>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily. Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily. ABP is only involved in transport contrary to other related sugar-binding proteins such as the glucose/galactose-binding protein (GGBP) and the ribose-binding protein (RBP), both of which are involved in chemotaxis as well as transport. The periplasmic ABP consists of two alpha/beta globular domains connected by a three-stranded hinge, a Venus flytrap-like domain, which undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, ABP is homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR) and DNA-binding transcriptional repressors such a

Probab=96.02 E-value=0.14 Score=30.18 Aligned_cols=107 Identities=19% Similarity=0.183 Sum_probs=68.3 Q ss_pred HHHHHHHCCCCCCEEEEC-CCCCCHHHHHHHHH-HHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCC--CCEEE Q ss_conf 999999658996248842-78889899999999-986199865899963586132899999999999972999--87999 Q gi|254781049|r 282 TMDIIKLYGGAPANFLDV-GGGADQDKVAAAFK-IITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKIN--IPLVM 357 (398) Q Consensus 282 tmD~i~~~Gg~pANFlD~-gG~a~~e~~~~a~~-~il~~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~--~pivv 357 (398) T Consensus 152 f~~~l~~~g~p~~~vv~~~~~~~~~~~a~~~~~~~L~a~pdi~~~~i-----~a~ND~mAlGA~~Al~~aGl~~~~v~vv 226 (289) T cd01540 152 ALEALKAPGFPEANIFQAPQKTTDTEGAFDAAASTLTKNPNVKNWII-----YGLNDETVLGAVRATEQSGIAAADVIGV 226 (289) T ss_pred HHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEE-----EECCCHHHHHHHHHHHHCCCCCCCEEEE T ss_conf 99999635999607998456886699999999999975899884399-----9779668899999999749988976999 Q ss_pred ECCCCCHHHHHHHHHHCCCCEEEECCHH----HHHHHHHH Q ss_conf 7489858999999997699589949989----99999999 Q gi|254781049|r 358 RLEGANVDIGNRLIAESGLNVITAIDLD----DAAQKIVH 393 (398) Q Consensus 358 Rl~Gtn~~~g~~il~~~g~~~~~~~~~~----~A~~~~v~ 393 (398) T Consensus 227 gidg~~~~~~~~~~~~~~~~atv~Q~p~~~G~~av~~~~~ 266 (289) T cd01540 227 GINGSDAADEESKKQPTGFYGTVLISPTNHGYITAQNLYE 266 (289) T ss_pred EEECCCHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHH T ss_conf 9728825999974336764899950889999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd01540