>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. This group includes the ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. They are members of the LacI-GalR family of repressor proteins which are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.

Probab=92.76 E-value=0.8 Score=25.10 Aligned_cols=87 Identities=13% Similarity=0.115 Sum_probs=56.9 Q ss_pred CCCCCCHHHHHHHHHHHHC-CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCCC Q ss_conf 2788898999999999861-998658999635861328999999999999729998799974898589999999976995 Q gi|254781049|r 299 VGGGADQDKVAAAFKIITS-DSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLN 377 (398) Q Consensus 299 ~gG~a~~e~~~~a~~~il~-~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvRl~Gtn~~~g~~il~~~g~~ 377 (398) T Consensus 156 ~~~~~~~~~~~~~~~~~l~~~~~~~aii-------~~~D~~A~g~l~~l~~~gi~vp~disiigfd~~---~~~~~~~p~ 225 (268) T cd06289 156 VEGPPSRQGGAEAVAQLLDLPPRPTAIV-------CFNDLVAFGAMSGLRRAGLTPGRDIAVVGFDDV---AEAALATPA 225 (268) T ss_pred ECCCCCHHHHHHHHHHHHHCCCCCCEEC-------CCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCH---HHHHHCCCC T ss_conf 3168865569999999984699986203-------576899999999999849999985499995787---899722897 Q ss_pred EE-EECCHHHHHHHHHHHH Q ss_conf 89-9499899999999985 Q gi|254781049|r 378 VI-TAIDLDDAAQKIVHAV 395 (398) Q Consensus 378 ~~-~~~~~~~A~~~~v~~~ 395 (398) T Consensus 226 ltti~~~~~~~g~~a~~~l 244 (268) T cd06289 226 LTTVSTDPREIGRRAAELL 244 (268) T ss_pred EEEEEECHHHHHHHHHHHH T ss_conf 1699849999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd06289