402298.1| succinate dehydrogenase subunit D [Rubrivivax benzoatilyticus JA2]
 gi|332110003|gb|EGJ10631.1| succinate dehydrogenase subunit D [Rubrivivax benzoatilyticus JA2]
          Length = 120

 Score = 50.4 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 41/100 (41%), Gaps = 2/100 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     F    +   +  G   Y++   + S   +  +  +  +S+
Sbjct: 14  AHYGARDWLAQRITAALIALFTFVLLVQLLAPGPLGYDRWAGIFSAQWMKVLTFVVIVSL 73

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           + H  +G++ I  DY+    +++    ++   V L+    
Sbjct: 74  AWHAWIGIRDIWMDYVRPAGIRLALQVLS--IVWLVGCAG 111


>gi|226951561|ref|ZP_03822025.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter sp.
           ATCC 27244]
 gi|294651218|ref|ZP_06728546.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226837703|gb|EEH70086.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter sp.
           ATCC 27244]
 gi|292822871|gb|EFF81746.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 126

 Score = 50.4 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 41/110 (37%), Gaps = 7/110 (6%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +  + + +      YEQ    +  + +     L  +
Sbjct: 11  GLTGSGSRDWYIQRVSAVVLAAYTVVILGWILCNSGFGYEQWAGFMLTLPMKIFSLLAVL 70

Query: 76  SISVHMQLGMQVIIEDYI-------HYRLLKIMFLFMNSCFVLLLIIFCL 118
           S+  H  +GM  +  DY+           L+++        V +  I+ +
Sbjct: 71  SLVAHAWIGMWQVFTDYVTTRQMGPSASGLRLVLTSAVIISVFVYAIWGI 120


>gi|308050200|ref|YP_003913766.1| succinate dehydrogenase subunit D [Ferrimonas balearica DSM 9799]
 gi|307632390|gb|ADN76692.1| succinate dehydrogenase subunit D [Ferrimonas balearica DSM 9799]
          Length = 115

 Score = 50.4 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 44/101 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   F+  R +A+    F++F + F     +  +E    + S+ A+     +  +++ 
Sbjct: 10  RSGVHDFVLLRASALVLASFVLFMVGFLALTPELTFESWHGLFSHTAMKVYTLVSLVALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH  +G+  ++ DYI    L+    F  +  +L  +   + 
Sbjct: 70  VHGWIGLWQVLTDYIKPAGLRAFLQFAVNLVLLAYLFAGVV 110


>gi|262371931|ref|ZP_06065210.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter junii SH205]
 gi|262311956|gb|EEY93041.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter junii SH205]
          Length = 121

 Score = 50.4 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 40/110 (36%), Gaps = 7/110 (6%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +    + +      YEQ    +  + +     L  +
Sbjct: 6   GLTGSGSRDWYIQRVSAVVLAAYTVVMFGWILCNSGFGYEQWAGFMLTLPMKIFSLLAVL 65

Query: 76  SISVHMQLGMQVIIEDYI-------HYRLLKIMFLFMNSCFVLLLIIFCL 118
           S+  H  +GM  +  DY+           L+++        V +  I+ +
Sbjct: 66  SLVAHAWIGMWQVFTDYVTTRQMGPSASGLRLVLTSAVIISVFVYAIWGI 115


>gi|66045246|ref|YP_235087.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae B728a]
 gi|289679939|ref|ZP_06500829.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae FF5]
 gi|302187423|ref|ZP_07264096.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae 642]
 gi|63255953|gb|AAY37049.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. syringae B728a]
 gi|330899181|gb|EGH30600.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330940368|gb|EGH43473.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330951680|gb|EGH51940.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae Cit 7]
 gi|330980728|gb|EGH78831.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 122

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 40/103 (38%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHGLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+    L              +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSA-TAVRFLFQAVCGVLMFA 110


>gi|221134278|ref|ZP_03560583.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Glaciecola sp. HTCC2999]
          Length = 115

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 43/101 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R TA+    +  +    FI    + +     + +++ +        +SI 
Sbjct: 10  RNGIQDWVSLRATALIIALYSFYLAFVFITTDISSFAIWQGIFASLFMKVFTFAALVSIM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H+++G+  ++ DYI    L+    ++ +      +   LF
Sbjct: 70  LHVRIGLWQVLTDYIKPTGLRAGIQYVLNLIAFAYVAVGLF 110


>gi|71908477|ref|YP_286064.1| succinate dehydrogenase subunit D [Dechloromonas aromatica RCB]
 gi|71848098|gb|AAZ47594.1| succinate dehydrogenase subunit D [Dechloromonas aromatica RCB]
          Length = 115

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 36/85 (42%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TA+    + +   A  +      +E    V +N  +  +  L  +S+
Sbjct: 9   AHYGLKDWIAQRATAVIMAVYSVLIAAVLLVVRPNTFEAWQGVFANGVIKFLTFLFFVSL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMF 102
             H  +G++ I  DY+    +++  
Sbjct: 69  FYHAWIGVRDIWMDYVKPTGVRLTL 93


>gi|289209040|ref|YP_003461106.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thioalkalivibrio sp. K90mix]
 gi|288944671|gb|ADC72370.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thioalkalivibrio sp. K90mix]
          Length = 112

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 46/86 (53%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G G ++ QR TA+    F+I  + +F+    + +   V+V+++ AVA    L  + + +
Sbjct: 5   SGQGAWLLQRITAVYVGLFVILVLGYFLIAPPSDHAAWVAVIAHPAVALGSALFVVLLLL 64

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFM 105
           H  +G++ ++ DY+    L++  L +
Sbjct: 65  HAWIGLRDVVLDYVKPLALRLTVLTL 90


>gi|212712448|ref|ZP_03320576.1| hypothetical protein PROVALCAL_03542 [Providencia alcalifaciens DSM
           30120]
 gi|212684905|gb|EEB44433.1| hypothetical protein PROVALCAL_03542 [Providencia alcalifaciens DSM
           30120]
          Length = 114

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 37/87 (42%), Gaps = 1/87 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI  + ++++ + F     D  YE      ++        L   SI 
Sbjct: 10  RTGIQDWLLIRGSAIVIVLYVLYIVGFVA-INDITYEVWRGFFASSVTKVFTILTLFSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DY+    ++++    
Sbjct: 69  VHAWIGMWQVLTDYVKPLAIRLVLQLA 95


>gi|304387746|ref|ZP_07369926.1| succinate dehydrogenase cytochrome b small subunit [Neisseria
           meningitidis ATCC 13091]
 gi|304338222|gb|EFM04352.1| succinate dehydrogenase cytochrome b small subunit [Neisseria
           meningitidis ATCC 13091]
          Length = 113

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +    V V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLP-KEYSAWQAFFDQVWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSI 108


>gi|88798679|ref|ZP_01114262.1| Succinate dehydrogenase, hydrophobic anchor subunit [Reinekea sp.
           MED297]
 gi|88778442|gb|EAR09634.1| Succinate dehydrogenase, hydrophobic anchor subunit [Reinekea sp.
           MED297]
          Length = 102

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 38/98 (38%), Gaps = 2/98 (2%)

Query: 24  HFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQL 83
            ++ QR +A+    + +F + + +   D  +EQ   +              +++  H+ +
Sbjct: 2   DWLAQRVSAVILGSYAVFMVVYLLASSDLTFEQWQGLFGQFWFKIYTLAALVALVAHIWV 61

Query: 84  GMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           GM  +  DY+     + + L     + F   +I F   
Sbjct: 62  GMWTVATDYVKNAWSRFIVLGVIALTNFSYFIIGFSAV 99


>gi|121634751|ref|YP_974996.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria meningitidis FAM18]
 gi|120866457|emb|CAM10203.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria meningitidis FAM18]
 gi|325198182|gb|ADY93638.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria meningitidis G2136]
          Length = 108

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 40/101 (39%), Gaps = 1/101 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +  QR TA+  + + +  +          Y    +  S   V     +  I++
Sbjct: 4   AHYGLRDWAMQRATAVIMLIYTVALLVVLFSLP-KEYSAWQAFFSQTWVKVFTQVSFIAV 62

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  FLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSI 103


>gi|330959059|gb|EGH59319.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 122

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 40/100 (40%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
             H  +GM  I  DY+    L      +   F  +  +  
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSATVVRFLFQAVCGVLM 108


>gi|90580051|ref|ZP_01235859.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Vibrio angustum S14]
 gi|90438936|gb|EAS64119.1| Putative succinate dehydrogenase, hydrophobic membrane anchor
           protein [Vibrio angustum S14]
          Length = 115

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R TAI    + ++ + FF    +  +E      + ++      L  +SI 
Sbjct: 10  RNGIHDFILIRATAIILTLYTVYMVGFFAFGSELTFETWSVFFNQISTKVFTMLALVSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +G+  ++ DYI   +L++   F+    + + +    F +
Sbjct: 70  VHAWIGLWQVLTDYIKPAVLRVGLQFVVVAVLFVYLFAGFFIV 112


>gi|255065300|ref|ZP_05317155.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria sicca ATCC 29256]
 gi|255050721|gb|EET46185.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria sicca ATCC 29256]
          Length = 113

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +    V V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVALLVILFTLP-KEYSAWQAFFDQVWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSI 108


>gi|241761112|ref|ZP_04759201.1| hypothetical protein ZmobDRAFT_0278 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374731|gb|EER64192.1| hypothetical protein ZmobDRAFT_0278 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 128

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 41/101 (40%), Gaps = 1/101 (0%)

Query: 26  IKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGM 85
             ++ TA AN+   ++ I  F++     +  I   ++   VA  M    IS   +    +
Sbjct: 24  FYKKLTAAANLLLYVWLIVSFLELPVYDFNVIRRWVAQTIVALPMIFLAISTYGYACSFV 83

Query: 86  QVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
             +  +   +    + F      ++++     +FS+LKIA 
Sbjct: 84  DKLFSE-ERFPKAGLYFQIAAYFYMIIFAAIAVFSILKIAF 123


>gi|260752924|ref|YP_003225817.1| hypothetical protein Za10_0686 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283856282|ref|YP_162303.2| hypothetical protein ZMO0568 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552287|gb|ACV75233.1| hypothetical protein Za10_0686 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283775278|gb|AAV89192.2| hypothetical protein ZMO0568 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 128

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 41/101 (40%), Gaps = 1/101 (0%)

Query: 26  IKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGM 85
             ++ TA AN+   ++ I  F++     +  I   ++   VA  M    IS   +    +
Sbjct: 24  FYKKLTAAANLLLYVWLIVSFLELPVYDFNVIRRWVAQTIVALPMIFLAISTYGYACSFV 83

Query: 86  QVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
             +  +   +    + F      ++++     +FS+LKIA 
Sbjct: 84  DKLFSE-ERFPKAGLYFQIAAYFYMIIFAAIAVFSILKIAF 123


>gi|253996131|ref|YP_003048195.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylotenera mobilis JLW8]
 gi|253982810|gb|ACT47668.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Methylotenera mobilis JLW8]
          Length = 115

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
           ++ QR +A+A + +++  +          Y   +  +S      +  +  +S+  H  LG
Sbjct: 16  WLTQRISAVAMVIYLLLLLLVLAIKQPHDYASWLDFMSPWWWRLLTLVFFVSLLTHAWLG 75

Query: 85  MQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           ++ + +DY+    L+ +          L+   C  S++
Sbjct: 76  VRDVFKDYVFNLRLRAVLQVTVDIL--LIGYLCWVSII 111


>gi|241765616|ref|ZP_04763571.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acidovorax delafieldii 2AN]
 gi|241364554|gb|EER59620.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acidovorax delafieldii 2AN]
          Length = 121

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 43/102 (42%), Gaps = 1/102 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA   + F +  +   +       Y++  S+ S+  +  +     ++
Sbjct: 14  AHYGLRDWLSQRVTAALMVLFTLIVLVQLVLTKGPIGYDRWASIFSSQWMKVLTFSVILA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           +  H  +GM+ I  DYI    L+++       +++    + +
Sbjct: 74  LVWHAWVGMRNIWMDYIKPVSLRLVLQIFTIVWLVGCAGWGI 115


>gi|226945048|ref|YP_002800121.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Azotobacter vinelandii DJ]
 gi|226719975|gb|ACO79146.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Azotobacter vinelandii DJ]
          Length = 122

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 42/103 (40%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + +F + +     D  Y +   + S+  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVILAAYTLFLLGYLFFSSDLSYAEWHGLFSSTGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
           SVH  +GM  I  DY+    L  +   +            +F+
Sbjct: 69  SVHAWVGMWTISTDYLTPMALGKLA-TVVRFLFQAACGIAMFA 110


>gi|261364265|ref|ZP_05977148.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria mucosa ATCC 25996]
 gi|298369269|ref|ZP_06980587.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria sp. oral taxon 014 str. F0314]
 gi|288567508|gb|EFC89068.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria mucosa ATCC 25996]
 gi|298283272|gb|EFI24759.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria sp. oral taxon 014 str. F0314]
          Length = 113

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +    V V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVALLVILFTLP-KEYSAWQAFFDQVWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             I++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|93004939|ref|YP_579376.1| succinate dehydrogenase hydrophobic membrane anchor subunit
           [Psychrobacter cryohalolentis K5]
 gi|92392617|gb|ABE73892.1| succinate dehydrogenase subunit D [Psychrobacter cryohalolentis K5]
          Length = 134

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 49/110 (44%), Gaps = 9/110 (8%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
             G+  +I QR +A+    + +  + FF+ +GD  Y +  + ++++ +     +  ++++
Sbjct: 15  GSGSRDWIVQRISAVVLAVYSVVLLGFFLTHGDVSYTEWSNFMTSLPMRLFSLVAVLALA 74

Query: 79  VHMQLGMQVIIEDYI---------HYRLLKIMFLFMNSCFVLLLIIFCLF 119
            H  +GM  +  DYI             L +  L + + FV L     +F
Sbjct: 75  GHAWIGMWTVFTDYITTGKLGASAAGLRLVLQTLMIIAVFVFLFWGIMIF 124


>gi|183598173|ref|ZP_02959666.1| hypothetical protein PROSTU_01552 [Providencia stuartii ATCC 25827]
 gi|188020340|gb|EDU58380.1| hypothetical protein PROSTU_01552 [Providencia stuartii ATCC 25827]
          Length = 114

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI  + ++++ +  FI   D  YE      ++        L   SI 
Sbjct: 10  RTGIQDWLLIRGSAIVIVLYVLYLVG-FIAINDITYETWRGFFASSVTKVFTILTLFSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           VH  +G+  ++ DY+    L+++   
Sbjct: 69  VHAWIGLWQVLTDYVKPLALRLVLQL 94


>gi|261343508|ref|ZP_05971153.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Providencia rustigianii DSM 4541]
 gi|282568654|gb|EFB74189.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Providencia rustigianii DSM 4541]
          Length = 114

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 36/87 (41%), Gaps = 1/87 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI  I   + +I  F+   D  YE      ++        L   SI 
Sbjct: 10  RTGIQDWLLIRGSAI-LIVLYVLYIVGFVAINDITYEVWRGFFASSVTKVFTILTLFSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DY+    ++++    
Sbjct: 69  VHAWIGMWQVLTDYVKPIAIRLVLQLA 95


>gi|188534434|ref|YP_001908231.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Erwinia tasmaniensis Et1/99]
 gi|188029476|emb|CAO97353.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Erwinia tasmaniensis Et1/99]
          Length = 115

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R  A+    ++++ +AF +  G   ++      ++        L   SI 
Sbjct: 10  RNGIHDWLLLRAAAMIMTFYVLYILAFIVMSGPLTFDIWRGFFASSFTKVFTLLTLFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           VH  +GM  ++ DYI    L++M   +    +L+  I+    +
Sbjct: 70  VHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVV 112


>gi|149374989|ref|ZP_01892762.1| Succinate dehydrogenase, hydrophobic anchor subunit [Marinobacter
           algicola DG893]
 gi|149360878|gb|EDM49329.1| Succinate dehydrogenase, hydrophobic anchor subunit [Marinobacter
           algicola DG893]
          Length = 114

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 40/100 (40%), Gaps = 1/100 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR TA     + +F   F +   D  Y+   ++           L  +SI 
Sbjct: 10  RSGVFDWMIQRVTAYVLALYTVFLFGFVLT-TDINYDSWSALFDQTWFRIFTLLALLSIG 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+  +  DYI   L + +   +    + + +++ +
Sbjct: 69  AHAWVGLWTVTTDYIKATLPRFLVQALCGLAMFVYLVWGI 108


>gi|239993979|ref|ZP_04714503.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Alteromonas macleodii ATCC 27126]
          Length = 115

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 45/101 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   ++  R TA     + +F   FFI   +  + +   + S +A+        +++ 
Sbjct: 10  RDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVFTLAALVAVM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H+++G+  ++ DY+    L+    ++ +      +   LF
Sbjct: 70  IHVRIGLWQVLTDYVKSAGLRAGLQYILNIIAFGYVAVGLF 110


>gi|254786525|ref|YP_003073954.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Teredinibacter turnerae T7901]
 gi|237684865|gb|ACR12129.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Teredinibacter turnerae T7901]
          Length = 123

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 43/100 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QRF+A+    + +  + F I +    Y +     S + +     L  +S  
Sbjct: 10  RSGLSDWLIQRFSALVLATYTLVVLGFLILHPQLTYAEWSGFYSQLWMRVFSLLVLVSTV 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+  ++ DY+  R++    L +    +L+  +  +
Sbjct: 70  AHGWIGLWGVLTDYVTSRMIGSSALMLRMIALLIYALISV 109


>gi|330973470|gb|EGH73536.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 122

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 40/103 (38%), Gaps = 1/103 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           ++ G   ++ QR +A+    + IF I + + +    Y Q   + ++  +     L  +++
Sbjct: 9   SRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPSRSYAQWHGLFAHNGMRIFSLLALVAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             H  +GM  I  DY+    L              +    +F+
Sbjct: 69  GAHAWVGMWTIATDYLTPMALGKSA-TAVRFLFQAVCGVLMFA 110


>gi|332535003|ref|ZP_08410819.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035570|gb|EGI72063.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 115

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 48/101 (47%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   F+  R TA+    + IF I +F+   +  +E    + SN+A+     +  I I 
Sbjct: 10  RDGVQDFVSLRTTALIISAYAIFIIGYFLATPEVTFEAWTGLFSNLAMKGFTLITLICIM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH ++G+  ++ DY+    L+ +  F+ +   +  +   L 
Sbjct: 70  VHTRIGLWQVLTDYVKCSKLRAVLGFVLNLMAVAYVAIGLI 110


>gi|291614299|ref|YP_003524456.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sideroxydans lithotrophicus ES-1]
 gi|291584411|gb|ADE12069.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Sideroxydans lithotrophicus ES-1]
          Length = 115

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 44/101 (43%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     + +  + + +      Y+  + + S   + +   L  +S+
Sbjct: 9   AHYGLRDWLAQRVTAAVMAVYSLVVVVYLLMQPSLGYDTWIDLFSGNIMRTFSMLFLLSL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H  +G++ I+ DY+    +++    +    ++L  I+ L
Sbjct: 69  FYHAWIGVRDIVMDYVKPAGIRLSIHVLVILALVLYTIWSL 109


>gi|296138695|ref|YP_003645938.1| succinate dehydrogenase cytochrome b subunit [Tsukamurella
           paurometabola DSM 20162]
 gi|296026829|gb|ADG77599.1| succinate dehydrogenase cytochrome b subunit [Tsukamurella
           paurometabola DSM 20162]
          Length = 155

 Score = 49.3 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 36/103 (34%), Gaps = 5/103 (4%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPY-----EQIVSVLSNVAVASIMGLGTISISV 79
           ++  RF+ IA +  +   +   +              +    ++               +
Sbjct: 42  WLFMRFSGIALLVLVFGHVFIMLALDSDGVHRINAAFVAQRWASPFWQIWDITMLWLAQL 101

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           H   G++VII+DY      +     +    ++L++    ++LL
Sbjct: 102 HGGNGLRVIIDDYAKKDRTRFWLKALLVLSMILVVGLGSYALL 144


>gi|71279703|ref|YP_268941.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Colwellia psychrerythraea 34H]
 gi|71145443|gb|AAZ25916.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Colwellia psychrerythraea 34H]
          Length = 115

