>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of TreR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding wh

Probab=90.18 E-value=1.5 Score=23.35 Aligned_cols=102 Identities=16% Similarity=0.276 Sum_probs=64.2 Q ss_pred HHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCC Q ss_conf 99999965899624884278889899999999986199865899963586132899999999999972999879997489 Q gi|254781049|r 282 TMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEG 361 (398) Q Consensus 282 tmD~i~~~Gg~pANFlD~gG~a~~e~~~~a~~~il~~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvRl~G 361 (398) T Consensus 137 ~~~al~~~g~~~~~~~~--~~~~~~~~~~~~~~ll~~~~~~Ai~-------~~nD~~A~g~~~~l~~~g~~vP~Disvig 207 (259) T cd01542 137 YLDALKEHGICPPNIVE--TDFSYESAYEAAQELLEPQPPDAIV-------CATDTIALGAMKYLQELGRRIPEDISVAG 207 (259) T ss_pred HHHHHHHCCCCCCEEEE--CCCCHHHHHHHHHHHHHCCCCCCEE-------ECCHHHHHHHHHHHHHCCCCCCCCEEEEE T ss_conf 99999976999635996--5787778999999997457998324-------34589999999999981999999869999 Q ss_pred C-CHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHH Q ss_conf 8-589999999976995899499899999999985 Q gi|254781049|r 362 A-NVDIGNRLIAESGLNVITAIDLDDAAQKIVHAV 395 (398) Q Consensus 362 t-n~~~g~~il~~~g~~~~~~~~~~~A~~~~v~~~ 395 (398) T Consensus 208 fdd~~~~-~~~-~P~LTt-v~q~~~~~G~~A~~~L 239 (259) T cd01542 208 FGGYELS-SVV-TPSLTT-VDFGYKEAGKKAAELL 239 (259) T ss_pred ECCHHHH-HHC-CCCCEE-EEECHHHHHHHHHHHH T ss_conf 8982999-826-899789-9959999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd01542