>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription

Probab=93.64 E-value=0.59 Score=25.96 Aligned_cols=103 Identities=15% Similarity=0.229 Sum_probs=64.7 Q ss_pred HHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHH-HCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECC Q ss_conf 9999996589962488427888989999999998-619986589996358613289999999999997299987999748 Q gi|254781049|r 282 TMDIIKLYGGAPANFLDVGGGADQDKVAAAFKII-TSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLE 360 (398) Q Consensus 282 tmD~i~~~Gg~pANFlD~gG~a~~e~~~~a~~~i-l~~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvRl~ 360 (398) T Consensus 135 f~~al~~~g~~~~-~~~~~~~~~~~~~~~~~~~~l~~~~~~~Ai~-------~~nD~~A~g~~~al~~~g~~vP~disvi 206 (265) T cd06291 135 FLDVLKENGLEVR-IIEIQENFDDAEKKEEIKELLEEYPDIDGIF-------ASNDLTAILVLKEAQQRGIRVPEDLQII 206 (265) T ss_pred HHHHHHHCCCCCE-EEEECCCCCHHHHHHHHHHHHHCCCCCCEEE-------CCCHHHHHHHHHHHHHCCCCCCCCEEEE T ss_conf 9999997699960-8997688986999999999985599988432-------1668999999999998199999986999 Q ss_pred CCCHHHHHHHHHHCCCCEE-EECCHHHHHHHHHHHH Q ss_conf 9858999999997699589-9499899999999985 Q gi|254781049|r 361 GANVDIGNRLIAESGLNVI-TAIDLDDAAQKIVHAV 395 (398) Q Consensus 361 Gtn~~~g~~il~~~g~~~~-~~~~~~~A~~~~v~~~ 395 (398) T Consensus 207 gfDd~---~~~~~~~p~LTtv~~~~~~~g~~A~~~L 239 (265) T cd06291 207 GYDGT---KLTRLYTPELTTIRQPIEEIAKTAVDLL 239 (265) T ss_pred EECCH---HHHHHCCCCCEEEECCHHHHHHHHHHHH T ss_conf 98880---9998439995599739999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd06291