 Score = 49.3 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 40/88 (45%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           + ++G   FI  R +AI  + + +    FF+      Y+      + ++V     +  ++
Sbjct: 8   AGRNGVHDFILLRASAIILVLYTLLLAGFFVVTPSVTYDVWQGFFACMSVKVATVMALLA 67

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLF 104
           + VH ++G+  ++ DY+    L+    F
Sbjct: 68  LLVHAKIGVWQVLSDYVKPAFLRGALQF 95


>gi|261856936|ref|YP_003264219.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Halothiobacillus neapolitanus c2]
 gi|261837405|gb|ACX97172.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Halothiobacillus neapolitanus c2]
          Length = 116

 Score = 49.3 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 47/101 (46%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A+ G   ++ QR TA+  + + +F   + + +  + +     +  ++ V     +  +S+
Sbjct: 9   ARYGIKDWLVQRLTAVVMVIYTLFITGYLLWHPVSNFADWQMMFHSLPVRLFSLIFLLSL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            VH  LGM+ I  DYIH  L+++    +    ++    + +
Sbjct: 69  FVHAWLGMRDIFMDYIHPTLIRLGLHALVILALVAYTAWAV 109


>gi|226941337|ref|YP_002796411.1| SdhD [Laribacter hongkongensis HLHK9]
 gi|226716264|gb|ACO75402.1| SdhD [Laribacter hongkongensis HLHK9]
          Length = 116

 Score = 49.3 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 43/104 (41%), Gaps = 3/104 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TA   + + +  +   +    + YE   ++ S   V  I  +  I++
Sbjct: 10  AGYGVKDWIVQRMTAAVMLVYTVLIVLMLLAMP-SSYEGWQALFSLTWVQVITQITFIAV 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMF--LFMNSCFVLLLIIFCLF 119
             H+ +G++ +  DYI    L++    L        L+  F + 
Sbjct: 69  VWHLWVGIRDLWMDYIKPDGLRLALHALTAVWLVGCLVYSFVVV 112


>gi|3273344|dbj|BAA31214.1| fumarate reductase cytochrome b small subunit [Rhodoferax
           fermentans]
          Length = 121

 Score = 49.3 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA+    F +  +A  I       YE    + +   + ++  +  +S
Sbjct: 14  AHYGVRDWLSQRVTAVILALFTVLLLAQVIFSKGPISYELWAGIFAAQWMKTLTFVVFLS 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMF 102
           +  H+ +GM+ I  DY+    ++ + 
Sbjct: 74  LFYHVWVGMRNIFMDYVKPYAVRFVL 99


>gi|294340932|emb|CAZ89327.1| putative Succinate dehydrogenase hydrophobic membrane anchor
           protein (sdhD) [Thiomonas sp. 3As]
          Length = 121

 Score = 48.9 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 45/101 (44%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR TA     F +  + +F+  G   +E+   + +   +  +  +  +++
Sbjct: 15  AHYGLRDWMAQRVTAAVIAVFTLVLLVYFLAPGPLSFERWHDLFAQQWMKLLTFVTVLAL 74

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             H+ +GM+ I  DY+    ++++       ++L    + L
Sbjct: 75  IYHVWVGMRDIWMDYVKPVGVRLLLQIGTILWLLACAGWAL 115


>gi|192360343|ref|YP_001981988.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Cellvibrio japonicus Ueda107]
 gi|190686508|gb|ACE84186.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Cellvibrio japonicus Ueda107]
          Length = 123

 Score = 48.9 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 43/100 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR   +    + IF +A+ +   +  YEQ  S+ S + +        +S  
Sbjct: 10  RSGLYDWLIQRVGGVIMAAYTIFIVAYLVLNPELTYEQWQSLYSQLWMRVFSLAVLLSFI 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
            H  +G+  ++ DY+  RLL     F+     ++L    +
Sbjct: 70  SHAWIGLWAVLTDYLTVRLLGSKATFLRIFAQIVLGAVAV 109


>gi|268590351|ref|ZP_06124572.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Providencia rettgeri DSM 1131]
 gi|291314261|gb|EFE54714.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Providencia rettgeri DSM 1131]
          Length = 114

 Score = 48.9 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 36/87 (41%), Gaps = 1/87 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI    ++++ + F     D  Y+      ++        L   SI 
Sbjct: 10  RTGIQDWLLIRGSAIVIALYVLYIVGFVA-INDITYDVWRGFFASSVTKVFTILTLFSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
           VH  +GM  ++ DY+    ++++    
Sbjct: 69  VHAWIGMWQVLTDYVKPLAIRLVLQLA 95


>gi|329897268|ref|ZP_08272006.1| Succinate dehydrogenase hydrophobic membrane anchor protein [gamma
           proteobacterium IMCC3088]
 gi|328921264|gb|EGG28660.1| Succinate dehydrogenase hydrophobic membrane anchor protein [gamma
           proteobacterium IMCC3088]
          Length = 119

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 38/98 (38%), Gaps = 2/98 (2%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   F+ QR T++  + +  +     +      Y Q  ++ +   +        +S+ 
Sbjct: 10  RNGLSDFLVQRITSVILLAYFAWLAYVLV--AGTDYAQWEALFAATWMRIFSVAALLSLV 67

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIF 116
            H  +GM  ++ DY+  RL+      +     L +   
Sbjct: 68  FHAWIGMWGVLSDYVTERLMGPKGNVLRFLLQLAIGAA 105


>gi|59711427|ref|YP_204203.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Vibrio fischeri ES114]
 gi|197335345|ref|YP_002155582.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio fischeri MJ11]
 gi|59479528|gb|AAW85315.1| succinate dehydrogenase, membrane subunit, binds cytochrome b556
           [Vibrio fischeri ES114]
 gi|197316835|gb|ACH66282.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Vibrio fischeri MJ11]
          Length = 115

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   FI  R +AI    + ++ + F     +  Y    +    +   +   L  +SI 
Sbjct: 10  RNGVHDFILIRASAIILTLYTLYIVGFCAFGPELTYLSWTNFFGGLFTKAFTMLALLSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMF------LFMNSCFVLLLIIFCL 118
           +H  +G+  ++ DYI   +L+ +       +     F  L+I++ +
Sbjct: 70  IHAWIGLWQVLTDYIKPVMLRALLQLGLVSVLFVYFFSGLIIVWGV 115


>gi|257453554|ref|ZP_05618844.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Enhydrobacter aerosaccus SK60]
 gi|257449012|gb|EEV23965.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Enhydrobacter aerosaccus SK60]
          Length = 123

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 43/106 (40%), Gaps = 3/106 (2%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  ++ QR +A+    + +  + +F+ +    +E     + ++ +     L  +
Sbjct: 18  GLTGSGSRDWVVQRISAVVLAVYSLVMLGWFLTHQ-PTFELWQGFMLSLPMRLFTLLMIL 76

Query: 76  SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSC--FVLLLIIFCLF 119
           ++  H  +GM  ++ DY+    L+ +          V L     +F
Sbjct: 77  ALVGHAWVGMWTVLTDYVKSNGLRFVLQSAMILAVLVYLFWGVMIF 122


>gi|327398308|ref|YP_004339177.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hippea maritima DSM 10411]
 gi|327180937|gb|AEA33118.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Hippea maritima DSM 10411]
          Length = 123

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFII--FFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
           R  GS K G   ++ QR + +A +  ++  FFI  F+      Y+ + + L++       
Sbjct: 10  RYQGSGKGGDLSWLLQRVSGVALLVLLLGHFFIEHFVGGP-LDYQHVAARLASPLWKVFD 68

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
               +    H   G+ + IEDY+H        +F    F ++ II+ + + + I
Sbjct: 69  LTFVVFALYHGINGIFMNIEDYVHSGWR----VFWKGFFWVVGIIYLVLAAITI 118


>gi|313668608|ref|YP_004048892.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria lactamica ST-640]
 gi|313006070|emb|CBN87531.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Neisseria lactamica 020-06]
          Length = 108

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/89 (15%), Positives = 33/89 (37%), Gaps = 1/89 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +  QR TA+  + + +  +          Y    +  S   V     +  +++
Sbjct: 4   AHYGLRDWAMQRATAVIMLIYTVALLVVLFTLP-KEYSAWQAFFSQTWVKVFTQVSFLAV 62

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
            +H  +G++ +  DYI    +++      
Sbjct: 63  FLHAWVGIRDLWMDYIKPFGVRLFLQVAT 91


>gi|300113364|ref|YP_003759939.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Nitrosococcus watsonii C-113]
 gi|299539301|gb|ADJ27618.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosococcus watsonii C-113]
          Length = 109

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 52/104 (50%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G   ++ QR TA+  +  ++ F+A  ++     YE   + +++  V+ ++ L   ++ +
Sbjct: 6   SGLRAWLAQRGTAVTMLVLLLLFLARLMQDSFPTYEAWRAWINDPLVSIMVALFFGALLL 65

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
           H  +G++ II DY+    L+++  F+       +  + +  LL+
Sbjct: 66  HSWIGLRNIILDYVDPTPLRLLAHFLVVVVYSAIGFWVIRILLR 109


>gi|56479263|ref|YP_160852.1| succinate dehydrogenase (membrane anchor subunit) [Aromatoleum
           aromaticum EbN1]
 gi|56315306|emb|CAI09951.1| Succinate dehydrogenase (membrane anchor subunit) [Aromatoleum
           aromaticum EbN1]
          Length = 115

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 42/97 (43%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TA+  + F I F    ++  +  +E    +  +  +     L  +++
Sbjct: 9   AHYGLRDWIGQRATAVFMVIFTILFAIAALRLPEMTHEAWSGLFRSGVMRFFTFLFFLAL 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
             H  +G++ I  DYI+   ++++   +    ++   
Sbjct: 69  FYHAWIGVRDIFMDYINPVGVRLVLHVVTIFVLVGYA 105


>gi|71064680|ref|YP_263407.1| succinate dehydrogenase subunit D [Psychrobacter arcticus 273-4]
 gi|71037665|gb|AAZ17973.1| succinate dehydrogenase subunit D [Psychrobacter arcticus 273-4]
          Length = 134

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 49/102 (48%), Gaps = 4/102 (3%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
             G+  +I QR +A+    + +  + FF+ +GD  Y +  + ++++ +     +  ++++
Sbjct: 15  GSGSRDWIVQRISAVVLAVYSVVLLGFFLTHGDVTYTEWSNFMTSLPMRLFSLVAVLALA 74

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMF----LFMNSCFVLLLIIF 116
            H  +GM  +  DYI    L        L + +  ++ +++F
Sbjct: 75  GHAWIGMWTVFTDYITTGKLGASAAGLRLVLQTLMIIAVLVF 116


>gi|213018856|ref|ZP_03334664.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|212995807|gb|EEB56447.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 101

 Score = 48.5 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 5/90 (5%)

Query: 35  NIPFIIFFIAFFIK--YGDAPY---EQIVSVLSNVAVASIMGLGTISISVHMQLGMQVII 89
            +    +FI  F    Y D+P    E++   +++        +    I  H  LGMQV+ 
Sbjct: 1   MLFLFPWFIYSFSCTFYVDSPLSFNEKLFQAINHPLELLFFVILVFCIFWHAVLGMQVVC 60

Query: 90  EDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           EDYI   LL+I  +        +  I   F
Sbjct: 61  EDYIDSVLLRIFTITCIKYLSSITYIVLAF 90


>gi|238898941|ref|YP_002924623.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with SdhC [Candidatus Hamiltonella defensa 5AT
          (Acyrthosiphon pisum)]
 gi|229466701|gb|ACQ68475.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556
          with SdhC [Candidatus Hamiltonella defensa 5AT
          (Acyrthosiphon pisum)]
          Length = 115

 Score = 48.1 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 30/75 (40%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          ++G   ++  R +AI    ++ +   FF    +  YE      +         L   SI 
Sbjct: 10 RNGIQDWLLLRASAIIIALYVFYLFGFFAITPNVTYEIWQHFFAAAFTKIFTLLTLFSIL 69

Query: 79 VHMQLGMQVIIEDYI 93
          +H  +G+  +  DY+
Sbjct: 70 IHAWIGLWQVFTDYV 84


>gi|261401136|ref|ZP_05987261.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria lactamica ATCC 23970]
 gi|269208914|gb|EEZ75369.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria lactamica ATCC 23970]
          Length = 113

 Score = 48.1 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 34/94 (36%), Gaps = 1/94 (1%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +     G   +  QR TA+  + + +  +          Y    +  S   V     +
Sbjct: 4   RKLTGVHYGLRDWAMQRATAVIMLIYTVALLVVLFTLP-KEYSAWQAFFSQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMN 106
             +++ +H  +G++ +  DYI    +++      
Sbjct: 63  SFLAVFLHAWVGIRDLWMDYIKPFGVRLFLQVAT 96


>gi|119472930|ref|ZP_01614803.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Alteromonadales bacterium TW-7]
 gi|119444648|gb|EAW25957.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Alteromonadales bacterium TW-7]
          Length = 115

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 47/101 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   ++  R TA+    + IF I +F+   +  +E    + SN+A+     +  + I 
Sbjct: 10  RDGVQDYVSLRTTALIISAYAIFIIGYFLATPEVTFEAWTGLFSNLAMKGFTLVTLVCIM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH ++G+  ++ DY+    L+    F+ +   +  +   L 
Sbjct: 70  VHTRIGLWQVLTDYVKNSKLRAFLGFVLNLMAVAYVAIGLI 110


>gi|119774561|ref|YP_927301.1| succinate dehydrogenase, cytochrome subunit B [Shewanella
           amazonensis SB2B]
 gi|119767061|gb|ABL99631.1| succinate dehydrogenase subunit D [Shewanella amazonensis SB2B]
          Length = 115

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +A+    + IF ++F        +E    + S + +     L  I++ 
Sbjct: 10  RSGVHDFILLRASAVILACYTIFLVSFIALSAPLTFEIWHGLFSTLPMKVFTLLALIALL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFL--FMNSCFVLLLIIFCLF 119
           +H  +G+  ++ DY+    L+ +    F+ + F  L     + 
Sbjct: 70  IHAWIGIWQVLTDYVKQTALRGVLQFTFVVTAFAYLAAGIVIV 112


>gi|222111458|ref|YP_002553722.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acidovorax ebreus TPSY]
 gi|221730902|gb|ACM33722.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acidovorax ebreus TPSY]
          Length = 121

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 37/88 (42%), Gaps = 1/88 (1%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA+    F +  +A  I       Y+    + S+  +  +     ++
Sbjct: 14  AHYGVRDWLVQRATAVLMALFTLVLLACVIFSKGPIGYDLWAGIFSSQWMKVLTLSVIVA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLF 104
           ++ H  +G++ +  DYI    L++    
Sbjct: 74  LAWHAWVGVRNVWMDYIKPAGLRLTLQV 101


>gi|319943669|ref|ZP_08017950.1| succinate dehydrogenase cytochrome b small subunit [Lautropia
           mirabilis ATCC 51599]
 gi|319742902|gb|EFV95308.1| succinate dehydrogenase cytochrome b small subunit [Lautropia
           mirabilis ATCC 51599]
          Length = 116

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 36/102 (35%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   ++ QR T +    + IF +          Y     +     +     +  +++
Sbjct: 10  AHYGLRDWLAQRITGLIMALYTIFLLCSVCTLPQLDYISWSQLFQGQFMKVATMVAVLAL 69

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
             H  +G++ +  DY+   L++++        +     +  F
Sbjct: 70  IYHAWVGIRDLYMDYLKNTLVRLVLEVGTLVLLTGYAFWAAF 111


>gi|121605924|ref|YP_983253.1| succinate dehydrogenase, cytochrome b subunit [Polaromonas
           naphthalenivorans CJ2]
 gi|120594893|gb|ABM38332.1| succinate dehydrogenase subunit D [Polaromonas naphthalenivorans
           CJ2]
          Length = 121

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 42/102 (41%), Gaps = 1/102 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  GT  ++ QR TA     F +  +   +       Y+Q   + S   +  +     ++
Sbjct: 14  AHYGTRDWLSQRITAALMAIFTLLLLGQVLLSKGPIGYDQWAGIFSAQWMKILTFAVIVA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           +  H+ +GM+ I  DYI    L+++       +++    + +
Sbjct: 74  LLWHVWVGMRDIWMDYIKPVGLRLLLQVFTIVWLVACAGWGI 115


>gi|149926164|ref|ZP_01914426.1| putative transmembrane succinate dehydrogenase (hydrophobic
           membrane anchor subunit) oxidoreductase protein
           [Limnobacter sp. MED105]
 gi|149824982|gb|EDM84194.1| putative transmembrane succinate dehydrogenase (hydrophobic
           membrane anchor subunit) oxidoreductase protein
           [Limnobacter sp. MED105]
          Length = 125

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 40/106 (37%), Gaps = 5/106 (4%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV-----LSNVAVASIMGL 72
           A  G   ++ QR TA+    + I      +   D  Y + V       LS      +  L
Sbjct: 14  AHYGLKEWVAQRITAVIMSVYTIGLFLAVLFTPDLDYAKWVGFFNFTVLSFPLGKILALL 73

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             +S+  H  +G++ I  DY+    +++      + ++L    +  
Sbjct: 74  AILSLCYHAYIGIRDIWMDYVKPTGIRLGLQVFTALWLLGAAGYAA 119


>gi|319949457|ref|ZP_08023517.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Dietzia cinnamea P4]
 gi|319436883|gb|EFV91943.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Dietzia cinnamea P4]
          Length = 143

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 13/105 (12%), Positives = 37/105 (35%), Gaps = 4/105 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           +I  R++ +A +   +  +   +   +      +  +     +   A    L      +H
Sbjct: 36  WIFMRYSGVALVILTLGHLTVGLMIDEGVHRIDWAYVADRWQSPFWAIWDILMLWLAMLH 95

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIA 125
              G++ II DY      +     +     +L ++   +++  +A
Sbjct: 96  GANGVRTIIADYSRKDSTRFWLNSILLVATVLTLVLGTYAIFGLA 140


>gi|332977197|gb|EGK13994.1| succinate dehydrogenase cytochrome b small subunit [Psychrobacter
           sp. 1501(2011)]
          Length = 128

 Score = 48.1 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 5   MRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNV 64
           MR+  G     G    G+  ++ QR +A+    + +  ++FF+  G   YEQ V  + ++
Sbjct: 6   MRNDSGIKSATGLTGSGSRDWVMQRISAVVLAVYAVVIVSFFLFNGHIGYEQWVMFIMSM 65

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMN--SCFVLLLIIFCLF 119
            +  +  L  ++++VH  +GM  +  DY+    L+I+       +  V L     +F
Sbjct: 66  PMRLLSLLAIVALAVHAWVGMWTVFTDYVKSTGLRIVLQAAMIIAILVYLFWGVMIF 122


>gi|209694422|ref|YP_002262350.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Aliivibrio salmonicida LFI1238]
 gi|208008373|emb|CAQ78528.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Aliivibrio salmonicida LFI1238]
          Length = 115

 Score = 47.7 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 44/106 (41%), Gaps = 6/106 (5%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   FI  R +AI    + ++ + F +   +  Y    +    +       L  +SI 
Sbjct: 10  RSGVHDFILIRASAIILTLYTLYIVGFCVFGPELTYMSWTNFFGGLFTKVFTMLALLSII 69

Query: 79  VHMQLGMQVIIEDYIH------YRLLKIMFLFMNSCFVLLLIIFCL 118
           +H  +G+  ++ DYI          L ++ + +   F  L+I++ +
Sbjct: 70  IHAWIGLWQVLTDYIKPVLLRALLQLGLVAVLLGYFFSGLIIVWGV 115


>gi|54293524|ref|YP_125939.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella pneumophila str. Lens]
 gi|53753356|emb|CAH14806.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Legionella pneumophila str. Lens]
          Length = 115

 Score = 47.7 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 43/94 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
            +G   ++ QR TA+    ++IF   F +   D  + Q   + +N        +G I+++
Sbjct: 10  GNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKVFQIATTIGLIALT 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLL 112
           +H  +G+  +  DY+   ++++    +   ++  
Sbjct: 70  LHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLFG 103


