>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators. This group includes the ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators. The binding of CelR to the celE promoter is inhibited specifically by cellobiose. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn chang

Probab=91.72 E-value=1.1 Score=24.29 Aligned_cols=103 Identities=17% Similarity=0.212 Sum_probs=67.0 Q ss_pred HHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHC-CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCC Q ss_conf 99999658996248842788898999999999861-99865899963586132899999999999972999879997489 Q gi|254781049|r 283 MDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITS-DSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEG 361 (398) Q Consensus 283 mD~i~~~Gg~pANFlD~gG~a~~e~~~~a~~~il~-~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvRl~G 361 (398) T Consensus 148 ~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ai~~-------~nD~~A~g~~~~~~~~g~~iP~disIig 220 (275) T cd06295 148 REALAEAGLPLDPRLVAPGDFTEESGRAAMRALLERGPDFDAVFA-------ASDLMALGALRALREAGRRVPEDVAVVG 220 (275) T ss_pred HHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHCCCCCCEEEE-------CCCHHHHHHHHHHHHCCCCCCCCEEEEE T ss_conf 999998699999417996577668799998889854999870341-------4758789999999974999898569999 Q ss_pred CCHHHHHHHHHHCCCCEE-EECCHHHHHHHHHHHH Q ss_conf 858999999997699589-9499899999999985 Q gi|254781049|r 362 ANVDIGNRLIAESGLNVI-TAIDLDDAAQKIVHAV 395 (398) Q Consensus 362 tn~~~g~~il~~~g~~~~-~~~~~~~A~~~~v~~~ 395 (398) T Consensus 221 fd~~---~~~~~~~P~LTtI~~~~~~ig~~A~~~L 252 (275) T cd06295 221 FDDI---PLAAYADPPLTTVRQDIEEAGRLLVDLL 252 (275) T ss_pred ECCH---HHHHHCCCCEEEEEECHHHHHHHHHHHH T ss_conf 6786---8998348986999809999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd06295