RPSBLAST alignment of GI: 254781042 and SCOP domain: d1nekd_

Alignment
>d1nekd_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]} Length = 113
 Score = 69.7 bits (171), Expect = 7e-14
 Identities = 25/111 (22%), Positives = 49/111 (44%)

Query: 14  GMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLG 73
                ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L 
Sbjct: 3   ASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLA 62

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             SI +H  +GM  ++ DY+    L++M   +    +++ +I+    +  +
Sbjct: 63  LFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV 113

SCOP domain information

class: Membrane and cell surface proteins and peptides
fold: Heme-binding four-helical bundle
superfamily: Fumarate reductase respiratory complex transmembrane subunits
family: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD)
domain: Succinate dehydrogenase subunit SdhD
species: Escherichia coli [TaxId: 562]