RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781045|ref|YP_003065458.1| outer membrane lipoprotein omp19 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >gnl|CDD|131967 TIGR02921, PEP_integral, PEP-CTERM family integral membrane protein. Members of this protein family, found in three different species so far, have a PEP-CTERM sequence at the carboxyl-terminus (see model TIGR02595), but are unusual among PEP-CTERM proteins in having multiple predicted transmembrane segments. The function is unknown. It is proposed that a member of the EpsH family, to be designated exosortase (see TIGR02602), recognizes and cleaves PEP-CTERM proteins in a manner analogous to the cleavage of LPXTG proteins by sortase (see Haft, et al., 2006). Length = 952 Score = 29.2 bits (65), Expect = 0.49 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 40 PSVESEILLPPIPEEEFD-QDDISVPSKDNNAIRMGIIGAWKVSYR 84 P E+ LL + + D + IS+P ++++AIR G+I A+ YR Sbjct: 269 PQQEAFELLAFADKNDQDGETIISIPREEHDAIRKGLINAYLAPYR 314 >gnl|CDD|152267 pfam11831, DUF3351, Domain of unknown function (DUF3351). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 73 to 279 amino acids in length. Length = 377 Score = 28.5 bits (64), Expect = 0.84 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 37 SLP-PSVESEILLPPIPEEEFDQDDI 61 SLP P E E+ LP EEE ++ + Sbjct: 150 SLPKPKNEYELELPEEEEEEPEEMEE 175 >gnl|CDD|178255 PLN02649, PLN02649, glucose-6-phosphate isomerase. Length = 560 Score = 27.7 bits (62), Expect = 1.6 Identities = 9/36 (25%), Positives = 18/36 (50%) Query: 57 DQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMIL 92 D+ + P K+N + +G++ W S+ + IL Sbjct: 307 DEHFRTAPLKENIPVLLGLLSVWNSSFLGYPARAIL 342 >gnl|CDD|178640 PLN03091, PLN03091, hypothetical protein; Provisional. Length = 459 Score = 27.6 bits (61), Expect = 1.7 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Query: 38 LPPSVESEILLPPI---PEEEFDQDDISVPSKDNNAIR 72 LPPSV S L P+ P D+ S+PS N +R Sbjct: 288 LPPSVTSSFLPTPMSYKPSISLPSDNPSIPSFTVNGVR 325 >gnl|CDD|181887 PRK09472, ftsA, cell division protein FtsA; Reviewed. Length = 420 Score = 25.9 bits (57), Expect = 5.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 41 SVESEILLPPIPEEEFDQDDI 61 S ++EI + PI EEE Q+D+ Sbjct: 89 SCQNEIGMVPISEEEVTQEDV 109 >gnl|CDD|152392 pfam11957, efThoc1, THO complex subunit 1 transcription elongation factor. The THO complex is a nuclear complex that is required for transcription elongation through genes containing tandemly repeated DNA sequences. The THO complex is also part of the TREX (TRanscription EXport) complex that is involved in coupling transcription to export of mRNAs to the cytoplasm. Length = 464 Score = 25.5 bits (56), Expect = 6.4 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Query: 32 KKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIGAWKV 81 KKP+ PS+ES + I E+EFD DD + AI W+ Sbjct: 408 KKPQRYRVPSLESFL--EGIKEDEFDIDDAQRKEEKKEAIEAKASKTWRA 455 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.139 0.417 Gapped Lambda K H 0.267 0.0542 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,695,809 Number of extensions: 163683 Number of successful extensions: 247 Number of sequences better than 10.0: 1 Number of HSP's gapped: 247 Number of HSP's successfully gapped: 8 Length of query: 162 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 76 Effective length of database: 4,136,185 Effective search space: 314350060 Effective search space used: 314350060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.6 bits)