RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781047|ref|YP_003065460.1| AFG1-family ATPase [Candidatus Liberibacter asiaticus str. psy62] (404 letters) >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown. Length = 223 Score = 33.7 bits (77), Expect = 0.091 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Query: 131 LVASSIALESRVLCFDE-FMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEI 189 LVA ++A VL DE F ++ +L+ LF L G I+MT++ + + + Sbjct: 123 LVARALATRPSVLLLDEPFTGLDMPTQELLTELFIELAGAGTAILMTTHDLAQAM--ATC 180 Query: 190 NRNVLVS 196 +R VL++ Sbjct: 181 DRVVLLN 187 >gnl|CDD|162606 TIGR01924, rsbW_low_gc, serine-protein kinase RsbW. This model describes the anti-sigma B factor also known as serine-protein kinase RsbW. Sigma B controls the general stress regulon in B subtilis and is activated by cell stresses such as stationary phase and heat shock. RsbW binds to sigma B and prevents formation of the transcription complex at the promoter. RsbV (anti-anti-sigma factor) binds to RsbW to inhibit association with sigma B, however RsbW can phosphorylate RsbV, causing disassociation of the RsbV/RsbW complex. Low ATP level or environmental stress causes the dephosphorylation of RsbV. Length = 159 Score = 32.5 bits (74), Expect = 0.19 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 185 YKDEINRNVLVSFIELLEKKLEIISLDSGQ--DYRRKEQSILPI 226 YK+ N + +SF + E +LEII D G D +QS+ P Sbjct: 59 YKEGENGEIGISF-HIYEDRLEIIVSDQGDSFDMDTFKQSLGPY 101 >gnl|CDD|179735 PRK04069, PRK04069, serine-protein kinase RsbW; Provisional. Length = 161 Score = 31.1 bits (71), Expect = 0.51 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Query: 185 YKDEINRNVLVSFIELLEKKLEIISLDSGQ--DYRRKEQSILPIY 227 YK++ + + F E+ E +LEI+ D+G DY + + P Sbjct: 59 YKEDEVGEIHIRF-EIYEDRLEIVVADNGVSFDYETLKSKLGPYD 102 >gnl|CDD|181587 PRK08939, PRK08939, primosomal protein DnaI; Reviewed. Length = 306 Score = 29.8 bits (68), Expect = 1.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Query: 66 MQGIYLHGDVGQGKSMLM 83 ++G+YL+GD G GKS L+ Sbjct: 156 VKGLYLYGDFGVGKSYLL 173 >gnl|CDD|178741 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional. Length = 2102 Score = 29.7 bits (67), Expect = 1.6 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Query: 10 LISLIQDKKLKYNPAQESVVKSFDRLLVD 38 LISL+ + + AQE+ V + DRLL D Sbjct: 1364 LISLLVSES---STAQEAGVCALDRLLDD 1389 >gnl|CDD|177379 PHA02544, 44, clamp loader, small subunit; Provisional. Length = 316 Score = 28.8 bits (65), Expect = 2.5 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Query: 127 DPIPLVASSIALES--RVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFI 180 + + AS+++L +V+ DEF +ADA R F +S C ++T+N Sbjct: 86 NRLTRFASTVSLTGGGKVIIIDEFDRLGLADAQRHLRSFMEAYSKNCSFIITANNK 141 >gnl|CDD|183720 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional. Length = 256 Score = 28.9 bits (65), Expect = 2.6 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Query: 146 DEFMITNIADAIILSRLFAALFSH---GCIIVMTS 177 D+ N+ ++LS FA + G II +TS Sbjct: 120 DKHYAVNVRATMLLSSAFAKQYDGKAGGRIINLTS 154 >gnl|CDD|178431 PLN02837, PLN02837, threonine-tRNA ligase. Length = 614 Score = 27.9 bits (62), Expect = 5.1 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Query: 279 FFDLCDRPLSANDFVEIANRFDVVIINDIPLLKED-RKDWIKRFIMLIDVFYEHKI 333 ++D PL+ D I D +I ++PL++E+ ++ ++ IM I+ Y+ +I Sbjct: 78 YYDFDMEPLTDKDLKRIKKEMDRIISRNLPLVREEVSREEAQKRIMAINEPYKLEI 133 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.142 0.414 Gapped Lambda K H 0.267 0.0621 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,608,498 Number of extensions: 437416 Number of successful extensions: 1138 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1138 Number of HSP's successfully gapped: 28 Length of query: 404 Length of database: 5,994,473 Length adjustment: 96 Effective length of query: 308 Effective length of database: 3,920,105 Effective search space: 1207392340 Effective search space used: 1207392340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 58 (26.4 bits)