HHsearch alignment for GI: 254781049 and conserved domain: COG1038

>COG1038 PycA Pyruvate carboxylase [Energy production and conversion].
Probab=97.76  E-value=0.0016  Score=42.81  Aligned_cols=128  Identities=23%  Similarity=0.319  Sum_probs=86.0

Q ss_pred             HHHHHHHHHCCCCCCCCE--EECCHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHH
Q ss_conf             999999998689888815--747999999999872998699971213687656565567777777079958999999999
Q gi|254781049|r    6 YQAKALLRKYNVPVAKGV--VISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDI   83 (398)
Q Consensus         6 yqaK~lL~~~GIpvp~g~--~a~s~~ea~~~a~~ig~p~~VvKaQV~aGgRGKa~~~~~hk~~~GGV~l~~s~~ea~~~a   83 (398)
T Consensus       123 v~Ar~~A~~agvPvipgt~~~~~~~ee~~~fa~~~gyPv-miKA~~GGGGRG--------------MR~vr~~~~l~~~~  187 (1149)
T COG1038         123 VKARNAAIKAGVPVIPGTDGPIETIEEALEFAEEYGYPV-MIKAAAGGGGRG--------------MRVVRSEADLAEAF  187 (1149)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCE-EEEECCCCCCCC--------------EEEECCHHHHHHHH
T ss_conf             889999997599855699998212999999998669858-999714798665--------------26625888999999


Q ss_pred             HH-------HCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEEEEEEEEECCCCCEEEEEECCCCCCHHHHHHHCHHHHEE
Q ss_conf             98-------61876544212222244330110345556505899999834778048998447884024555748312203
Q gi|254781049|r   84 RE-------ILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFK  156 (398)
Q Consensus        84 ~~-------ilg~~l~t~qt~~~G~~v~~vLVEe~v~~~~E~ylgi~~Dr~~~~~vii~S~~GGvdIE~va~~~p~~I~~  156 (398)
T Consensus       188 ~~AksEAkaAFG~--------------~eVyvEk~ve~pkHIEVQiLgD-~~GnvvHLfE--RDCSvQ---RRhQKV---  244 (1149)
T COG1038         188 ERAKSEAKAAFGN--------------DEVYVEKLVENPKHIEVQILGD-THGNVVHLFE--RDCSVQ---RRHQKV---  244 (1149)
T ss_pred             HHHHHHHHHHCCC--------------CCEEHHHHHCCCCEEEEEEEEC-CCCCEEEEEE--CCCCHH---HCCCEE---
T ss_conf             9988999974189--------------8066565524865268998605-7787888862--355331---014403---


Q ss_pred             EECCCCCCCCHHHHH
Q ss_conf             321444578957888
Q gi|254781049|r  157 LLIDPLIGVTSEDVA  171 (398)
Q Consensus       157 ~~id~~~gl~~~~~~  171 (398)
T Consensus       245 VE~APa~~L~~~~R~  259 (1149)
T COG1038         245 VEVAPAPYLSPELRD  259 (1149)
T ss_pred             EEECCCCCCCHHHHH
T ss_conf             785688889999999