>gi|253990451|ref|YP_003041807.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211638982|emb|CAR67597.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781901|emb|CAQ85065.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Photorhabdus asymbiotica]
          Length = 115

 Score = 47.7 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 36/87 (41%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +AI  + ++I+ + F     D  YE      S+        L   SI 
Sbjct: 10  RTGIHDWLLLRASAIIIVLYVIYILGFVAITSDITYEVWRGFFSSSITKVFTVLALFSIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFM 105
            H  +GM  ++ DY+    L+++    
Sbjct: 70  AHAWIGMWQVLTDYVKPLALRLVLQLA 96


>gi|77360591|ref|YP_340166.1| succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with
           sdhC [Pseudoalteromonas haloplanktis TAC125]
 gi|76875502|emb|CAI86723.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Pseudoalteromonas haloplanktis TAC125]
          Length = 115

 Score = 47.7 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 47/101 (46%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +DG   F+  R TA+    + IF I +F+   +  +E    + SN+A+     +  + I 
Sbjct: 10  RDGVQDFVSLRTTALIISAYAIFIIGYFLATPEVTFEAWTGLFSNLAMKGFTLIALVCIM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           VH ++G+  ++ DY+    L+ +  F+ +      +   L 
Sbjct: 70  VHTRIGLWQVLTDYVKCAKLRAVLGFVLNLMAFAYVAIGLI 110


>gi|332992985|gb|AEF03040.1| putative succinate dehydrogenase, hydrophobic subunit, cytochrome
           b556 with sdhC [Alteromonas sp. SN2]
          Length = 115

 Score = 47.7 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 45/101 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R TA     + +F   FFI   +  +     + S +A+        I+I 
Sbjct: 10  RNGIQDYVSLRTTAAIIFAYTVFMAWFFISTDNITFIAWRGLFSGLAMKVFTLAALIAIM 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +H+++G+  ++ DY+    L+ +  ++ +      +   LF
Sbjct: 70  IHVRIGLWQVLTDYVKASGLRAIIQYVLNIIAFGYVAVGLF 110


>gi|323357073|ref|YP_004223469.1| succinate dehydrogenase, hydrophobic anchor subunit [Microbacterium
           testaceum StLB037]
 gi|323273444|dbj|BAJ73589.1| succinate dehydrogenase, hydrophobic anchor subunit [Microbacterium
           testaceum StLB037]
          Length = 152

 Score = 47.7 bits (113), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 44/121 (36%), Gaps = 7/121 (5%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVL 61
           R+   R +G    K G   +I  R + +  +  I   +   +  GD      +  +   L
Sbjct: 14  RTPSVRKKGSNLEKWG---WIYMRASGVLLLVLIFGHLFVNLMLGDGIHQIDFAFVAGKL 70

Query: 62  SNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           ++        L      +H   GM+ I+ DY+    ++ + ++       LLI+     +
Sbjct: 71  ASPFWQWWDVLMLWLALIHGANGMRTIVNDYVTNAAVRKVLVWSLWLSAGLLILLGTLVV 130

Query: 122 L 122
            
Sbjct: 131 F 131


>gi|121611267|ref|YP_999074.1| succinate dehydrogenase, cytochrome b subunit [Verminephrobacter
           eiseniae EF01-2]
 gi|121555907|gb|ABM60056.1| succinate dehydrogenase subunit D [Verminephrobacter eiseniae
           EF01-2]
          Length = 122

 Score = 47.4 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 42/101 (41%), Gaps = 3/101 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA     F +  +A  I       Y Q   +  +  + S+     ++
Sbjct: 15  AHYGLRDWLCQRVTAALMALFTLVLLARLIFSKGPIGYHQWAGIFHSQWMKSLTFAIIVA 74

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           ++ H  +G++ I+ DYIH   L+++        V L+    
Sbjct: 75  LAWHAWVGVRDILMDYIHPVGLRLVLQVG--ALVWLVGCAG 113


>gi|294637439|ref|ZP_06715729.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Edwardsiella tarda ATCC 23685]
 gi|291089380|gb|EFE21941.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Edwardsiella tarda ATCC 23685]
          Length = 115

 Score = 47.0 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 35/75 (46%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          ++G   ++  R +AI    ++I+ +AF +  G   Y   +   S+        L  + + 
Sbjct: 10 RNGIQDWLLLRASAIIMTLYVIYLVAFIVGAGPLNYGVWLDFFSSRLTQVFTLLTLLCVL 69

Query: 79 VHMQLGMQVIIEDYI 93
          VH  +GM  ++ DY+
Sbjct: 70 VHAWIGMWQVLTDYV 84


>gi|193214176|ref|YP_001995375.1| succinate dehydrogenase membrane subunit [Chloroherpeton thalassium
           ATCC 35110]
 gi|193087653|gb|ACF12928.1| succinate dehydrogenase, membrane subunit, putative [Chloroherpeton
           thalassium ATCC 35110]
          Length = 172

 Score = 47.0 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 4/67 (5%)

Query: 53  PYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLL 112
            YE++ + LSN        L  I    H   G+  II+DY+ +  L++  +     F  +
Sbjct: 82  TYEKVTTRLSNPIWKIFDLLFLIFGLYHGMNGLLNIIDDYVRHTGLRLTLV----SFCWV 137

Query: 113 LIIFCLF 119
           L    L 
Sbjct: 138 LAALLLV 144


>gi|169630753|ref|YP_001704402.1| succinate dehydrogenase, hydrophobic membrane anchor protein SdhD
           [Mycobacterium abscessus ATCC 19977]
 gi|169242720|emb|CAM63748.1| Probable succinate dehydrogenase, hydrophobic membrane anchor
           protein SdhD [Mycobacterium abscessus]
          Length = 160

 Score = 47.0 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 36/102 (35%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           +I  R + +  I   +  +   + + +      +  +    ++    +   L      +H
Sbjct: 52  WIFMRLSGVVLIFLALGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLMLWLAQLH 111

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              GM+ II DY      +     + +  ++  ++   + LL
Sbjct: 112 GGNGMRTIIADYTRKDSTRFWLNCLLALSIIFTVVLGTYVLL 153


>gi|330503171|ref|YP_004380040.1| succinate dehydrogenase subunit D [Pseudomonas mendocina NK-01]
 gi|328917457|gb|AEB58288.1| succinate dehydrogenase subunit D [Pseudomonas mendocina NK-01]
          Length = 106

 Score = 47.0 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 39/97 (40%), Gaps = 1/97 (1%)

Query: 26  IKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGM 85
           + QR +A+    + +F + + I      Y +   + S+ A+     L  +++SVH  +GM
Sbjct: 1   MAQRVSAVVLAAYTLFLLGYVICNPGMGYAEWHGLFSHTAMRIFSLLALVALSVHAWVGM 60

Query: 86  QVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
             I  DY+    L              +    +F++ 
Sbjct: 61  WTISTDYLTPMALGKWA-TGVRFLFQAVCGIAMFAMF 96


>gi|206889944|ref|YP_002248615.1| succinate dehydrogenase membrane subunit, putative
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741882|gb|ACI20939.1| succinate dehydrogenase membrane subunit, putative
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 104

 Score = 47.0 bits (111), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 36/95 (37%), Gaps = 2/95 (2%)

Query: 25  FIKQRFTAIANI--PFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQ 82
           ++  R T +  +      F +  F+ + +  Y  ++  LS  +      +   S   H  
Sbjct: 4   WLLHRITGVILVVGLLYHFILMHFMGHDNYSYNAVMQRLSEPSWKIFNIVFLFSALYHGF 63

Query: 83  LGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
            G+  ++ +Y+    LK +  FM     + L  + 
Sbjct: 64  YGLNGVVTEYVRNNSLKRILKFMAFTVPIGLAFYG 98


>gi|237653214|ref|YP_002889528.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thauera sp. MZ1T]
 gi|237624461|gb|ACR01151.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Thauera sp. MZ1T]
          Length = 116

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 39/97 (40%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TA+    + I F        +  Y++   + S+     +  L  +S+
Sbjct: 10  AHYGLKDWIAQRATAVYMAAYTIIFALCAFSLRELNYQEWSGLFSHGLFKFLSFLFFLSV 69

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLI 114
             H  +G++ +  DYI    +++    +    ++   
Sbjct: 70  FYHAWIGIRDLWMDYIKPNGVRLALHLVTIFVLVGYA 106


>gi|319760460|ref|YP_004124398.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Candidatus Blochmannia vafer str. BVAF]
 gi|318039174|gb|ADV33724.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Candidatus Blochmannia vafer str. BVAF]
          Length = 117

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 45/103 (43%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           K G   ++  RF+A+  I +I++ + F     +  YEQ  S   +  +     +    + 
Sbjct: 12  KHGVYEWLIVRFSAMLMILYILYILNFMCFNHNVSYEQWRSFFYSNKIRLFSIIILFFVL 71

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            H  +G++ ++EDYI     K + + +    +   ++  +  +
Sbjct: 72  QHTWIGIRHVLEDYIKSVQFKRLGMKLIGIVIYTYLLSGIVII 114


>gi|257069274|ref|YP_003155529.1| succinate dehydrogenase subunit D [Brachybacterium faecium DSM
           4810]
 gi|256560092|gb|ACU85939.1| succinate dehydrogenase subunit D [Brachybacterium faecium DSM
           4810]
          Length = 150

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 35/102 (34%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYG----DAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  +   +   +  G       +  +    ++        L      +H
Sbjct: 29  WMFMRASGVLLVILVFGHLFVNLWLGQGVKGIDFAFVGGKWASPFWQVWDLLMLWLGLIH 88

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ II DY     L+++   +    V++ II     + 
Sbjct: 89  GGNGVRTIINDYARGDRLRLVLKGLLYFAVVVTIILGTLVIF 130


>gi|197284463|ref|YP_002150335.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Proteus mirabilis HI4320]
 gi|194681950|emb|CAR41361.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Proteus mirabilis HI4320]
          Length = 114

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R TAI    ++++F+ F     D  YE      S+        L  +SI 
Sbjct: 10  RTGIQDWLFLRATAIIIFLYVLYFVGFVAT-TDITYEVWRGFFSSSLTKVFTLLTLLSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           +H  +GM  ++ DYI    L++    
Sbjct: 69  IHAWIGMWQVLTDYIKPIALRLTLQL 94


>gi|320008970|gb|ADW03820.1| succinate dehydrogenase cytochrome b subunit [Streptomyces
           flavogriseus ATCC 33331]
          Length = 159

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 32/102 (31%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I  +  +I  +   +          +  +    ++               +H
Sbjct: 51  WLFMRLSGIVLVVLVIGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLAMLWLAMLH 110

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMN---SCFVLLLIIFCLF 119
              G++ +I DY      +     +    + F +LL    +F
Sbjct: 111 GANGLRTVINDYAERDNTRFWLKMLLYTATVFTVLLGTLVIF 152


>gi|227356641|ref|ZP_03841027.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Proteus mirabilis ATCC 29906]
 gi|227163149|gb|EEI48080.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Proteus mirabilis ATCC 29906]
          Length = 114

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R TAI    ++++F+ F     D  YE      S+        L  +SI 
Sbjct: 10  RTGIQDWLFLRATAIIIFLYVLYFVGFVAT-TDITYEVWRGFFSSSLTKVFTLLTLLSIL 68

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLF 104
           +H  +GM  ++ DYI    L++    
Sbjct: 69  IHAWIGMWQVLTDYIKPIALRLTLQL 94


>gi|91789452|ref|YP_550404.1| succinate dehydrogenase subunit D [Polaromonas sp. JS666]
 gi|91698677|gb|ABE45506.1| succinate dehydrogenase subunit D [Polaromonas sp. JS666]
          Length = 121

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 42/102 (41%), Gaps = 1/102 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA     F +  +A  +       Y++   + S+  +  +     I+
Sbjct: 14  AHYGLRDWLAQRVTAALMALFTLLVLAQILFSKGPIGYDKWAGIFSSQWMKVLTFTIIIA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           +  H+ +GM+ I  DYI    L++        +++    + +
Sbjct: 74  LLWHVWVGMRDIWMDYIKPVGLRLGLQVFTMVWLVACAGWGI 115


>gi|332528253|ref|ZP_08404258.1| succinate dehydrogenase subunit D [Hylemonella gracilis ATCC 19624]
 gi|332042273|gb|EGI78594.1| succinate dehydrogenase subunit D [Hylemonella gracilis ATCC 19624]
          Length = 121

 Score = 46.2 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 39/101 (38%), Gaps = 3/101 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   +I QR TA+    F +  +A  +       YE   ++ +   +  +     I+
Sbjct: 14  AHYGVRDWIVQRATAVIMALFTLLLLARVLLSSGPLGYESWAAIFAPQWMKVVTFAVVIA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           +  H+ +GM+ I  DYI    L++         V L     
Sbjct: 74  LVWHVWVGMRDIWMDYIKPVWLRLSLQVFT--IVWLAGCAG 112


>gi|118473638|ref|YP_886047.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Mycobacterium smegmatis str. MC2 155]
 gi|118174925|gb|ABK75821.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Mycobacterium smegmatis str. MC2 155]
          Length = 156

 Score = 46.2 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 37/102 (36%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ IA +   +  +   + + D      +  +    ++               +H
Sbjct: 48  WLFMRFSGIALVFLALGHLFIMLMWQDGVYRIDFNYVAERWASPFWQIWDMALLWLAMIH 107

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              GM+ II DY    + K      L + + F L+L  + L 
Sbjct: 108 GANGMRTIIGDYARKNVTKFWLNSLLLLATGFTLVLGSYVLV 149


>gi|121595115|ref|YP_987011.1| succinate dehydrogenase subunit D [Acidovorax sp. JS42]
 gi|120607195|gb|ABM42935.1| succinate dehydrogenase subunit D [Acidovorax sp. JS42]
          Length = 121

 Score = 46.2 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 40/101 (39%), Gaps = 3/101 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA     F I  +A  I       Y++   + S   +  +     ++
Sbjct: 14  AHYGIRDWLAQRVTAALMALFTIALLAQVIFSKGPIGYDRWAGIFSTQWMKVLTFSVIVA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           +  H+ +G++ +  DY+    L+++        V L+    
Sbjct: 74  LVWHVWVGVRDVWMDYVKSAGLRLLLQVFT--IVWLVACAG 112


>gi|50085919|ref|YP_047429.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter sp.
           ADP1]
 gi|49531895|emb|CAG69607.1| succinate dehydrogenase, hydrophobic subunit [Acinetobacter sp.
           ADP1]
          Length = 121

 Score = 46.2 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 44/110 (40%), Gaps = 7/110 (6%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +    + + +G   YEQ    +  + +  +  L  +
Sbjct: 6   GLTGSGSRDWFIQRISAVVLAVYTVVIFGWILFHGGFSYEQWSGFMMTLPMKILSLLAIL 65

Query: 76  SISVHMQLGMQVIIEDYI-------HYRLLKIMFLFMNSCFVLLLIIFCL 118
           S++ H  +GM  +  DY+           L+++        V +  I+ +
Sbjct: 66  SLAAHAWIGMWQVFTDYVTTRQMGPSASGLRLVLTSAVIIAVFVFAIWGI 115


>gi|262201720|ref|YP_003272928.1| succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Gordonia bronchialis DSM 43247]
 gi|262085067|gb|ACY21035.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Gordonia bronchialis DSM 43247]
          Length = 153

 Score = 46.2 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/105 (13%), Positives = 38/105 (36%), Gaps = 5/105 (4%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA-----PYEQIVSVLSNVAVASIMGLGTISISV 79
           ++  RF+ +A I   I  +   + +            ++   S+               +
Sbjct: 43  WMFMRFSGLALIILTIGHMFIMLAWDSQGVHRIDAAFVLERWSSPFWQIWDLSMLWLAQL 102

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           H   G++ +I DY      +     +    ++L+++   +++L I
Sbjct: 103 HGGNGVRTVIADYSRKDSTRFWLNVLLGVSMILILVLGTYAILTI 147


>gi|302536397|ref|ZP_07288739.1| succinate dehydrogenase membrane subunit [Streptomyces sp. C]
 gi|302445292|gb|EFL17108.1| succinate dehydrogenase membrane subunit [Streptomyces sp. C]
          Length = 160

 Score = 46.2 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 35/102 (34%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I  +  +I  +   +          +  +    ++        L      +H
Sbjct: 52  WLFMRLSGIVLVVLVIGHLVIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLLMLWLAMLH 111

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ +I DY      ++     L+  + F +LL    +F
Sbjct: 112 GSNGLRTVINDYAERANTRLWLKGLLYTATVFTILLGTLVIF 153


>gi|282860944|ref|ZP_06270010.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Streptomyces sp. ACTE]
 gi|282564680|gb|EFB70216.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Streptomyces sp. ACTE]
          Length = 160

 Score = 46.2 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 32/102 (31%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I  +  +I  +   +          +  +    ++               +H
Sbjct: 52  WLFMRLSGIVLVVLVIGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLAMLWLAMLH 111

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMN---SCFVLLLIIFCLF 119
              G++ +I DY      +     +    + F +LL    +F
Sbjct: 112 GANGLRTVINDYAERDNTRFWLKMLLYTATVFTVLLGTLVIF 153


>gi|261377704|ref|ZP_05982277.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria cinerea ATCC 14685]
 gi|269145977|gb|EEZ72395.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria cinerea ATCC 14685]
          Length = 113

 Score = 45.8 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/106 (13%), Positives = 42/106 (39%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +  +   V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLIYTVVLLVVLFTLP-KEYSAWQAFFNQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             +++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFLAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|238752113|ref|ZP_04613596.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
          [Yersinia rohdei ATCC 43380]
 gi|238709690|gb|EEQ01925.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
          [Yersinia rohdei ATCC 43380]
          Length = 115

 Score = 45.8 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 34/75 (45%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          ++G   ++  R +AI    ++++ + F +   D  YE      ++        L  ++I 
Sbjct: 10 RNGVHDWLLLRASAIVITLYVLYILGFVVIVPDITYEIWRGFFASHITKVFTLLTLLAIL 69

Query: 79 VHMQLGMQVIIEDYI 93
           H  +G+  ++ DYI
Sbjct: 70 AHAWIGLWQVLTDYI 84


>gi|283458662|ref|YP_003363297.1| succinate dehydrogenase, hydrophobic anchor subunit [Rothia
           mucilaginosa DY-18]
 gi|283134712|dbj|BAI65477.1| succinate dehydrogenase, hydrophobic anchor subunit [Rothia
           mucilaginosa DY-18]
          Length = 161

 Score = 45.8 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 40/103 (38%), Gaps = 7/103 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQ----IVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +  GD  +      +    +N        L      +H
Sbjct: 39  WLGMRLSGVVLVVLIFGHLFSNLMVGDGIHAIDFGFVGGKWANPFWQVWDLLLLWLAMLH 98

Query: 81  MQLGMQVIIEDYIHYRLLKIMF---LFMNSCFVLLLIIFCLFS 120
              G++VII+DY     L+I     LF    FVLL+    +F+
Sbjct: 99  GANGIRVIIDDYAEKDRLRIWLKVILFAACAFVLLVGTLTIFA 141


>gi|107101015|ref|ZP_01364933.1| hypothetical protein PaerPA_01002045 [Pseudomonas aeruginosa PACS2]
          Length = 106

 Score = 45.8 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 39/95 (41%), Gaps = 1/95 (1%)

Query: 26  IKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGM 85
           + QR +A+    ++IF + + I + +  Y     + S   +     L  +++SVH  +GM
Sbjct: 1   MAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIFSLLTLVALSVHAWVGM 60

Query: 86  QVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS 120
             I  DY+    L      +       +    +F+
Sbjct: 61  WTISTDYLTSMALGKAA-TVVRFLFQAVCGMAMFA 94


>gi|238920752|ref|YP_002934267.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           [Edwardsiella ictaluri 93-146]
 gi|238870321|gb|ACR70032.1| succinate dehydrogenase, hydrophobic membrane anchor protein,
           putative [Edwardsiella ictaluri 93-146]
          Length = 115

 Score = 45.8 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 46/103 (44%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++  R +AI    ++I+ +AF +  G   Y   +   S+        L  + I 
Sbjct: 10  RNGIQDWLLLRASAIVITLYVIYLLAFVVGAGPLNYTLWLDFFSSRITQVFTLLTLLCIL 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           +H  +GM  ++ DY+    L+++        +++ +I+    +
Sbjct: 70  IHAWIGMWQVLTDYVKPLALRLVLQLAIVVVLVVYLIYGTLVV 112


