HHsearch alignment for GI: 254781048 and conserved domain: PRK03806

>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=96.30  E-value=0.077  Score=32.02  Aligned_cols=124  Identities=16%  Similarity=0.217  Sum_probs=67.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCEEEECCCHHHHCCCCEEEEECCC
Q ss_conf             98728998898136899999995799869999657881289883076205446887568526974883789789995566
Q gi|254781048|r    2 KSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGI   81 (320)
Q Consensus         2 k~~KV~IIGaG~VG~~~a~~~~~~~l~ei~L~D~~~~~~~g~~~Dl~~~~~~~~~~~~v~~~~d~~~l~~aDivVitag~   81 (320)
T Consensus         5 ~~k~v~V~GlG~sG~s~~~~L~~~G-~~v~~~D~~~~~~~~~~--l~~~------~~~~~g~~~~~~~~~~d~vV~SPGI   75 (438)
T PRK03806          5 QGKNVVIIGLGLTGLSCVDFFLARG-VTPRVMDTRMTPPGLDK--LPEN------VERHTGSLNDEWLLAADLIVASPGI   75 (438)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHCC-CEEEEEECCCCCHHHHH--HHCC------CCEEECCCCHHHHCCCCEEEECCCC
T ss_conf             8998999945788899999999789-96999989999005788--6458------8466577796680679999989978


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEE--CCCCHH---HHHHHHHHCCCC
Q ss_conf             66765574678998899999999765412667408871--484207---899998844998
Q gi|254781048|r   82 PRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICI--TNPLDA---MVWALQKFSGLP  137 (320)
Q Consensus        82 ~~~~g~~R~dll~~N~~i~~~i~~~i~~~~p~~i~ivv--tNPvDv---~~~~~~~~sg~~  137 (320)
T Consensus        76 ~~~~p-~~~~a~~~~i~i~seiel~~~-~~-~~~iIaVTGTnGKTTTt~li~~iL~~~g~~  133 (438)
T PRK03806         76 ALAHP-SLSAAADAGVEIVGDIELFCR-EA-QAPIVAITGSNGKSTVTTLVGEMAKAAGVN  133 (438)
T ss_pred             CCCCH-HHHHHHHCCCCEEEHHHHHHC-CC-CCCEEEEECCCCCHHHHHHHHHHHHHCCCC
T ss_conf             99898-999999879947769999722-27-998899948998489999999999865997