>gi|269139932|ref|YP_003296633.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Edwardsiella tarda EIB202]
 gi|267985593|gb|ACY85422.1| succinate dehydrogenase cytochrome b556 small membrane subunit
          [Edwardsiella tarda EIB202]
 gi|304559767|gb|ADM42431.1| Succinate dehydrogenase hydrophobic membrane anchor protein
          [Edwardsiella tarda FL6-60]
          Length = 115

 Score = 45.8 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 37/81 (45%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          ++G   ++  R +AI    ++I+ +AF +  G   Y   +   S+        L  + I 
Sbjct: 10 RNGIQDWLLLRASAIIITLYVIYLLAFVVGAGPLTYTLWLDFFSSRITQVFTLLTLLCIL 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          +H  +GM  ++ DY+    L+
Sbjct: 70 IHAWIGMWQVLTDYVKPLALR 90


>gi|126666299|ref|ZP_01737278.1| hypothetical protein MELB17_11961 [Marinobacter sp. ELB17]
 gi|126629100|gb|EAZ99718.1| hypothetical protein MELB17_11961 [Marinobacter sp. ELB17]
          Length = 59

 Score = 45.8 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 25/54 (46%)

Query: 30 FTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQL 83
           TA   +P +I+ +A  I       E +V  L+   VA  M L  I++  HM L
Sbjct: 1  MTAAILVPLVIWSLASLIAIVGGGRETVVGWLARPGVAIPMILLLIALFWHMAL 54


>gi|239814436|ref|YP_002943346.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Variovorax paradoxus S110]
 gi|239801013|gb|ACS18080.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Variovorax paradoxus S110]
          Length = 121

 Score = 45.4 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 41/108 (37%), Gaps = 1/108 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR T      F I  +A  I       Y+    + +   +  +      S
Sbjct: 14  AHYGLRDWLSQRITGGLMALFTIILLAQLIFTRGPIGYDLWAGIFAAQWMKVLTFCVIAS 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           +  H+ +GM+ +  DY+    +++        +++    + +  L KI
Sbjct: 74  LLYHVWVGMRDVWMDYVQPVGIRLALQIFTIVWLVGCAGWAIQVLWKI 121


>gi|255327363|ref|ZP_05368437.1| succinate dehydrogenase hydrophobic membrane anchor protein [Rothia
           mucilaginosa ATCC 25296]
 gi|255295643|gb|EET74986.1| succinate dehydrogenase hydrophobic membrane anchor protein [Rothia
           mucilaginosa ATCC 25296]
          Length = 161

 Score = 45.4 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 40/103 (38%), Gaps = 7/103 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQ----IVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +  GD  +      +    +N        L      +H
Sbjct: 39  WLGMRLSGVVLVVLIFGHLFSNLMVGDGIHAIDFGFVGGKWANPFWQVWDLLLLWLAMLH 98

Query: 81  MQLGMQVIIEDYIHYRLLKIMF---LFMNSCFVLLLIIFCLFS 120
              G++VII+DY     L++     LF    FVLL+    +F+
Sbjct: 99  GANGIRVIIDDYAEKDRLRVWLKVILFAACAFVLLVGTLTIFA 141


>gi|319792255|ref|YP_004153895.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Variovorax paradoxus EPS]
 gi|315594718|gb|ADU35784.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Variovorax paradoxus EPS]
          Length = 121

 Score = 45.4 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/108 (16%), Positives = 43/108 (39%), Gaps = 1/108 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR T      F +  +A  I       Y+    + +   +  +     +S
Sbjct: 14  AHYGLRDWLSQRITGGLMALFTVILLAQMIFTRGPIGYDLWAGIFAAQWMKVLTFSVIVS 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           +  H+ +GM+ +  DY+    ++++       +++    + +  L KI
Sbjct: 74  LLYHVWVGMRDVWMDYVQPVGIRLVLQIFTIVWLVGCAGWAIQVLWKI 121


>gi|90416068|ref|ZP_01224001.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [marine gamma proteobacterium HTCC2207]
 gi|90332442|gb|EAS47639.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [marine gamma proteobacterium HTCC2207]
          Length = 122

 Score = 45.4 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 47/104 (45%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++  R +A     ++IF + + +   +  Y    ++ S++ +     L  +SI+
Sbjct: 10  RSGLSDWLIARVSAYVMSAYLIFIVGYLMLTPELNYADWAALNSSLPMRMFSLLTILSIA 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
            H  +GM  ++ DY+  RL+      +   F L +I   L  ++
Sbjct: 70  AHAWIGMWCVLTDYVTVRLIGPKATALRIIFQLGMIAITLLYVI 113


>gi|260220785|emb|CBA28696.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 121

 Score = 45.4 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 42/101 (41%), Gaps = 3/101 (2%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR TA+    F I  +A  I +     Y++   + S   +  +     I+
Sbjct: 14  AHYGLRDWLAQRVTAVLMALFTIALLAQVILFKGPIGYDKWAGIFSQQWMKFLTFAVIIA 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
           +  H+ +G++ I  DY+    +++     +   V L+    
Sbjct: 74  MLYHVWVGVRDIWMDYVKPVSIRLSLQVFS--IVWLVGCAG 112


>gi|34496521|ref|NP_900736.1| succinate dehydrogenase, hydrophobic subunit [Chromobacterium
           violaceum ATCC 12472]
 gi|34102375|gb|AAQ58741.1| succinate dehydrogenase, hydrophobic subunit [Chromobacterium
           violaceum ATCC 12472]
          Length = 114

 Score = 45.4 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           A  G   +I QR TA+  + + +    F +    A YE   S+ S+  V     +  +++
Sbjct: 9   AGYGLRDWIMQRVTAVVMVLYTVALALFLLALP-AGYEGWKSLFSHTWVQLFTQVTLLAL 67

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMF-----LFMNSCFVLLLIIF 116
            +H+ +G++ +  DY+    +++       +++ SCF+  + + 
Sbjct: 68  FLHVWVGIRDVWMDYVKPVGIRLALHVFTIVWLVSCFIYSVKVV 111


>gi|254385209|ref|ZP_05000541.1| succinate dehydrogenase membrane subunit [Streptomyces sp. Mg1]
 gi|194344086|gb|EDX25052.1| succinate dehydrogenase membrane subunit [Streptomyces sp. Mg1]
          Length = 165

 Score = 45.4 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 35/102 (34%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I  +  +I  +   +          +  +    ++        L      +H
Sbjct: 57  WLFMRLSGIVLVVLVIGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLLMLWLAMLH 116

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ +I DY      ++     L+  + F +LL    +F
Sbjct: 117 GSNGLRTVINDYAERANTRLWLKGLLYTATVFTILLGTLVIF 158


>gi|54296563|ref|YP_122932.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Legionella pneumophila str. Paris]
 gi|53750348|emb|CAH11742.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Legionella pneumophila str. Paris]
          Length = 115

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 39/81 (48%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +G   ++ QR TA+    ++IF   F +   D  + Q   + +N        +G ++++
Sbjct: 10 GNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKLFQIATTIGLMALT 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          +H  +G+  +  DY+   +++
Sbjct: 70 LHAWIGIWTVTTDYMKCTVIR 90


>gi|284029309|ref|YP_003379240.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Kribbella flavida DSM 17836]
 gi|283808602|gb|ADB30441.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Kribbella flavida DSM 17836]
          Length = 153

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 35/102 (34%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +A +  ++  +   +  GD      +  +    +N        L      +H
Sbjct: 36  WLFMRLSGLALVVLVLGHLFVNLMVGDGINALDFGFVAGKWANPLWQVWDLLMLWLAMLH 95

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ II DY      +     +     +++++     + 
Sbjct: 96  GTNGLRTIINDYAEKDQTRFWLKSLLVTASIVVVVLGTLVIF 137


>gi|307609336|emb|CBW98820.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [Legionella pneumophila 130b]
          Length = 115

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 39/81 (48%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +G   ++ QR TA+    ++IF   F +   D  + Q   + +N        +G ++++
Sbjct: 10 GNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKVFQIATTIGLMALT 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          +H  +G+  +  DY+   +++
Sbjct: 70 LHAWIGIWTVTTDYMKCTVIR 90


>gi|325283228|ref|YP_004255769.1| succinate dehydrogenase cytochrome b subunit [Deinococcus
           proteolyticus MRP]
 gi|324315037|gb|ADY26152.1| succinate dehydrogenase cytochrome b subunit [Deinococcus
           proteolyticus MRP]
          Length = 125

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 38/103 (36%), Gaps = 6/103 (5%)

Query: 25  FIKQRFTAIANIPFI---IFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           +I  R + +  I  +   I+     +   DA Y  +V+ LSN A      L      +H 
Sbjct: 23  WIFMRVSGLILIFLVLGHIYMTFIQVSESDATYHAVVAKLSNPAWKLYDWLILTLTMLHG 82

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFV---LLLIIFCLFSL 121
             G + ++EDYI     +     +          L    LFS+
Sbjct: 83  MNGARYVMEDYIRSNPNRAWVKMVVFSIAALIYALGTVGLFSI 125


>gi|148360815|ref|YP_001252022.1| succinate dehydrogenase hydrophobic membrane anchor protein
          subunit D [Legionella pneumophila str. Corby]
 gi|296106121|ref|YP_003617821.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Legionella pneumophila 2300/99 Alcoy]
 gi|148282588|gb|ABQ56676.1| succinate dehydrogenase hydrophobic membrane anchor protein
          subunit D [Legionella pneumophila str. Corby]
 gi|295648022|gb|ADG23869.1| succinate dehydrogenase hydrophobic membrane anchor protein
          [Legionella pneumophila 2300/99 Alcoy]
          Length = 115

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 39/81 (48%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +G   ++ QR TA+    ++IF   F +   D  + Q   + +N        +G ++++
Sbjct: 10 GNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKIFQIATTIGLMALT 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          +H  +G+  +  DY+   +++
Sbjct: 70 LHAWIGIWTVTTDYMKCTVIR 90


>gi|298246054|ref|ZP_06969860.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ktedonobacter racemifer DSM 44963]
 gi|297553535|gb|EFH87400.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Ktedonobacter racemifer DSM 44963]
          Length = 136

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 36/103 (34%), Gaps = 8/103 (7%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAP---YEQIVSVLSNVAVASIMGLGTISISVHM 81
           +   R + +  I  +I  +       D     Y  + +  +N        L       H 
Sbjct: 21  WYYFRISGVVLIFLVIIHLTIMHVTNDVSCTTYAFVAARYANPFWRLFDWLLLTFGLTHG 80

Query: 82  QLGMQVIIEDYIHYRLLK-----IMFLFMNSCFVLLLIIFCLF 119
             G++V+I+DY+     +     I  + + + F+L  I    F
Sbjct: 81  VNGLRVVIDDYVRSPGTRLVLQGIAAVLLLAFFMLGTITLITF 123


>gi|45199041|ref|NP_986070.1| AFR523Cp [Ashbya gossypii ATCC 10895]
 gi|44985116|gb|AAS53894.1| AFR523Cp [Ashbya gossypii ATCC 10895]
          Length = 180

 Score = 45.1 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 39/102 (38%), Gaps = 13/102 (12%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G+ H+  +R +A++ IP  +  +   +      Y  I + L +      M L      +
Sbjct: 61  QGSYHWYYERISAVSMIPLTLVPLYGAVTGASVEYPLIDAALCS------MLL------I 108

Query: 80  HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           H Q+G+   I DYI  R   I       C +       L+ +
Sbjct: 109 HTQMGLTSCIVDYIPKRKFGIWHNLAM-CLLYSGTAVGLYGV 149


>gi|300743788|ref|ZP_07072808.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rothia dentocariosa M567]
 gi|300380149|gb|EFJ76712.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Rothia dentocariosa M567]
          Length = 161

 Score = 45.1 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 7/103 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQ----IVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +  GD  +      +    +N        L      +H
Sbjct: 39  WLGMRLSGVVLVVLIFGHLFVNLMVGDGIHAIDFGFVGGKWANPFWQIWDLLLLWLAMLH 98

Query: 81  MQLGMQVIIEDYIHYRLLKIMF---LFMNSCFVLLLIIFCLFS 120
              G++V+I+DY     +++     LF  S FVLL+    +F+
Sbjct: 99  GTNGIRVVIDDYAEKDRVRVWLKIILFAASAFVLLVGTLTIFA 141


>gi|262375852|ref|ZP_06069084.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter lwoffii SH145]
 gi|262309455|gb|EEY90586.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Acinetobacter lwoffii SH145]
          Length = 121

 Score = 44.7 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 47/110 (42%), Gaps = 4/110 (3%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +  + + +  G   +EQ    +  V +  +  L  +
Sbjct: 6   GLTGSGSRDWFLQRVSAVVLAVYTVVVLGWILLNGGFNFEQWYGFMMTVPMKIMSLLAVL 65

Query: 76  SISVHMQLGMQVIIEDYIH----YRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  H  +GM  +  DY+           + L + S  ++ ++ + ++++
Sbjct: 66  SLVAHAWIGMWQVFTDYVTTRQMGPSASGLRLVLTSAVIIAVLAYAIWAI 115


>gi|311113029|ref|YP_003984251.1| succinate dehydrogenase cytochrome b small subunit [Rothia
           dentocariosa ATCC 17931]
 gi|310944523|gb|ADP40817.1| succinate dehydrogenase cytochrome b small subunit [Rothia
           dentocariosa ATCC 17931]
          Length = 161

 Score = 44.7 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 7/103 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQ----IVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +  GD  +      +    +N        L      +H
Sbjct: 39  WLGMRLSGVVLVVLIFGHLFVNLMVGDGIHAIDFGFVGGKWANPFWQIWDLLLLWLAMLH 98

Query: 81  MQLGMQVIIEDYIHYRLLKIMF---LFMNSCFVLLLIIFCLFS 120
              G++V+I+DY     +++     LF  S FVLL+    +F+
Sbjct: 99  GTNGIRVVIDDYAEKDRVRVWLKIILFAASAFVLLVGTLTIFA 141


>gi|152967896|ref|YP_001363680.1| succinate dehydrogenase hydrophobic anchor subunit-like
           [Kineococcus radiotolerans SRS30216]
 gi|151362413|gb|ABS05416.1| Succinate dehydrogenase hydrophobic anchor subunit-like
           [Kineococcus radiotolerans SRS30216]
          Length = 169

 Score = 44.3 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 33/102 (32%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  I  +   +   +  GD      +  +    S+        L      +H
Sbjct: 38  WLFMRMSGVVLIVLVFGHLFVNLMTGDGIHQVDWGFVAGKWSSPFWQVWDLLMLWLAQLH 97

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ +I DY    + +           +++++     + 
Sbjct: 98  GTNGVRTVINDYAERDVTRFWLKMALYLATVIVLVVGTLVIF 139


>gi|269925902|ref|YP_003322525.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789562|gb|ACZ41703.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 126

 Score = 44.3 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/101 (13%), Positives = 33/101 (32%), Gaps = 3/101 (2%)

Query: 25  FIKQRFTAIANIPFIIFFIAFF---IKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           +   R + +  +   +  +             Y  + +  +     +   +  +    H 
Sbjct: 19  WYYFRISGVLLLFLALGHVYIMHIATPVEQINYAFVAARYATPFWRTYDLVLLLLAMSHG 78

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
             G++VII DYI  R  ++  L       L+  +     +L
Sbjct: 79  VNGIRVIIHDYIRSRSWRLFALSALYSISLIFTVLGALVIL 119


>gi|319779730|ref|YP_004130643.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Taylorella equigenitalis MCE9]
 gi|317109754|gb|ADU92500.1| Succinate dehydrogenase hydrophobic membrane anchor protein
           [Taylorella equigenitalis MCE9]
          Length = 124

 Score = 44.3 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 50/108 (46%), Gaps = 4/108 (3%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFI----KYGDAPYEQIVSVLSNVAVASIMGLG 73
           A  GT  FI QR TA     + +FF+   +     Y +  +    +VLS  A    + L 
Sbjct: 14  AHYGTIGFIVQRLTATLLAIYSVFFLLTLLFTPVTYENWLHLFTFTVLSIPAGQICVTLV 73

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
             +++ H  +G++ +  DYI   +L+++       +++ + ++  F +
Sbjct: 74  FFTLAWHAWIGIRDVWMDYIDCWMLRLVLFIFTIFWLIAMSMYFCFVI 121


>gi|254480494|ref|ZP_05093741.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [marine gamma proteobacterium HTCC2148]
 gi|214039077|gb|EEB79737.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [marine gamma proteobacterium HTCC2148]
          Length = 119

 Score = 43.9 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 41/104 (39%), Gaps = 2/104 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + G   ++ QR + +  + + I      +      Y Q  ++ ++  +     L  +S++
Sbjct: 10  RSGLSDWLLQRVSGVILLAYAICLGGTLV--IGVNYAQWQAMFASTGMRVFTLLAILSLA 67

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
            H  +GM  +  DY+  R+L      +   F +   +     ++
Sbjct: 68  AHAWIGMWAVGTDYLTERMLGTKGNLLRLAFQIGCSLAIFVYVI 111


>gi|56478027|ref|YP_159616.1| succinate dehydrogenase,hydrophobic membrane anchor protein
           [Aromatoleum aromaticum EbN1]
 gi|56314070|emb|CAI08715.1| Succinate dehydrogenase,hydrophobic membrane anchor protein
           [Aromatoleum aromaticum EbN1]
          Length = 114

 Score = 43.9 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 49/95 (51%)

Query: 21  GTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           G   ++ QR TA+  + F+    A  +      YE+   + ++   A ++ +   ++++H
Sbjct: 6   GQRAWMLQRVTAVVLLIFLAAAAAMLLAGLPLTYERWYELATSPHGAVLIVVLFAALALH 65

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLII 115
             +G++ I+ DYIH   +++  L + +  ++ ++I
Sbjct: 66  GWIGIRDIVLDYIHPPAVRLPLLGLIALVLIAIVI 100


>gi|160897867|ref|YP_001563449.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Delftia acidovorans SPH-1]
 gi|160363451|gb|ABX35064.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Delftia acidovorans SPH-1]
          Length = 121

 Score = 43.9 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 46/108 (42%), Gaps = 1/108 (0%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDA-PYEQIVSVLSNVAVASIMGLGTIS 76
           A  G   ++ QR T +    F I  +A  I    +  Y+    + +   +  +     +S
Sbjct: 14  AHYGIRDWMVQRVTGVLMALFTIVLLAKLIFSTGSVGYDLWAGIFAPQWMKFLTFAVIVS 73

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
           ++ H+ +G++ I  DY+    L+++       +++    + +  L +I
Sbjct: 74  LAWHVWVGVRDIWMDYVKPVGLRLVLNVFTLVWLVGCAGWGIQILWRI 121


>gi|52840773|ref|YP_094572.1| succinate dehydrogenase hydrophobic membrane anchor protein
          subunit D [Legionella pneumophila subsp. pneumophila
          str. Philadelphia 1]
 gi|52627884|gb|AAU26625.1| succinate dehydrogenase hydrophobic membrane anchor protein
          subunit D [Legionella pneumophila subsp. pneumophila
          str. Philadelphia 1]
          Length = 115

 Score = 43.5 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 40/81 (49%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           +G   ++ QR TA+    ++IF   F +   D  + Q   + +N A      +G ++++
Sbjct: 10 GNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLSFSQWHLLFTNKAFQIATTIGLMALT 69

Query: 79 VHMQLGMQVIIEDYIHYRLLK 99
          +H  +G+  +  DY+   +++
Sbjct: 70 LHAWIGIWTVTTDYMKCTVIR 90


>gi|119476703|ref|ZP_01617013.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [marine gamma proteobacterium HTCC2143]
 gi|119449959|gb|EAW31195.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [marine gamma proteobacterium HTCC2143]
          Length = 128

 Score = 43.5 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 31/74 (41%), Gaps = 1/74 (1%)

Query: 19 KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
          + G   ++ QR T +  + + + FIA  +      + +  ++     V        +S++
Sbjct: 10 RSGLSDWMIQRITGVILLAYTL-FIAAVLFIVAPEFAEWKALFGQTWVKVFSLAAVLSVA 68

Query: 79 VHMQLGMQVIIEDY 92
           H  +G+  +  DY
Sbjct: 69 AHAWIGLWCVSTDY 82


>gi|226305531|ref|YP_002765491.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rhodococcus erythropolis PR4]
 gi|229489342|ref|ZP_04383205.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Rhodococcus erythropolis SK121]
 gi|226184648|dbj|BAH32752.1| putative succinate dehydrogenase hydrophobic membrane anchor
           protein [Rhodococcus erythropolis PR4]
 gi|229323439|gb|EEN89197.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Rhodococcus erythropolis SK121]
          Length = 151

 Score = 43.5 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 41/121 (33%), Gaps = 8/121 (6%)

Query: 6   RSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVA 65
           RS   + R           ++  RF+ +A I  ++  +   +      +    + ++   
Sbjct: 26  RSPRAKARNNFE----LYAWLFMRFSGVALIVLVLGHMFIMLMLDGGVHRLNFAFVAGRW 81

Query: 66  VASIMGLGTISISV----HMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
            +       +++      H   G++ +I DY      +     +    ++L++    + +
Sbjct: 82  SSPFWQFWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRFWLTTILVLSMILIMGLGTYVI 141

Query: 122 L 122
            
Sbjct: 142 F 142


>gi|225075123|ref|ZP_03718322.1| hypothetical protein NEIFLAOT_00122 [Neisseria flavescens
           NRL30031/H210]
 gi|241760351|ref|ZP_04758446.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria flavescens SK114]
 gi|224953607|gb|EEG34816.1| hypothetical protein NEIFLAOT_00122 [Neisseria flavescens
           NRL30031/H210]
 gi|241319229|gb|EER55707.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria flavescens SK114]
          Length = 113

 Score = 43.5 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 41/106 (38%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +      V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLVYTVVLLVVLFTLP-KEYSAWQAFFDQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             +++ +H  +G++ +  DYI    L++        +++  +++ +
Sbjct: 63  SFLAVFLHAWVGIRDLWMDYIKPFGLRLFLQVATIVWLVGCLVYSV 108


>gi|289641513|ref|ZP_06473676.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Frankia symbiont of Datisca glomerata]
 gi|289508723|gb|EFD29659.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Frankia symbiont of Datisca glomerata]
          Length = 145

 Score = 43.1 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 33/102 (32%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I  +  ++  +              +  +    ++    +   L  +   +H
Sbjct: 37  WLFMRVSGILLVFLVLGHLFIMNILDGGVQRIGFGFVAGRWASPFWRTWDLLMLVLAELH 96

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMN---SCFVLLLIIFCLF 119
              G++ +I DY      +     +    +  V+ L    +F
Sbjct: 97  GTNGLRTVINDYAERPQTRFWLKMLLYVSAFLVISLGSLVIF 138


>gi|50312329|ref|XP_456198.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645334|emb|CAG98906.1| KLLA0F25080p [Kluyveromyces lactis]
          Length = 193

 Score = 43.1 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 37/104 (35%), Gaps = 15/104 (14%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G+ H+  +R TA++ +P           YG        S      + S++    +   +
Sbjct: 68  HGSYHWDYERITAVSLVPLT-----MVPLYGAMSSATFASGFPFPVIDSLLASTIL---I 119

Query: 80  HMQLGMQVIIEDYIH-------YRLLKIMFLFMNSCFVLLLIIF 116
           H  LG+   I DYI        ++  K      +S  +  + + 
Sbjct: 120 HAYLGITSCIIDYIPKRKFGFWHKAAKFALALGSSFSLYGIYVL 163


>gi|260767666|ref|ZP_05876601.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           furnissii CIP 102972]
 gi|260617175|gb|EEX42359.1| succinate dehydrogenase hydrophobic membrane anchor protein [Vibrio
           furnissii CIP 102972]
 gi|315179502|gb|ADT86416.1| Succinate dehydrogenase, hydrophobic anchor subunit [Vibrio
           furnissii NCTC 11218]
          Length = 97

 Score = 43.1 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 31/91 (34%), Gaps = 1/91 (1%)

Query: 29  RFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVI 88
           R +AI    + I+ I  F  + D  Y                 L  + I +H  +G+  +
Sbjct: 3   RASAIIMTLYTIY-IVSFCAFTDISYVSWTQFFGGTFTKVFTMLALVCILIHGWIGLWQV 61

Query: 89  IEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           + DY+    L+     +    +       LF
Sbjct: 62  LTDYVKCSKLRGGLQLVVIAVLFGYFFSGLF 92


>gi|33519788|ref|NP_878620.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Candidatus Blochmannia floridanus]
 gi|33504133|emb|CAD83395.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Candidatus Blochmannia floridanus]
          Length = 115

 Score = 43.1 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 44/98 (44%)

Query: 21  GTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           G   ++  R +AI  I + ++   F     +  YE+      +  +     +  + +  H
Sbjct: 12  GVYEWLIVRISAILTILYSVYLFNFINIDDNFSYEKWCIFFYDKKIKIFNTIVLLMLLKH 71

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             +GM+ I+EDYI   +L+ + + +    + + ++F +
Sbjct: 72  TWIGMRHILEDYISSIILRRLSIGLIHIILYVYLLFGI 109


>gi|319637650|ref|ZP_07992416.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria mucosa C102]
 gi|317400805|gb|EFV81460.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Neisseria mucosa C102]
          Length = 113

 Score = 43.1 bits (101), Expect = 0.013,   Method: Composition-based stats.
 Identities = 14/106 (13%), Positives = 41/106 (38%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +      V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLVYTVVLLVVLFTLP-KEYSAWQAFFDQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             +++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFLAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|261379698|ref|ZP_05984271.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria subflava NJ9703]
 gi|284797362|gb|EFC52709.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Neisseria subflava NJ9703]
          Length = 113

 Score = 43.1 bits (101), Expect = 0.014,   Method: Composition-based stats.
 Identities = 14/106 (13%), Positives = 41/106 (38%), Gaps = 1/106 (0%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
           R +  A  G   +  QR TA+  + + +  +          Y    +      V     +
Sbjct: 4   RKLTGAHYGLRDWAMQRATAVIMLVYTVVLLVVLFTLP-KEYSAWQAFFDQTWVKVFTQV 62

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
             +++ +H  +G++ +  DYI    +++        +++  +++ +
Sbjct: 63  SFLAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSV 108


>gi|268315784|ref|YP_003289503.1| hypothetical protein Rmar_0209 [Rhodothermus marinus DSM 4252]
 gi|262333318|gb|ACY47115.1| hypothetical protein Rmar_0209 [Rhodothermus marinus DSM 4252]
          Length = 167

 Score = 43.1 bits (101), Expect = 0.014,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 53  PYEQIVSVLSNVAVASIM----GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSC 108
           PY+ ++  L++   A +      L  I    H   G+  I+ DYI   + +++   ++  
Sbjct: 84  PYDVVMLRLADPVYAVLWKGFNILFLIFALHHGFYGLNNILTDYIRNPIGRVLAQTLSWT 143

Query: 109 FVLLLIIFCLFSLL 122
             L L+I  L+S++
Sbjct: 144 LALALLIVGLYSII 157


>gi|126433857|ref|YP_001069548.1| succinate dehydrogenase subunit D [Mycobacterium sp. JLS]
 gi|126233657|gb|ABN97057.1| succinate dehydrogenase subunit D [Mycobacterium sp. JLS]
          Length = 159

 Score = 42.7 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 40/102 (39%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +A +   +  +   + + +      +  +    S+    +   L      +H
Sbjct: 51  WLFMRFSGMALVFLALGHLFIMLMWDNGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLH 110

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++VII DY      +     + +  ++ +++   + LL
Sbjct: 111 GGNGLRVIISDYARKDSTRFWLNSLLALSMIFILVLGTYVLL 152


>gi|295396420|ref|ZP_06806582.1| succinate dehydrogenase cytochrome b small subunit [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294970722|gb|EFG46635.1| succinate dehydrogenase cytochrome b small subunit [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 149

 Score = 42.7 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 9/102 (8%), Positives = 30/102 (29%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFI----KYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +          +  +    ++               +H
Sbjct: 28  WLFMRVSGLILVILIFGHLFVNLWQGEGVQGLDFGFVAGKWASPFWQIWDLAMLWLAMLH 87

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              GM+ II DY       ++   +      ++++     + 
Sbjct: 88  GTNGMRTIINDYAEKPGTNVVLQLVLYIASAIVVVLGTLVIF 129


>gi|91208852|ref|YP_539013.1| succinate dehydrogenase subunit 4 [Physcomitrella patens]
 gi|90991392|dbj|BAE93084.1| succinate dehydrogenase subunit 4 [Physcomitrella patens]
 gi|328775201|gb|AEB39996.1| succinate dehydrogenase subunit 4 [Funaria hygrometrica]
          Length = 86

 Score = 42.7 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 23/91 (25%)

Query: 23  GHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQ 82
           GH++ QR TA + IP I+                        +  S + L  I +  H+ 
Sbjct: 9   GHWLLQRMTAASLIPTILI-----------------------SNVSTLILLNILLFWHIH 45

Query: 83  LGMQVIIEDYIHYRLLKIMFLFMNSCFVLLL 113
           +G++ I+ DY+H+ + +   L +   F L++
Sbjct: 46  VGIEEILTDYVHHEITRNWILILFRVFCLII 76


>gi|83814218|ref|YP_444631.1| succinate dehydrogenase, membrane subunit, putative [Salinibacter
           ruber DSM 13855]
 gi|294506382|ref|YP_003570440.1| Succinate dehydrogenase flavoprotein subunit [Salinibacter ruber
           M8]
 gi|83755612|gb|ABC43725.1| succinate dehydrogenase, membrane subunit, putative [Salinibacter
           ruber DSM 13855]
 gi|294342710|emb|CBH23488.1| Succinate dehydrogenase flavoprotein subunit [Salinibacter ruber
           M8]
          Length = 150

 Score = 42.7 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 53  PYEQIVSVLSNVAVASIM----GLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSC 108
           PY+ ++  L++   A +      L  +    H   G+  ++ DYI   + +++   ++  
Sbjct: 73  PYQVVMQRLADPVYAVLWKGFNILFLVVALHHGFYGLNNVMTDYIRDPMGRLVAKSLSWT 132

Query: 109 FVLLLIIFCLFSLL 122
             L L+I   +S+L
Sbjct: 133 VALGLLIIGTYSVL 146


>gi|256380450|ref|YP_003104110.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Actinosynnema mirum DSM 43827]
 gi|255924753|gb|ACU40264.1| Succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Actinosynnema mirum DSM 43827]
          Length = 138

 Score = 42.7 bits (100), Expect = 0.017,   Method: Composition-based stats.
 Identities = 9/102 (8%), Positives = 33/102 (32%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQ----IVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +A +  ++  +          +      +    ++               +H
Sbjct: 27  WLFMRLSGVALLVLVLGHLFIMNILDGGVHRINFGFVAGRWASPFWQIWDLAMLWLAQIH 86

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ +I DY      +     +    ++L+I+   + + 
Sbjct: 87  GGNGLRTVINDYARKDATRFWLKMLLYVSMVLIIVTGTYVVF 128


>gi|254434381|ref|ZP_05047889.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosococcus oceani AFC27]
 gi|207090714|gb|EDZ67985.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Nitrosococcus oceani AFC27]
          Length = 89

 Score = 42.4 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 41/89 (46%)

Query: 35  NIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIH 94
            +  ++FF+A  ++     YE     +S+  V+ ++ L    + +H  +G++ II DY+ 
Sbjct: 1   MLVLLLFFLARLMQGSFKTYEAWREWISDPLVSIMVALFFGVLLLHSWVGLRDIILDYVR 60

Query: 95  YRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
              L++    +       +  + +  LL+
Sbjct: 61  PVSLRLFAHSLIVVVYSGIGFWVIRILLR 89


>gi|150406492|ref|YP_001315098.1| succinate:cytochrome c oxidoreductase subunit 4 [Chlorokybus
           atmophyticus]
 gi|126507729|gb|ABO15126.1| succinate:cytochrome c oxidoreductase subunit 4 [Chlorokybus
           atmophyticus]
          Length = 109

 Score = 42.4 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 39/94 (41%), Gaps = 23/94 (24%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
           +   + H+  QR TAI   P I+                           S++ L    +
Sbjct: 27  SGKASTHWHIQRLTAILLFPTILSL-----------------------NPSLILLLIAVL 63

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVL 111
            +H+Q G+  I++DY+H  + +++ + +   F+L
Sbjct: 64  PLHIQAGISEILDDYVHNEVTRMVSILLARLFIL 97


>gi|22550364|ref|NP_689351.1| succinate:cytochrome c oxidoreductase subunit 4
          [Chaetosphaeridium globosum]
 gi|22417030|gb|AAM96629.1|AF494279_34 succinate:cytochrome c oxidoreductase subunit 4
          [Chaetosphaeridium globosum]
          Length = 79

 Score = 42.4 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 31/77 (40%), Gaps = 23/77 (29%)

Query: 23 GHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQ 82
           H++ QR TA    P ++F                           I+ +  + +  HMQ
Sbjct: 2  SHWLYQRATAAILFPTLLFADVS-----------------------ILIVLNLVLFWHMQ 38

Query: 83 LGMQVIIEDYIHYRLLK 99
          +G+Q I+ DYIH  + +
Sbjct: 39 IGIQEILSDYIHNEVTR 55


>gi|256389983|ref|YP_003111547.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Catenulispora acidiphila DSM 44928]
 gi|256356209|gb|ACU69706.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Catenulispora acidiphila DSM 44928]
          Length = 151

 Score = 42.4 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 12/107 (11%), Positives = 34/107 (31%), Gaps = 14/107 (13%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  ++  +   +          +  +    ++        L      +H
Sbjct: 42  WLFMRASGVLLVFLVLGHLFIMMVTDGGVEKIGFAFVAGRWASPWWQFWDLLQLWLAMIH 101

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAIL 127
              GM+ +I DY      +           +L  +    ++L IA+ 
Sbjct: 102 GSNGMRTVINDYADKDRTR----------AILKGLLYTAAVLTIALG 138


>gi|182436481|ref|YP_001824200.1| putative succinate dehydrogenase membrane subunit [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326777102|ref|ZP_08236367.1| putative succinate dehydrogenase membrane subunit [Streptomyces cf.
           griseus XylebKG-1]
 gi|178464997|dbj|BAG19517.1| putative succinate dehydrogenase membrane subunit [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326657435|gb|EGE42281.1| putative succinate dehydrogenase membrane subunit [Streptomyces cf.
           griseus XylebKG-1]
          Length = 160

 Score = 42.4 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 31/102 (30%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I     +I  +   +          +  +    ++               +H
Sbjct: 52  WLFMRLSGILLTVLVIGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLTMLWLAMLH 111

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMN---SCFVLLLIIFCLF 119
              G++ +I DY      +     +    + F +LL    +F
Sbjct: 112 GGNGLRTVINDYAERDNTRFWLKMLLYTATVFTVLLGTLVIF 153


>gi|94984995|ref|YP_604359.1| succinate dehydrogenase, cytochrome b subunit [Deinococcus
           geothermalis DSM 11300]
 gi|94555276|gb|ABF45190.1| succinate dehydrogenase, cytochrome b subunit [Deinococcus
           geothermalis DSM 11300]
          Length = 125

 Score = 42.4 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 43/103 (41%), Gaps = 6/103 (5%)

Query: 25  FIKQRFTAIANIPFI---IFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           +I  R + +  +  I   I+     +   DA ++ +V+ L N A      L  +   +H 
Sbjct: 23  WIFMRISGLILVFLILGHIYMTFIQVSESDATFDAVVAKLQNPAWKFYDWLILLLAMLHG 82

Query: 82  QLGMQVIIEDYIHYRLLKIMF--LFMNSC-FVLLLIIFCLFSL 121
             G +  IEDY+  R  +     +F   C  + LL    LFS+
Sbjct: 83  VNGARYSIEDYVRSRPNRAWVKGIFYTICAVIFLLGTVGLFSI 125


>gi|111023210|ref|YP_706182.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rhodococcus jostii RHA1]
 gi|226365715|ref|YP_002783498.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rhodococcus opacus B4]
 gi|110822740|gb|ABG98024.1| probable succinate dehydrogenase hydrophobic membrane anchor
           protein [Rhodococcus jostii RHA1]
 gi|226244205|dbj|BAH54553.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Rhodococcus opacus B4]
          Length = 147

 Score = 42.4 bits (99), Expect = 0.022,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 38/102 (37%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV----H 80
           ++  RF+ +A I  ++  +   +   D  +    + ++    +       +++      H
Sbjct: 37  WLFMRFSGLALIFLVLGHLFIMLMLDDGVHRINFAFVAGRWSSPFWQFWDLTMLWLAQLH 96

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ +I DY      +     +    ++L++    + + 
Sbjct: 97  GGNGLRTVIADYSRKDSTRFWLTTILVLSMILIMGLGTYVIF 138


>gi|262369423|ref|ZP_06062751.1| succinate dehydrogenase [Acinetobacter johnsonii SH046]
 gi|262315491|gb|EEY96530.1| succinate dehydrogenase [Acinetobacter johnsonii SH046]
          Length = 121

 Score = 42.4 bits (99), Expect = 0.022,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 45/110 (40%), Gaps = 4/110 (3%)

Query: 16  GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTI 75
           G    G+  +  QR +A+    + +  + + +  G   YEQ    +    +  +  L  +
Sbjct: 6   GLTGSGSRDWFIQRVSAVVLAVYTVVVLGWILCNGGFSYEQWYGFMMTAPMKILSLLAVL 65

Query: 76  SISVHMQLGMQVIIEDYIH----YRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           S+  H  +GM  +  DY+           + L + S  ++ +  + ++++
Sbjct: 66  SLVAHAWIGMWQVFTDYVTTRQMGPSASGLRLVLTSAVIIAVFAYAIWAI 115


>gi|226356177|ref|YP_002785917.1| succinate dehydrogenase, hydrophobic membrane anchor protein SdhD
           [Deinococcus deserti VCD115]
 gi|226318167|gb|ACO46163.1| putative Succinate dehydrogenase, hydrophobic membrane anchor
           protein SdhD [Deinococcus deserti VCD115]
          Length = 125

 Score = 42.4 bits (99), Expect = 0.023,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 45/105 (42%), Gaps = 5/105 (4%)

Query: 25  FIKQRFTAIANIPFI---IFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           +I  R + +  +  +   I+     +   DA ++ +V+ LSN A      +      +H 
Sbjct: 23  WIFMRISGLILVFLVLGHIYMTFIQVSESDATFDAVVAKLSNPAWKFYDWMILFLSLLHG 82

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAI 126
             G +  IEDYI  R  +      +  + ++ ++F   ++  I+I
Sbjct: 83  ANGARYSIEDYIRSRPNR--AWVKSIFYTVIALVFAFGTIGLISI 125


>gi|239943741|ref|ZP_04695678.1| putative succinate dehydrogenase membrane subunit [Streptomyces
           roseosporus NRRL 15998]
 gi|239990193|ref|ZP_04710857.1| putative succinate dehydrogenase membrane subunit [Streptomyces
           roseosporus NRRL 11379]
 gi|291447201|ref|ZP_06586591.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Streptomyces roseosporus NRRL 15998]
 gi|291350148|gb|EFE77052.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Streptomyces roseosporus NRRL 15998]
          Length = 160

 Score = 42.4 bits (99), Expect = 0.023,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 33/102 (32%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I     +I  +   +          +  +    ++    +   +      +H
Sbjct: 52  WLFMRLSGILLTVLVIGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQAWDLIMLWLAMLH 111

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMN---SCFVLLLIIFCLF 119
              G++ +I DY      +     +    + F +LL    +F
Sbjct: 112 GGNGLRTVINDYAERDNTRFWLKMLLYTATVFTVLLGTLVIF 153


>gi|297622604|ref|YP_003704038.1| succinate dehydrogenase, membrane subunit (SdhD) [Truepera
           radiovictrix DSM 17093]
 gi|297163784|gb|ADI13495.1| succinate dehydrogenase, membrane subunit (SdhD) [Truepera
           radiovictrix DSM 17093]
          Length = 152

 Score = 42.0 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 35/100 (35%), Gaps = 3/100 (3%)

Query: 25  FIKQRFTAIANIPFI---IFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           ++  R + +A I      ++     I  G   +  +   LS   V     L      +H 
Sbjct: 25  WVFMRVSGLALIFLTFGHLYMSNIVIDAGQIDFSYVARRLSITWVKIYDTLLLGLAVLHG 84

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
             G +  IEDY  +   +           +L++I  + SL
Sbjct: 85  VNGARYSIEDYARHPGWRFGIKMGLYSATVLVMIIGIISL 124


>gi|38638303|ref|NP_943706.1| succinate:cytochrome c oxidoreductase subunit 4 [Chara vulgaris]
 gi|32966617|gb|AAP92200.1| succinate:cytochrome c oxidoreductase subunit 4 [Chara vulgaris]
          Length = 92

 Score = 42.0 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 44/101 (43%), Gaps = 24/101 (23%)

Query: 23  GHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQ 82
            H++ QR TA   IP I+                        A  S + L  I +  HM 
Sbjct: 9   AHWLLQRITAAFLIPTILL-----------------------ANVSTLILLNILLFWHMH 45

Query: 83  LGMQVIIEDYIHYRLLK-IMFLFMNSCFVLLLIIFCLFSLL 122
           +G++ I+ DYIH+ + +  + LF+    ++++    +F +L
Sbjct: 46  VGIEEILADYIHHEVTRNFICLFLRVFVLIIIKYVFVFCVL 86


>gi|260907393|ref|ZP_05915715.1| succinate dehydrogenase cytochrome b556 subunit [Brevibacterium
           linens BL2]
          Length = 150

 Score = 41.6 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 10/102 (9%), Positives = 32/102 (31%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFI----KYGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +          +  +    ++        L      +H
Sbjct: 28  WLFMRISGVVLVILIFGHLFVNLWAGEGVQAIDFGFVAGKWASPFWQIWDLLMLWLAMLH 87

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ II DY      ++    +     +++I+     + 
Sbjct: 88  GTNGLRTIIMDYAEKPGTRMALQVILYIASIIVIVLGTLVIF 129


>gi|11467130|ref|NP_054431.1| succinate dehydrogenase subunit 4 [Marchantia polymorpha]
 gi|262186732|ref|YP_003275991.1| succinate dehydrogenase subunit 4 [Pleurozia purpurea]
 gi|586765|sp|P38460|YMF17_MARPO RecName: Full=Uncharacterized mitochondrial protein ymf17; AltName:
           Full=ORF86A
 gi|786215|gb|AAC09428.1| ORF86a [Marchantia polymorpha]
 gi|237780729|gb|ACR19375.1| succinate dehydrogenase subunit 4 [Pleurozia purpurea]
          Length = 86

 Score = 41.6 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 23/91 (25%)

Query: 23  GHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQ 82
           GH++ QR TA   IP I+                        A  S + L  I +  H+ 
Sbjct: 9   GHWLLQRITAAFLIPTILI-----------------------ANVSTLILLNILLFWHIH 45

Query: 83  LGMQVIIEDYIHYRLLKIMFLFMNSCFVLLL 113
           +G++ I+ DY+H+ + +   L +   F L++
Sbjct: 46  VGIEEILADYVHHEVTRNWILILLRVFCLII 76


>gi|15805977|ref|NP_294677.1| succinate dehydrogenase, hydrophobic subunit SdhD [Deinococcus
           radiodurans R1]
 gi|6458674|gb|AAF10526.1|AE001947_9 succinate dehydrogenase, hydrophobic subunit SdhD, putative
           [Deinococcus radiodurans R1]
          Length = 125

 Score = 41.6 bits (97), Expect = 0.036,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 39/96 (40%), Gaps = 5/96 (5%)

Query: 25  FIKQRFTAIANIPFI---IFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           +I  R + +  +  +   I+     +   DA Y  +V+ LSN A      L      +H 
Sbjct: 23  WIFMRISGLILVFLVLGHIYMTFIQVSEADATYVAVVNKLSNPAWKFYDWLILALALLHG 82

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFC 117
             G +  IEDY+  R  +       + + ++ ++F 
Sbjct: 83  ANGARYSIEDYVRTRPDR--AWIKGTFYTVIALLFA 116


>gi|302342524|ref|YP_003807053.1| succinate dehydrogenase, cytochrome b556 subunit [Desulfarculus
           baarsii DSM 2075]
 gi|301639137|gb|ADK84459.1| succinate dehydrogenase, cytochrome b556 subunit [Desulfarculus
           baarsii DSM 2075]
          Length = 125

 Score = 41.6 bits (97), Expect = 0.038,   Method: Composition-based stats.
 Identities = 19/112 (16%), Positives = 48/112 (42%), Gaps = 4/112 (3%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFF--IKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
             G   ++ QR + +A + ++I  +     I  G   +++I++V+ +            +
Sbjct: 13  HPGYIAWLFQRISGLALVLYLIMHVYVIHHIALGRQAFDEIMAVVQSPLFHLAEAALLAA 72

Query: 77  ISVHMQLGMQVIIEDYIH-YRLLKIMFLFM-NSCFVLLLIIFCLFSLLKIAI 126
           +  H   G++VI+ DY       KI    +       ++++     ++K+A+
Sbjct: 73  VVYHGVNGLRVILLDYGRAADKQKISPWVLGVMSLCAVIVLAGAIPMIKLAL 124


>gi|225174743|ref|ZP_03728741.1| hypothetical protein DealDRAFT_0596 [Dethiobacter alkaliphilus AHT
           1]
 gi|225169870|gb|EEG78666.1| hypothetical protein DealDRAFT_0596 [Dethiobacter alkaliphilus AHT
           1]
          Length = 100

 Score = 41.6 bits (97), Expect = 0.040,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLG 84
           ++ QR T I  +  I + I            +I  +LS+  VA++ GL  +++  H+  G
Sbjct: 4   WLSQRITGIFLMFLIPWKIYSGYALTGQ-VPRIEGLLSSHIVATLDGLLIVTVIFHLAYG 62

Query: 85  MQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
           ++V++ D       + +  +  +   LLL ++ L+ +
Sbjct: 63  LRVMLID--AGIKQEKVLFYAATALSLLLSVYALYYI 97


>gi|118594807|ref|ZP_01552154.1| succinate dehydrogenase (membrane anchor subunit) [Methylophilales
           bacterium HTCC2181]
 gi|118440585|gb|EAV47212.1| succinate dehydrogenase (membrane anchor subunit) [Methylophilales
           bacterium HTCC2181]
          Length = 118

 Score = 41.6 bits (97), Expect = 0.041,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 36/92 (39%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIM 70
             + + S   G   ++ QRFTA+    ++I        Y    ++   S+  +  +    
Sbjct: 2   NAKSLKSPFGGMTQWLYQRFTALFMTTYMISLALILTTYRPLTFDVWASLFDHWTIKYAT 61

Query: 71  GLGTISISVHMQLGMQVIIEDYIHYRLLKIMF 102
            +  I +  H  +G+  I EDYI    ++   
Sbjct: 62  LVFFILMFFHAWIGILHITEDYIKVIAVRTTI 93


>gi|145225423|ref|YP_001136101.1| putative succinate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|145217909|gb|ABP47313.1| succinate dehydrogenase subunit D [Mycobacterium gilvum PYR-GCK]
          Length = 167

 Score = 41.2 bits (96), Expect = 0.042,   Method: Composition-based stats.
 Identities = 15/102 (14%), Positives = 36/102 (35%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ I  +   +  +   + + +      +  +    S+    +   L      +H
Sbjct: 59  WLFMRFSGIVLVFLALGHLFIMLMWENGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLH 118

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              GM+ II DY      K     + +  +   ++   + LL
Sbjct: 119 GGNGMRTIIADYTRKDSTKFWLNTLLALSMAFTLVLGTYVLL 160


>gi|296168860|ref|ZP_06850532.1| succinate dehydrogenase cytochrome b small subunit [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295896477|gb|EFG76127.1| succinate dehydrogenase cytochrome b small subunit [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 156

 Score = 41.2 bits (96), Expect = 0.043,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 37/102 (36%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +A I   +  +   + + D      +  +    ++               +H
Sbjct: 47  WLFMRFSGVALIVLAVGHLFIMLMWDDGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLH 106

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + L 
Sbjct: 107 GGNGLRTIIDDYSRKDSTRFWLNSLLLLSMGFTLVLGTYVLV 148


>gi|15610453|ref|NP_217834.1| succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
           [Mycobacterium tuberculosis H37Rv]
 gi|148663181|ref|YP_001284704.1| succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
           [Mycobacterium tuberculosis H37Ra]
 gi|167968952|ref|ZP_02551229.1| succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
           [Mycobacterium tuberculosis H37Ra]
 gi|2894227|emb|CAA17089.1| PROBABLE SUCCINATE DEHYDROGENASE (HYDROPHOBIC MEMBRANE ANCHOR
           SUBUNIT) SDHD (SUCCINIC DEHYDROGENASE) (FUMARATE
           REDUCTASE) (FUMARATE DEHYDROGENASE) (FUMARIC
           HYDROGENASE) [Mycobacterium tuberculosis H37Rv]
 gi|148507333|gb|ABQ75142.1| succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
           [Mycobacterium tuberculosis H37Ra]
          Length = 144

 Score = 41.2 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 36  WLFMRFSGVVLVFLAIGHVFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLH 95

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 96  GGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIV 137


>gi|15827294|ref|NP_301557.1| succinate dehydrogenase hydrophobic membrane anchor protei
           [Mycobacterium leprae TN]
 gi|221229772|ref|YP_002503188.1| putative succinate dehydrogenase hydrophobic membrane anchor protei
           [Mycobacterium leprae Br4923]
 gi|467180|gb|AAA17338.1| L308_F1_25 [Mycobacterium leprae]
 gi|13092843|emb|CAC30207.1| putative succinate dehydrogenase hydrophobic membrane anchor protei
           [Mycobacterium leprae]
 gi|219932879|emb|CAR70792.1| putative succinate dehydrogenase hydrophobic membrane anchor protei
           [Mycobacterium leprae Br4923]
          Length = 163

 Score = 41.2 bits (96), Expect = 0.051,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 37/103 (35%), Gaps = 7/103 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +A +      +   + + +      +  +    S+               VH
Sbjct: 55  WLFMRFSGVALVVLAFGHLFIMLMWDNGVYRIDFNFVAQRWSSPFWRFWDLALLWLAQVH 114

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLFS 120
              G++ II+DY      +      L ++  F L+L  + L S
Sbjct: 115 GGNGLRNIIDDYSRKDHTRFWLNSLLLLSMGFTLVLGSYVLLS 157


>gi|322694650|gb|EFY86474.1| succinate dehydrogenase cytochrome b small subunit precursor
           [Metarhizium acridum CQMa 102]
          Length = 163

 Score = 41.2 bits (96), Expect = 0.051,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G+ H+  +R  A   +P  I           AP+       S     ++  +   ++ +
Sbjct: 60  HGSYHWTFERLLAAGLVPLTI-----------APFA------SGSLNPTMDAVLCSAVLI 102

Query: 80  HMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           H  +G Q +I DYI  R    L+ +F +  +   +++ +
Sbjct: 103 HSHIGFQSVIIDYIPKRRYPGLRKLFWWGLNAATVVVGV 141


>gi|312140770|ref|YP_004008106.1| succinate dehydrogenase membrane subunit sdhd2 [Rhodococcus equi
           103S]
 gi|325675590|ref|ZP_08155274.1| succinate dehydrogenase cytochrome b small subunit [Rhodococcus
           equi ATCC 33707]
 gi|311890109|emb|CBH49427.1| succinate dehydrogenase membrane subunit SdhD2 [Rhodococcus equi
           103S]
 gi|325553561|gb|EGD23239.1| succinate dehydrogenase cytochrome b small subunit [Rhodococcus
           equi ATCC 33707]
          Length = 147

 Score = 41.2 bits (96), Expect = 0.052,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 38/102 (37%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV----H 80
           ++  RF+ +A I  ++  +   +   D  +    + ++    +       +++      H
Sbjct: 37  WLFMRFSGLALIILVLGHLFIMLMLDDGVHRINFAFVAGRWSSPFWQFWDLTMLWLAQLH 96

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ +I DY      +     +    ++L++    + + 
Sbjct: 97  GGNGLRTVIADYSRKDSTRFWLNTILVVSMILIMGLGTYVIF 138


>gi|308406119|ref|ZP_07669513.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu012]
 gi|308364447|gb|EFP53298.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu012]
          Length = 149

 Score = 41.2 bits (96), Expect = 0.053,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 41  WLFMRFSGVVLVFLAIGHVFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLH 100

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 101 GGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIV 142


>gi|83815294|ref|YP_444632.1| putative succinate dehydrogenase membrane subunit [Salinibacter
           ruber DSM 13855]
 gi|83756688|gb|ABC44801.1| putative succinate dehydrogenase membrane subunit [Salinibacter
           ruber DSM 13855]
          Length = 164

 Score = 40.8 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 11/101 (10%), Positives = 41/101 (40%), Gaps = 2/101 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTISI 77
           + G   ++  R T +  + ++I  I       D   +  +++   +           +++
Sbjct: 42  RTGMFAWMMHRLTGVGLVVYLIVHIWGLTALTDPETFNALIAKYHSPIFKVGEFALLVAV 101

Query: 78  SVHMQLGMQVIIEDYIH-YRLLKIMFLFMNSCFVLLLIIFC 117
           + H   G+++++ D++      K +F  + +   +++ +  
Sbjct: 102 AYHAMNGLRLVLIDFLGWSPKQKKLFWTLGAVTAVIIAVGG 142


>gi|315445771|ref|YP_004078650.1| succinate dehydrogenase subunit D [Mycobacterium sp. Spyr1]
 gi|315264074|gb|ADU00816.1| succinate dehydrogenase subunit D [Mycobacterium sp. Spyr1]
          Length = 167

 Score = 40.8 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 15/102 (14%), Positives = 35/102 (34%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ I  +   +  +   + +        +  +    S+    +   L      +H
Sbjct: 59  WLFMRFSGIVLVFLALGHLFIMLMWESGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLH 118

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              GM+ II DY      K     + +  +   ++   + LL
Sbjct: 119 GGNGMRTIIADYTRKDSTKFWLNTLLALSMAFTLVLGTYVLL 160


>gi|108798200|ref|YP_638397.1| succinate dehydrogenase subunit D [Mycobacterium sp. MCS]
 gi|119867296|ref|YP_937248.1| succinate dehydrogenase subunit D [Mycobacterium sp. KMS]
 gi|108768619|gb|ABG07341.1| succinate dehydrogenase subunit D [Mycobacterium sp. MCS]
 gi|119693385|gb|ABL90458.1| succinate dehydrogenase subunit D [Mycobacterium sp. KMS]
          Length = 159

 Score = 40.8 bits (95), Expect = 0.059,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 39/102 (38%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   +  +   + + +      +  +    S+    +   L      +H
Sbjct: 51  WLFMRFSGMVLVFLALGHLFIMLMWDNGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLH 110

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++VII DY      +     + +  ++ +++   + LL
Sbjct: 111 GGNGLRVIISDYARKDSTRFWLNSLLALSMIFILVLGTYVLL 152


>gi|110834360|ref|YP_693219.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Alcanivorax borkumensis SK2]
 gi|110647471|emb|CAL16947.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Alcanivorax borkumensis SK2]
          Length = 123

 Score = 40.8 bits (95), Expect = 0.060,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 43/104 (41%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++ QR +A+    ++I  + + I  GD  Y    + + ++ +     L  IS+ 
Sbjct: 10  RNGLYDWLIQRVSAVIIGVYMIGMLGYLITVGDLDYSSWKAFMGSICMQIANTLLVISVV 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
            H  +G+  +  DY+           +     + + +  +  LL
Sbjct: 70  AHTWVGVWGVTTDYLTSLTFGKAATGVRLIAQVAIALALVVYLL 113


>gi|254429440|ref|ZP_05043147.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Alcanivorax sp. DG881]
 gi|196195609|gb|EDX90568.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Alcanivorax sp. DG881]
          Length = 123

 Score = 40.8 bits (95), Expect = 0.061,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 44/104 (42%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           ++G   ++ QR +A+    ++I  + + I  GD  Y    + + ++ +     L  IS++
Sbjct: 10  RNGLYDWLIQRVSAVIIGVYMIGMLGYLITAGDLDYGSWKAFMGSICMQIANTLLVISVA 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
            H  +G+  +  DY+           +     L + +  +  LL
Sbjct: 70  AHTWVGLWGVTTDYLTSLTFGKAATGVRLIAQLAIALALVVYLL 113


>gi|163839067|ref|YP_001623472.1| succinate dehydrogenase cytochrome b556 subunit [Renibacterium
           salmoninarum ATCC 33209]
 gi|162952543|gb|ABY22058.1| succinate dehydrogenase cytochrome b556 subunit [Renibacterium
           salmoninarum ATCC 33209]
          Length = 158

 Score = 40.8 bits (95), Expect = 0.061,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 33/102 (32%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQ----IVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  I  I   +   +  G+  +      +    ++        L      +H
Sbjct: 35  WLFMRLSGVILIVLIFGHLFVNLMVGEGVHAIDFGFVAGKWASPFWQIWDLLMLWLAMLH 94

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ II DY      +I    +     +++I      + 
Sbjct: 95  GTNGVRTIINDYAEKTGTRIALKTVLYVATVVIITLGTLVIF 136


>gi|120402594|ref|YP_952423.1| putative succinate dehydrogenase [Mycobacterium vanbaalenii PYR-1]
 gi|119955412|gb|ABM12417.1| succinate dehydrogenase subunit D [Mycobacterium vanbaalenii PYR-1]
          Length = 163

 Score = 40.8 bits (95), Expect = 0.065,   Method: Composition-based stats.
 Identities = 15/102 (14%), Positives = 36/102 (35%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ I  +   +  +   + + +      +  +    S+    +   L      +H
Sbjct: 55  WLFMRFSGIVLVFLALGHLFIMLMWENGVYRIDFNYVAERWSSPFWQTWDLLLLWLAQLH 114

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              GM+ II DY      K     + +  +   ++   + LL
Sbjct: 115 GGNGMRTIIADYSRKDSTKFWLNTLLALSMAFTLVLGTYVLL 156


>gi|326793535|ref|YP_004311355.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas mediterranea MMB-1]
 gi|326544299|gb|ADZ89519.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Marinomonas mediterranea MMB-1]
          Length = 116

 Score = 40.8 bits (95), Expect = 0.066,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 40/101 (39%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           + GT  ++ QR + +    + + FI+ FI      YE  V + S +          + + 
Sbjct: 10  RSGTREWLFQRLSNLLICVWSVVFISLFISAPQLNYESWVQLFSPLWFKLYSSATLLIVC 69

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           ++  L    I  DYI    +  +++       LL  +  LF
Sbjct: 70  LNSVLAGWQIGTDYIKANAVNWVYMQFIRLVSLLYAVLGLF 110


>gi|326381947|ref|ZP_08203640.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Gordonia neofelifaecis NRRL B-59395]
 gi|326199373|gb|EGD56554.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Gordonia neofelifaecis NRRL B-59395]
          Length = 143

 Score = 40.8 bits (95), Expect = 0.068,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 42/102 (41%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV----H 80
           ++  RF+ +A I      +   + +    +    S +++   +    +  +++      H
Sbjct: 36  WMFMRFSGLALIVLTFGHMFIMLMWDSGVHRIDASFVADRWKSPFWQVWDLTMLWLAQLH 95

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ +I DY      +     + +  ++L+++   +++L
Sbjct: 96  GGNGVRTVIADYSRKDSTRFWLNTLLALSMILILVLGTYAIL 137


>gi|215405332|ref|ZP_03417513.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis 02_1987]
 gi|215447625|ref|ZP_03434377.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T85]
 gi|289747136|ref|ZP_06506514.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis 02_1987]
 gi|294993740|ref|ZP_06799431.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Mycobacterium tuberculosis 210]
 gi|289687664|gb|EFD55152.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis 02_1987]
 gi|326902454|gb|EGE49387.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis W-148]
          Length = 144

 Score = 40.4 bits (94), Expect = 0.072,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 36  WLFMRFSGVVLVFLAIGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLH 95

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 96  GGNGLRTIIDDYSRKDATRFWLNSLLVLSMLFTLMLGTYVIV 137


>gi|294506383|ref|YP_003570441.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Salinibacter ruber M8]
 gi|294342711|emb|CBH23489.1| Succinate dehydrogenase hydrophobic membrane anchor subunit
           [Salinibacter ruber M8]
          Length = 153

 Score = 40.4 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 11/101 (10%), Positives = 41/101 (40%), Gaps = 2/101 (1%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTISI 77
           + G   ++  R T +  + ++I  I       D   +  +++   +           +++
Sbjct: 31  RTGMFAWMMHRLTGVGLVVYLIVHIWGLTALTDPETFNALIAKYHSPIFKVGEFALLVAV 90

Query: 78  SVHMQLGMQVIIEDYIH-YRLLKIMFLFMNSCFVLLLIIFC 117
           + H   G+++++ D++      K +F  + +   +++ +  
Sbjct: 91  AYHAMNGLRLVLIDFLGWSPKQKKLFWTLGAVTAVIIAVGG 131


>gi|322705581|gb|EFY97166.1| succinate dehydrogenase cytochrome b small subunit [Metarhizium
           anisopliae ARSEF 23]
          Length = 167

 Score = 40.4 bits (94), Expect = 0.074,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G+ H+  +R  A   +P  I           AP+       S     ++  +   ++ +
Sbjct: 64  HGSYHWTFERLLAAGLVPLTI-----------APFA------SGSLNPTMDAILCSAVLI 106

Query: 80  HMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           H  +G Q +I DYI  R    L+ +F +  +   +++ +
Sbjct: 107 HSHIGFQSVIIDYIPKRRYPGLRRLFWWGLNAATVVVGV 145


>gi|317508112|ref|ZP_07965796.1| succinate dehydrogenase subunit D protein [Segniliparus rugosus
           ATCC BAA-974]
 gi|316253623|gb|EFV13009.1| succinate dehydrogenase subunit D protein [Segniliparus rugosus
           ATCC BAA-974]
          Length = 156

 Score = 40.4 bits (94), Expect = 0.081,   Method: Composition-based stats.
 Identities = 9/105 (8%), Positives = 35/105 (33%), Gaps = 5/105 (4%)

Query: 23  GHFIKQRFTAIANIPFIIFFIAFFIKYG-----DAPYEQIVSVLSNVAVASIMGLGTISI 77
             +   R + +A +   +  +   +              +              +     
Sbjct: 48  HAWFFMRISGVALVFLALGHMLIMLTITPDGVHRVSSTFVAERWHQPFWRGWDLIMLWLA 107

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
            +H   G++V+I+DY      +++   + +   ++ ++   ++L+
Sbjct: 108 ELHGTNGVRVVIDDYARKPATRLVLRTILALSAIITLVAGSYALI 152


>gi|15842909|ref|NP_337946.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mycobacterium tuberculosis CDC1551]
 gi|31794498|ref|NP_856991.1| succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
           [Mycobacterium bovis AF2122/97]
 gi|121639241|ref|YP_979465.1| putative succinate dehydrogenase (hydrophobic membrane anchor
           subunit) sdhD [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148824521|ref|YP_001289275.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis F11]
 gi|215413197|ref|ZP_03421898.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis 94_M4241A]
 gi|215428804|ref|ZP_03426723.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T92]
 gi|215432282|ref|ZP_03430201.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis EAS054]
 gi|218755101|ref|ZP_03533897.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis GM 1503]
 gi|219559380|ref|ZP_03538456.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T17]
 gi|224991700|ref|YP_002646389.1| putative succinate dehydrogenase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|224991719|ref|YP_002646408.1| putative succinate dehydrogenase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|224991738|ref|YP_002646427.1| putative succinate dehydrogenase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253800362|ref|YP_003033363.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis KZN 1435]
 gi|254233927|ref|ZP_04927252.1| succinate dehydrogenase (hydrophobic membrane anchor subunit) sdhD
           [Mycobacterium tuberculosis C]
 gi|254365939|ref|ZP_04981984.1| succinate dehydrogenase (hydrophobic membrane anchor subunit) sdhD
           [Mycobacterium tuberculosis str. Haarlem]
 gi|254552421|ref|ZP_05142868.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|260188367|ref|ZP_05765841.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis CPHL_A]
 gi|260202481|ref|ZP_05769972.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T46]
 gi|260206671|ref|ZP_05774162.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis K85]
 gi|289444901|ref|ZP_06434645.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T46]
 gi|289449008|ref|ZP_06438752.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis CPHL_A]
 gi|289555596|ref|ZP_06444806.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis KZN 605]
 gi|289571546|ref|ZP_06451773.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T17]
 gi|289576039|ref|ZP_06456266.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis K85]
 gi|289752015|ref|ZP_06511393.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T92]
 gi|289755441|ref|ZP_06514819.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis EAS054]
 gi|289763507|ref|ZP_06522885.1| succinate dehydrogenase (hydrophobic membrane anchor subunit) sdhD
           [Mycobacterium tuberculosis GM 1503]
 gi|297635973|ref|ZP_06953753.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Mycobacterium tuberculosis KZN 4207]
 gi|297732970|ref|ZP_06962088.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Mycobacterium tuberculosis KZN R506]
 gi|313660302|ref|ZP_07817182.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Mycobacterium tuberculosis KZN V2475]
 gi|13883243|gb|AAK47760.1| succinate dehydrogenase, hydrophobic membrane anchor protein
           [Mycobacterium tuberculosis CDC1551]
 gi|31620094|emb|CAD95438.1| PROBABLE SUCCINATE DEHYDROGENASE (HYDROPHOBIC MEMBRANE ANCHOR
           SUBUNIT) SDHD (SUCCINIC DEHYDROGENASE) (FUMARATE
           REDUCTASE) (FUMARATE DEHYDROGENASE) (FUMARIC
           HYDROGENASE) [Mycobacterium bovis AF2122/97]
 gi|121494889|emb|CAL73372.1| Probable succinate dehydrogenase (hydrophobic membrane anchor
           subunit) sdhD [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|124599456|gb|EAY58560.1| succinate dehydrogenase (hydrophobic membrane anchor subunit) sdhD
           [Mycobacterium tuberculosis C]
 gi|134151452|gb|EBA43497.1| succinate dehydrogenase (hydrophobic membrane anchor subunit) sdhD
           [Mycobacterium tuberculosis str. Haarlem]
 gi|148723048|gb|ABR07673.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis F11]
 gi|224774815|dbj|BAH27621.1| putative succinate dehydrogenase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|224774834|dbj|BAH27640.1| putative succinate dehydrogenase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|224774853|dbj|BAH27659.1| putative succinate dehydrogenase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253321865|gb|ACT26468.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis KZN 1435]
 gi|289417820|gb|EFD15060.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T46]
 gi|289421966|gb|EFD19167.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis CPHL_A]
 gi|289440228|gb|EFD22721.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis KZN 605]
 gi|289540470|gb|EFD45048.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis K85]
 gi|289545300|gb|EFD48948.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T17]
 gi|289692602|gb|EFD60031.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T92]
 gi|289696028|gb|EFD63457.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis EAS054]
 gi|289711013|gb|EFD75029.1| succinate dehydrogenase (hydrophobic membrane anchor subunit) sdhD
           [Mycobacterium tuberculosis GM 1503]
 gi|328460095|gb|AEB05518.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis KZN 4207]
          Length = 144

 Score = 40.4 bits (94), Expect = 0.087,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 36  WLFMRFSGVVLVFLAIGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLH 95

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 96  GGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIV 137


>gi|306782370|ref|ZP_07420707.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu002]
 gi|306795081|ref|ZP_07433383.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu005]
 gi|308325119|gb|EFP13970.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu002]
 gi|308336656|gb|EFP25507.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu005]
          Length = 144

 Score = 40.4 bits (94), Expect = 0.088,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 36  WLFMRFSGVVLVFLAIGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTRDLLLLWLAQLH 95

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 96  GGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIV 137


>gi|289759462|ref|ZP_06518840.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T85]
 gi|289715026|gb|EFD79038.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis T85]
          Length = 149

 Score = 40.4 bits (94), Expect = 0.089,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 41  WLFMRFSGVVLVFLAIGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLH 100

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 101 GGNGLRTIIDDYSRKDATRFWLNSLLVLSMLFTLMLGTYVIV 142


>gi|308372499|ref|ZP_07667393.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu004]
 gi|308378270|ref|ZP_07668702.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu009]
 gi|308333171|gb|EFP22022.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu004]
 gi|308353052|gb|EFP41903.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu009]
          Length = 171

 Score = 40.4 bits (94), Expect = 0.090,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 63  WLFMRFSGVVLVFLAIGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTRDLLLLWLAQLH 122

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 123 GGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIV 164


>gi|218295723|ref|ZP_03496519.1| succinate dehydrogenase, membrane subunit (SdhD) [Thermus aquaticus
           Y51MC23]
 gi|218243882|gb|EED10409.1| succinate dehydrogenase, membrane subunit (SdhD) [Thermus aquaticus
           Y51MC23]
          Length = 131

 Score = 40.4 bits (94), Expect = 0.090,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 34/101 (33%), Gaps = 3/101 (2%)

Query: 25  FIKQRFTAIANIPFII---FFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           ++  R + +  +  +I   +  A         Y+ +   LS         L      +H 
Sbjct: 24  WVFMRISGVVLVFLVIGHMWMNAILTDINKINYDYVAQRLSQTTWKIYDWLMLALGLLHG 83

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
             G++ +++D+I     +     +    +  L     FSL 
Sbjct: 84  ANGLRYVMDDWIRDPAKRFWTKVVVYSLIAFLFALGSFSLF 124


>gi|154320917|ref|XP_001559774.1| Succinate dehydrogenase-ubiquinone-cytochrome b small subunit,
           mitochondrial precursor [Botryotinia fuckeliana B05.10]
 gi|150851871|gb|EDN27063.1| Succinate dehydrogenase-ubiquinone-cytochrome b small subunit,
           mitochondrial precursor [Botryotinia fuckeliana B05.10]
 gi|254839119|gb|ACT83438.1| SdhD [Botryotinia fuckeliana]
          Length = 192

 Score = 40.4 bits (94), Expect = 0.090,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 33/102 (32%), Gaps = 20/102 (19%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S   G+ H+  +R  A+  +P                   +   +S     +   L   +
Sbjct: 86  SPSHGSYHWTFERLIAVGLVPL-----------------TVAPFVSGSLNPATDALLCAA 128

Query: 77  ISVHMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           I +H  +G +  I DY   +     K    +      +L+ +
Sbjct: 129 ILIHSHIGFESCITDYFPSKRVPKTKAFLWWGLRGATVLVGV 170


>gi|41409540|ref|NP_962376.1| SdhD [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41398371|gb|AAS05992.1| SdhD [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 156

 Score = 40.4 bits (94), Expect = 0.090,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 34/97 (35%), Gaps = 7/97 (7%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +A     I  +   + + D      +  +    ++               +H
Sbjct: 47  WLFMRFSGVALFVLAIGHLFIMLMWDDGVYRIDFNYVAQRWASPFWQLWDLALLWLAQLH 106

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLI 114
              G++ II+DY      +      L ++  F L+L 
Sbjct: 107 GGNGLRTIIDDYSRKDSTRFWLNSLLLLSMGFTLVLG 143


>gi|194335044|ref|YP_002016904.1| succinate dehydrogenase, membrane subunit, putative
           [Prosthecochloris aestuarii DSM 271]
 gi|194312862|gb|ACF47257.1| succinate dehydrogenase, membrane subunit, putative
           [Prosthecochloris aestuarii DSM 271]
          Length = 165

 Score = 40.0 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 28/70 (40%)

Query: 53  PYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLL 112
            Y  + + L+N    +I  +  +    H   G+  ++ DY+    L+      +    L 
Sbjct: 90  TYSSVAARLANPLWKAIDIMLLLFALAHGLNGLNNVLVDYVQRAALRKALFAGSLAVCLF 149

Query: 113 LIIFCLFSLL 122
           L +  + S+L
Sbjct: 150 LSVQGIASIL 159


>gi|269795864|ref|YP_003315319.1| succinate dehydrogenase subunit D [Sanguibacter keddieii DSM 10542]
 gi|269098049|gb|ACZ22485.1| succinate dehydrogenase subunit D [Sanguibacter keddieii DSM 10542]
          Length = 151

 Score = 40.0 bits (93), Expect = 0.093,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 33/102 (32%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +  GD      +  +    ++        L      +H
Sbjct: 30  WVFMRASGVILLVLIFGHLFVNLMVGDGVNAIDFAFVGGKWASPFWQIWDLLMLWLGMMH 89

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ I+ DY    L+++          + + +     + 
Sbjct: 90  GTNGVRTIVNDYAERPLVRLWLKVALYTAFVAVTVLGTLVIF 131


>gi|261194400|ref|XP_002623605.1| succinate dehydrogenase membrane anchor subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239588619|gb|EEQ71262.1| succinate dehydrogenase membrane anchor subunit [Ajellomyces
           dermatitidis SLH14081]
          Length = 203

 Score = 40.0 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 35/102 (34%), Gaps = 20/102 (19%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S   G+ H+  +R  A+A IP  I        +                   +  +   +
Sbjct: 97  SPSHGSYHWTFERAIAVALIPLTI------APFAGGS-----------LNPVMDAVFCGT 139

Query: 77  ISVHMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           I +H  +G Q  I DYI  R     K  F ++     L + +
Sbjct: 140 ILMHSHIGFQSCIIDYIPGRRFPKAKKAFDWLLRVMTLTVAV 181


>gi|39974375|ref|XP_368578.1| conserved hypothetical protein [Magnaporthe oryzae 70-15]
 gi|145018419|gb|EDK02698.1| conserved hypothetical protein [Magnaporthe oryzae 70-15]
          Length = 171

 Score = 40.0 bits (93), Expect = 0.095,   Method: Composition-based stats.
 Identities = 12/99 (12%), Positives = 34/99 (34%), Gaps = 20/99 (20%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISV 79
            G  H+  +R  A   +P                   +    +      +  +   ++ +
Sbjct: 68  HGHYHWTFERILAAGLVPL-----------------TVAPFAAGSFNPVMDAVLCSTLLL 110

Query: 80  HMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           H  LG+Q +I DY+  +     +   +++ +    ++ +
Sbjct: 111 HSHLGLQNVITDYLPQKRVPKSRKAAMWLLNLATAVVGV 149


>gi|254839117|gb|ACT83437.1| SdhD [Botryotinia fuckeliana]
          Length = 192

 Score = 40.0 bits (93), Expect = 0.096,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 33/102 (32%), Gaps = 20/102 (19%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S   G+ H+  +R  A+  +P                   +   +S     +   L   +
Sbjct: 86  SPSHGSYHWTFERLIAVGLVPL-----------------TVAPFVSGSLNPATDALLCAA 128

Query: 77  ISVHMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           I +H  +G +  I DY   +     K    +      +L+ +
Sbjct: 129 ILIHSHIGFESCITDYFPSKRVPKTKAFLWWGLRGATVLVGV 170


>gi|226365716|ref|YP_002783499.1| succinate dehydrogenase cytochrome b subunit [Rhodococcus opacus
           B4]
 gi|226244206|dbj|BAH54554.1| succinate dehydrogenase cytochrome b subunit [Rhodococcus opacus
           B4]
          Length = 156

 Score = 40.0 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 42/119 (35%), Gaps = 14/119 (11%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIA------FFIKYGDAPYEQIVSVLSNV 64
           R R +     G   ++  R T +       FF+         ++     Y+ ++    N 
Sbjct: 35  RTRSLYRGDPGMWSWVLHRITGV----MTFFFLFVHVLDTALVRVNPDTYDSVIETYKNP 90

Query: 65  AVASIMGLGTISISVHMQLGMQVIIEDY----IHYRLLKIMFLFMNSCFVLLLIIFCLF 119
            V  +      ++  H   G++V++ D+      Y+ L +  +      V++     +F
Sbjct: 91  IVGLMELALVAAVLYHALNGVRVMLVDFWSKGPQYQRLMLWVILAIWFLVMIPGAGRIF 149


>gi|118464043|ref|YP_883436.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Mycobacterium avium 104]
 gi|254776731|ref|ZP_05218247.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Mycobacterium avium subsp. avium ATCC 25291]
 gi|118165330|gb|ABK66227.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Mycobacterium avium 104]
          Length = 156

 Score = 40.0 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 34/97 (35%), Gaps = 7/97 (7%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +A     I  +   + + D      +  +    ++               +H
Sbjct: 47  WLFMRFSGVALFVLAIGHLFIMLMWDDGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLH 106

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLI 114
              G++ II+DY      +      L ++  F L+L 
Sbjct: 107 GGNGLRTIIDDYSRKDSTRFWLNSLLLLSMGFTLVLG 143


>gi|298526794|ref|ZP_07014203.1| SdhD [Mycobacterium tuberculosis 94_M4241A]
 gi|308232415|ref|ZP_07664076.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu001]
 gi|308379481|ref|ZP_07668968.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu010]
 gi|308380647|ref|ZP_07669234.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu011]
 gi|298496588|gb|EFI31882.1| SdhD [Mycobacterium tuberculosis 94_M4241A]
 gi|308214023|gb|EFO73422.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu001]
 gi|308357006|gb|EFP45857.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu010]
 gi|308360862|gb|EFP49713.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu011]
 gi|323718188|gb|EGB27370.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis CDC1551A]
          Length = 149

 Score = 40.0 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 41  WLFMRFSGVVLVFLAIGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLH 100

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 101 GGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIV 142


>gi|308371309|ref|ZP_07667132.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu003]
 gi|308374840|ref|ZP_07667875.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu006]
 gi|308376070|ref|ZP_07668182.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu007]
 gi|308377301|ref|ZP_07668477.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu008]
 gi|308329340|gb|EFP18191.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu003]
 gi|308340691|gb|EFP29542.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu006]
 gi|308344425|gb|EFP33276.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu007]
 gi|308348429|gb|EFP37280.1| succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
           [Mycobacterium tuberculosis SUMu008]
          Length = 149

 Score = 40.0 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ +  +   I  +   + + +      +  +    ++    +   L      +H
Sbjct: 41  WLFMRFSGVVLVFLAIGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTRDLLLLWLAQLH 100

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ II+DY      +      L ++  F L+L  + + 
Sbjct: 101 GGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIV 142


>gi|119503173|ref|ZP_01625257.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [marine gamma proteobacterium HTCC2080]
 gi|119460819|gb|EAW41910.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [marine gamma proteobacterium HTCC2080]
          Length = 119

 Score = 40.0 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 34/81 (41%), Gaps = 2/81 (2%)

Query: 18 AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
          ++ G   ++ QR T+   I    F     I  G   Y    ++    A+     L  +S+
Sbjct: 9  SRSGLSDWLIQRVTS--LILLAYFICLAGILLGGVDYGAWKAMHDTTAMRIFTLLAAMSL 66

Query: 78 SVHMQLGMQVIIEDYIHYRLL 98
          + H  +G+  +  DY+  R+L
Sbjct: 67 AAHAWIGLWAVYTDYLTERML 87


>gi|268315783|ref|YP_003289502.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodothermus
           marinus DSM 4252]
 gi|262333317|gb|ACY47114.1| succinate dehydrogenase, cytochrome b556 subunit [Rhodothermus
           marinus DSM 4252]
          Length = 136

 Score = 40.0 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 14/109 (12%), Positives = 46/109 (42%), Gaps = 5/109 (4%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAP-YEQIVSVLSNVAVASIMGLGTISI 77
           + G   ++  R T I  + ++I  +       D   + ++++            L   ++
Sbjct: 22  RTGMLAWLLHRLTGIGLVVYLILHVWGLRALTDREAFNELIATYHAPIFKIGEFLLLAAV 81

Query: 78  SVHMQLGMQVIIEDYI--HYRLLKIMFLFMNSCFVLLLIIF--CLFSLL 122
           + H   G+++++ D++  H    K+ +     C +++ +     L++++
Sbjct: 82  AYHALNGLRIVLIDFLGWHPHSKKLFWTLAVVCLLIIGVGGYPSLYAVI 130


>gi|327351974|gb|EGE80831.1| succinate dehydrogenase membrane anchor subunit [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 203

 Score = 40.0 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 35/102 (34%), Gaps = 20/102 (19%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S   G+ H+  +R  A+A IP  I        +                   +  +   +
Sbjct: 97  SPSHGSYHWTFERAIAVALIPLTI------APFAGGS-----------LNPVMDAVFCGT 139

Query: 77  ISVHMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           I +H  +G Q  I DYI  R     K  F ++     L + +
Sbjct: 140 ILMHSHIGFQACIIDYIPGRRFPKAKKAFDWLLRVMTLTVAV 181


>gi|254514198|ref|ZP_05126259.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [gamma proteobacterium NOR5-3]
 gi|219676441|gb|EED32806.1| succinate dehydrogenase, hydrophobic membrane anchor protein
          [gamma proteobacterium NOR5-3]
          Length = 102

 Score = 40.0 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 27/66 (40%), Gaps = 2/66 (3%)

Query: 27 KQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQ 86
           QR TA+  + F +F            Y +  ++ +   +     L  +S++ H  +GM 
Sbjct: 1  MQRVTAVILLAFFVFVGVQIAS--GVSYAEWTALFAQTWMKIFTLLAILSLAAHAWIGMW 58

Query: 87 VIIEDY 92
           +  DY
Sbjct: 59 GVFTDY 64


>gi|323398683|ref|YP_004222758.1| succinate dehydrogenase subunit 4 [Glaucocystis nostochinearum]
 gi|321401376|gb|ADW83130.1| succinate dehydrogenase subunit 4 [Glaucocystis nostochinearum]
          Length = 93

 Score = 40.0 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 35/95 (36%), Gaps = 25/95 (26%)

Query: 19  KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISIS 78
           K G   +I QR +++  +PF  +F                          +     +   
Sbjct: 15  KSGWLDWIFQRVSSLFLLPFCFYF-----------------------NNLLFINHFL--F 49

Query: 79  VHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLL 113
            H++LG+  I+EDYIH   +K +        ++L 
Sbjct: 50  FHIKLGLYSILEDYIHNETIKEILSLFIRLIIILG 84


>gi|254820241|ref|ZP_05225242.1| succinate dehydrogenase hydrophobic membrane anchor protein SdhD
           [Mycobacterium intracellulare ATCC 13950]
          Length = 156

 Score = 40.0 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 34/97 (35%), Gaps = 7/97 (7%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  RF+ IA     I  +   + + +      +  +    ++               +H
Sbjct: 47  WLFMRFSGIALFVLAIGHLFIMLMWDNGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLH 106

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLI 114
              G++ II+DY      +      L ++  F L+L 
Sbjct: 107 GGNGLRTIIDDYSRKDSTRFWLNSLLLLSMGFTLVLG 143


>gi|258578271|ref|XP_002543317.1| succinate dehydrogenase cytochrome b small subunit [Uncinocarpus
           reesii 1704]
 gi|237903583|gb|EEP77984.1| succinate dehydrogenase cytochrome b small subunit [Uncinocarpus
           reesii 1704]
          Length = 494

 Score = 39.7 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 35/102 (34%), Gaps = 20/102 (19%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S   G+ H+  +R  AI+ IP  I                     +         +   +
Sbjct: 388 SPTHGSYHWDFERLVAISLIPLTI-----------------TPFAAGSLNPVTDAILCGA 430

Query: 77  ISVHMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           + +H  +G Q +I DY+  R     + + ++      L + +
Sbjct: 431 LVLHSHIGFQALIVDYLPARRVPKTRALCVWALRLATLTVAV 472


>gi|62257889|gb|AAX77751.1| unknown protein [synthetic construct]
          Length = 157

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 40/107 (37%), Gaps = 5/107 (4%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGD---APYEQIVSVLSNV-AVASIMGLGTI 75
            G   F  QR TA+    +  + I   +         Y+    + ++         +  +
Sbjct: 40  SGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTDGMFFRVATLMAYL 99

Query: 76  SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           ++  H  +G+ +I  DYI         + ++   V +   F LF++L
Sbjct: 100 AMFFHAWVGIWIICGDYI-KFAWASALVMLSFVLVYIFCFFWLFAVL 145


>gi|167627194|ref|YP_001677694.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Francisella philomiragia subsp. philomiragia ATCC
           25017]
 gi|241667757|ref|ZP_04755335.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|167597195|gb|ABZ87193.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 117

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 43/107 (40%), Gaps = 5/107 (4%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAP---YEQIVSVLS-NVAVASIMGLGTI 75
            G   F  QR TA+    +  + I   +    A    Y+    + + ++       +  +
Sbjct: 9   SGIKDFFVQRVTAVIIAVYFGYLILETLCLSHAGTLNYDSWRGLFTDSMFFRVATLMAYL 68

Query: 76  SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           ++  H  +G+ +I  DYI Y       + ++   + +   F LF++L
Sbjct: 69  AMFFHAWVGIWIICGDYIKYAW-ASALVMLSFVLIYVFCFFWLFAVL 114


>gi|50954261|ref|YP_061549.1| succinate dehydrogenase, membrane subunit [Leifsonia xyli subsp.
           xyli str. CTCB07]
 gi|50950743|gb|AAT88444.1| succinate dehydrogenase, membrane subunit [Leifsonia xyli subsp.
           xyli str. CTCB07]
          Length = 147

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 34/102 (33%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +  GD      +  +    +         L      +H
Sbjct: 25  WVYMRASGVVLVVLIFGHLLINLVLGDGVKQIDFAFVAGKYATPFWQVWDLLMLWLALIH 84

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              GM+ ++ DY     L  +     +  V++LI+     + 
Sbjct: 85  GGNGMRTLVNDYTANATLNRILKGAIAAAVVVLIVLGTLVIF 126


>gi|88856452|ref|ZP_01131110.1| succinate dehydrogenase, membrane subunit [marine actinobacterium
           PHSC20C1]
 gi|88814319|gb|EAR24183.1| succinate dehydrogenase, membrane subunit [marine actinobacterium
           PHSC20C1]
          Length = 148

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 35/101 (34%), Gaps = 4/101 (3%)

Query: 25  FIKQRFTAIANIPFII--FFIAFFIK--YGDAPYEQIVSVLSNVAVASIMGLGTISISVH 80
           +I  R + +  I  I    F+            +  +   L++       GL      +H
Sbjct: 26  WIYMRASGVVLIVLIFGHLFVNLVAGEGVKAIDFAFVGGKLADPFWIVWDGLMLWLALLH 85

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSL 121
              GM+ ++ DY     ++ + L   +    +LII     +
Sbjct: 86  GANGMRTLVNDYAINPKVRKVLLIGIAASTAILIILGTLVI 126


>gi|46199393|ref|YP_005060.1| putative membrane anchor of succinate dehydrogenase [Thermus
           thermophilus HB27]
 gi|55981424|ref|YP_144721.1| succinate dehydrogenase, membrane subunit SdhD [Thermus
           thermophilus HB8]
 gi|46197018|gb|AAS81433.1| putative membrane anchor of succinate dehydrogenase [Thermus
           thermophilus HB27]
 gi|55772837|dbj|BAD71278.1| succinate dehydrogenase, membrane subunit (SdhD) [Thermus
           thermophilus HB8]
          Length = 131

 Score = 39.7 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 14/101 (13%), Positives = 36/101 (35%), Gaps = 6/101 (5%)

Query: 25  FIKQRFTAIANIPFII---FFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           ++  R + +  +  +I   +  A  +      Y+ +   LS         L      +H 
Sbjct: 24  WVFMRVSGVVLVFLLIGHMWMNAVLVDLNSIDYDYVAKRLSQTTWKVYDWLILALALLHG 83

Query: 82  QLGMQVIIEDYIHYRLLKIMFLFMN---SCFVLLLIIFCLF 119
             G++ +++D++   + +     +      F+  L    LF
Sbjct: 84  GNGLRYVLDDWVRDPMKRFWTKVVVYSLLAFLFFLGSLSLF 124


>gi|312140769|ref|YP_004008105.1| succinate dehydrogenase cytochrome b subunit sdhc [Rhodococcus equi
           103S]
 gi|311890108|emb|CBH49426.1| succinate dehydrogenase cytochrome b subunit SdhC [Rhodococcus equi
           103S]
          Length = 140

 Score = 39.7 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 43/115 (37%), Gaps = 6/115 (5%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIA--FFIKYGDAPYEQIVSVLSNVAVAS 68
           R R +     G   ++  R T +A   F+   +     ++     Y++++    N  V  
Sbjct: 19  RTRSLYRGDPGMWSWVLHRITGVATFFFLFVHVLDTALVRVNPDTYDRVIETYKNPLVGL 78

Query: 69  IMGLGTISISVHMQLGMQVIIEDY----IHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +       +  H   G++V++ D+      Y+ + +  +      V++     +F
Sbjct: 79  MELALVAMVLYHALNGLRVMLVDFWSKGPQYQRVMLWVIIAIWFVVMIPGAGRIF 133


>gi|184201437|ref|YP_001855644.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Kocuria rhizophila DC2201]
 gi|183581667|dbj|BAG30138.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Kocuria rhizophila DC2201]
          Length = 161

 Score = 39.7 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 38/102 (37%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQ----IVSVLSNVAVASIMGLGTISISVH 80
           ++  R + I  +  +   +   +  G+  +      +    +N        +      +H
Sbjct: 39  WLFMRMSGIVLVVLVFGHLFVNLMVGEGVHAVDFGFVGGKWANPFWQVWDLVMLWLAMLH 98

Query: 81  MQLGMQVIIEDYIHYRLLKIMF---LFMNSCFVLLLIIFCLF 119
              GM+ II+DY      +      LF+ S FV+LL    +F
Sbjct: 99  GTNGMRTIIDDYAGRNTTRFWLKVFLFVASAFVILLGTMVIF 140


>gi|154245910|ref|YP_001416868.1| succinate dehydrogenase cytochrome b556 subunit [Xanthobacter
           autotrophicus Py2]
 gi|154159995|gb|ABS67211.1| Succinate dehydrogenase cytochrome b556 subunit [Xanthobacter
           autotrophicus Py2]
          Length = 133

 Score = 39.3 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/105 (17%), Positives = 39/105 (37%), Gaps = 2/105 (1%)

Query: 26  IKQRFTAIANIPFIIFFIAFFIKYGDAP--YEQIVSVLSNVAVASIMGLGTISISVHMQL 83
           I  R T +         + + +    +P  +E   SV  +     ++   T ++  H   
Sbjct: 29  IVHRITGVGLYFGTAILVWWLLAAATSPSAFESFRSVAGSPIGLIVLFGYTWALLHHALG 88

Query: 84  GMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILG 128
           G +  I D+IH    K   L   +     + +  +  ++ +A+ G
Sbjct: 89  GARHFIWDFIHGFGPKERMLLAQATLAGSVALTVILWVVGLAVKG 133


>gi|296128871|ref|YP_003636121.1| succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Cellulomonas flavigena DSM 20109]
 gi|296020686|gb|ADG73922.1| succinate dehydrogenase hydrophobic anchor subunit-like protein
           [Cellulomonas flavigena DSM 20109]
          Length = 152

 Score = 39.3 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 33/102 (32%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  I   +   +  G+      +  +    ++        L      +H
Sbjct: 31  WMFMRGSGVVLVVLIFGHLFVNLMVGEGISAIDFGFVAGKWASPFWQVWDLLMLWLAMLH 90

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ II DY      +++          L+I+     + 
Sbjct: 91  GTNGVRTIINDYAEKDTTRLVLKLALYVATTLVIVLGTLVIF 132


>gi|213421919|ref|ZP_03354985.1| succinate dehydrogenase cytochrome b556 small membrane subunit
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E01-6750]
          Length = 83

 Score = 39.3 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 34/80 (42%)

Query: 42  FIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101
            + FF   G+  +E      S+        L   SI +H  +GM  ++ DY+    ++++
Sbjct: 1   MVGFFATSGELTFEAWTGFFSSAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLAVRLI 60

Query: 102 FLFMNSCFVLLLIIFCLFSL 121
              +    +++ +I+    +
Sbjct: 61  LQLVIVVALVVYVIYGFVVV 80


>gi|325675591|ref|ZP_08155275.1| succinate dehydrogenase cytochrome b558 subunit [Rhodococcus equi
           ATCC 33707]
 gi|325553562|gb|EGD23240.1| succinate dehydrogenase cytochrome b558 subunit [Rhodococcus equi
           ATCC 33707]
          Length = 134

 Score = 39.3 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 43/115 (37%), Gaps = 6/115 (5%)

Query: 11  RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIA--FFIKYGDAPYEQIVSVLSNVAVAS 68
           R R +     G   ++  R T +A   F+   +     ++     Y++++    N  V  
Sbjct: 13  RTRSLYRGDPGMWSWVLHRITGVATFFFLFVHVLDTALVRVNPDTYDRVIETYKNPLVGL 72

Query: 69  IMGLGTISISVHMQLGMQVIIEDY----IHYRLLKIMFLFMNSCFVLLLIIFCLF 119
           +       +  H   G++V++ D+      Y+ + +  +      V++     +F
Sbjct: 73  MELALVAMVLYHALNGLRVMLVDFWSKGPQYQRVMLWVIIAIWFVVMIPGAGRIF 127


>gi|290957988|ref|YP_003489170.1| succinate dehydrogenase membrane subunit [Streptomyces scabiei
           87.22]
 gi|260647514|emb|CBG70619.1| putative succinate dehydrogenase membrane subunit [Streptomyces
           scabiei 87.22]
          Length = 163

 Score = 39.3 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 36/102 (35%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  +I  +   +          +  +    ++    +   L      +H
Sbjct: 55  WLFMRLSGVVLVVLVIGHLIIQLVLDGGVSKIGFAFVAGRWASPFWQTWDLLMLWLAMLH 114

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ +I DY      ++     L+  + F +LL    +F
Sbjct: 115 GANGLRTVINDYAERPNTRLWLKGLLYTATVFTILLGTLVIF 156


>gi|46107720|ref|XP_380919.1| hypothetical protein FG00743.1 [Gibberella zeae PH-1]
          Length = 197

 Score = 39.3 bits (91), Expect = 0.19,   Method: Composition-based stats.
 Identities = 15/102 (14%), Positives = 35/102 (34%), Gaps = 17/102 (16%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           S+  G+ H+  +RF A   +P                   +    +     ++  +    
Sbjct: 79  SSTHGSYHWTFERFLAAGLVPL-----------------TVAPFAAGSLNPTLDAILCSV 121

Query: 77  ISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCL 118
           + +H  +G Q ++ DYI  R    +    N    +  ++  +
Sbjct: 122 LLLHSHMGFQQVVIDYIPSRTYPGLRKTFNWLLNIATVLVGV 163


>gi|302927670|ref|XP_003054545.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256735486|gb|EEU48832.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 177

 Score = 38.9 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 42/102 (41%), Gaps = 20/102 (19%)

Query: 17  SAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTIS 76
           SA  G+ H+  +R  A   +P  I           AP+       S     ++  +    
Sbjct: 71  SAAHGSYHWSFERLLAAGLVPLTI-----------APFA------SGSLNPTLDAILCSV 113

Query: 77  ISVHMQLGMQVIIEDYIHYR---LLKIMFLFMNSCFVLLLII 115
           + +H  +G Q ++ DYI  R    L+ +F ++ +   +++ +
Sbjct: 114 LLLHSHMGFQQVVIDYIPKRTYAGLRKIFDWLLNIATVIVGV 155


>gi|254876301|ref|ZP_05249011.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254842322|gb|EET20736.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 122

 Score = 38.9 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 43/107 (40%), Gaps = 5/107 (4%)

Query: 20  DGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAP---YEQIVSVLS-NVAVASIMGLGTI 75
            G   F  QR TA+    +  + I   +    A    Y+    + + ++       +  +
Sbjct: 14  SGIKDFFVQRVTAVIIAVYFGYLILETLCLSHAGTLNYDSWRGLFTDSMFFRVATLMAYL 73

Query: 76  SISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
           ++  H  +G+ +I  DYI Y       + ++   + +   F LF++L
Sbjct: 74  AMFFHAWVGIWIICGDYIKYAW-ASALVMLSFVLIYVFCFFWLFAVL 119


>gi|88660666|gb|ABD24440.1| succinate dehydrogenase subunit 4 [Populus trichocarpa]
          Length = 108

 Score = 38.9 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 36/86 (41%), Gaps = 22/86 (25%)

Query: 28  QRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQV 87
           QR TA   +P II             Y+++ S            L  +S+  H+  G++ 
Sbjct: 22  QRITAALLLPLIII------------YKKVSSTF----------LLNLSLFWHINEGIEE 59

Query: 88  IIEDYIHYRLLKIMFLFMNSCFVLLL 113
           I+ DY+H  + +   L     F+L++
Sbjct: 60  IMADYVHQEMTRNWILVYLRLFLLIV 85


>gi|254393800|ref|ZP_05008914.1| succinate dehydrogenase membrane subunit [Streptomyces clavuligerus
           ATCC 27064]
 gi|294814601|ref|ZP_06773244.1| Succinate dehydrogenase membrane subunit [Streptomyces clavuligerus
           ATCC 27064]
 gi|326442989|ref|ZP_08217723.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Streptomyces clavuligerus ATCC 27064]
 gi|197707401|gb|EDY53213.1| succinate dehydrogenase membrane subunit [Streptomyces clavuligerus
           ATCC 27064]
 gi|294327200|gb|EFG08843.1| Succinate dehydrogenase membrane subunit [Streptomyces clavuligerus
           ATCC 27064]
          Length = 158

 Score = 38.9 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 35/102 (34%), Gaps = 7/102 (6%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  +I  +   +          +  +    ++        L      +H
Sbjct: 50  WLFMRLSGVVLVVLVIGHLIIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLLMLWLAMLH 109

Query: 81  MQLGMQVIIEDYIHYRLLKIM---FLFMNSCFVLLLIIFCLF 119
              G++ +I DY      ++     L+  + F +LL    +F
Sbjct: 110 GANGLRTVINDYAERPNTRLWLKGLLYTATVFTILLGTLVIF 151


>gi|300782782|ref|YP_003763073.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Amycolatopsis mediterranei U32]
 gi|299792296|gb|ADJ42671.1| succinate dehydrogenase hydrophobic membrane anchor protein
           [Amycolatopsis mediterranei U32]
          Length = 137

 Score = 38.9 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 9/102 (8%), Positives = 32/102 (31%), Gaps = 4/102 (3%)

Query: 25  FIKQRFTAIANIPFIIFFIAFFIKYGDA----PYEQIVSVLSNVAVASIMGLGTISISVH 80
           ++  R + +  +  ++  +              +  +    ++        L      +H
Sbjct: 27  WLFMRISGLVLVILVLGHLLIMNILDGGVHRINWGFVAGRWASPFWQFWDLLMLWLAEIH 86

Query: 81  MQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
              G++ II+DY      +     +    ++L++      + 
Sbjct: 87  GGNGLRTIIDDYARKDSTRFWLKILLYVSMVLILAVGTMVIF 128


>gi|32491171|ref|NP_871425.1| hypothetical protein WGLp422 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166378|dbj|BAC24568.1| sdhD [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 113

 Score = 38.9 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 24/59 (40%)

Query: 54  YEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLL 112
           YE      +   +     L  +SI++H  +G+  II DYI    L++    +    +  
Sbjct: 45  YELWREFFNKSLIKIFTILTFMSIAIHSWIGLWQIITDYIKSESLRLKLEIVIFLILFA 103


>gi|320333906|ref|YP_004170617.1| succinate dehydrogenase cytochrome subunit B [Deinococcus
           maricopensis DSM 21211]
 gi|319755195|gb|ADV66952.1| succinate dehydrogenase cytochrome b subunit [Deinococcus
           maricopensis DSM 21211]
          Length = 127

 Score = 38.9 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 43/105 (40%), Gaps = 8/105 (7%)

Query: 25  FIKQRFTAIANIPFII---FFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHM 81
           +I  R + +  +  ++   +     +   DA ++ +V+ L+  A      L  +  ++H 
Sbjct: 23  WIFMRISGVLLVFLVLGHVYMTFIQVSESDATFDAVVNKLAQPAWKFYDFLILLLATLHG 82

Query: 82  QLGMQVI