>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site. These enzymes are: ATP citrate-lyase (4.1.3.8 from EC) , the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues, catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. ATP-citrate lyase is a tetramer of identical subunits; Succinyl-CoA ligase (GDP-forming) (6.2.1.4 from EC) is a mitochondrial enzyme that catalyzes the substrate level phosphorylation step of the tricarboxylic acid cycle: the formation of succinyl-CoA from succinate with a concomitant hydrolysis of GTP to GDP and phosphate. This enzyme is a dimer composed of an alpha and a beta subunits; Succinyl-CoA ligase (ADP-forming) (6.2.1.5 from EC) is a bacterial enzyme that during aerobic metabolism functions in the citric acid cycle, coupling the hydrolysis of succinyl-CoA to the synthesis of ATP. It can also function in the other direction for anabolic purposes. This enzyme is a tetramer composed of two alpha and two beta subunits; and Malate-CoA ligase (6.2.1.9 from EC) (malyl-CoA synthetase) , is a bacterial enzyme that forms malyl-CoA from malate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. Malate-CoA ligase is composed of two different subunits. This entry corresponds to a conserved region located in the first half of ATP citrate lyase and in the beta subunits of succinyl-CoA ligases and malate-CoA ligase. ; GO: 0003824 catalytic activity, 0008152 metabolic process.

Probab=93.43 E-value=0.68 Score=26.01 Aligned_cols=164 Identities=21% Similarity=0.330 Sum_probs=114.7 Q ss_pred HHHHHHHHCCCCEEEECCCCEEECCC-C-----HHCCEECCCCC------------------------------CCCCEE Q ss_conf 99999840177189406851013555-1-----00020011235------------------------------778679 Q gi|254781050|r 111 VRVKARLEKSSSRLIGPNCPGILTPD-S-----CKIGIMPGSIF------------------------------RKGSVG 154 (300) Q Consensus 111 ~~l~~~A~~~g~riiGPNc~Gii~p~-~-----~~lgi~p~~~~------------------------------~pG~Vg 154 (300) T Consensus 182 ~~Ly~~F~e~Da~L~EINPL-ViT~~G~L~alDAKl~~DDnALFRH~~l~~~~D~~~~~~~e~~A~~~gL~Yv~LdGnIG 260 (389) T TIGR01016 182 KKLYQIFLEKDASLVEINPL-VITKDGNLVALDAKLTIDDNALFRHPDLEEMEDYTQEDQLEVEAKQLGLNYVKLDGNIG 260 (389) T ss_pred HHHHHHHHHCCCCEEEECCE-EECCCCCEEEEEEECCCCCCHHCCCCCHHHHCCCCCCCHHHHHHHHHCCCEEEECCCEE T ss_conf 99999887537102545263-68789888998332244655100671168763888777337999861883688547707 Q ss_pred EEEECCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEEEEEECCCHHHH-HHHH-HHHHHHH Q ss_conf 9980541478999999971995167640556744678999999999739987288999705872489-9999-9998642 Q gi|254781050|r 155 ILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEE-EAAQ-FLKDEAK 232 (300) Q Consensus 155 ivSqSG~l~~e~~~~~~~~g~G~S~~VsiG~D~~~G~~~~d~L~~~~~Dp~T~~Ivl~gEiGG~~E~-~aa~-fi~~~~~ 232 (300) T Consensus 261 c~vNGAGLAMaTMDIiKl~GG~PANFLDvGGGA~~-e~v~eA~~~vLsD~~VKvvfiNI-FGGI~RCD~vA~G~v~A~~~ 338 (389) T TIGR01016 261 CMVNGAGLAMATMDIIKLYGGKPANFLDVGGGASE-ERVKEALKLVLSDKSVKVVFINI-FGGITRCDEVAKGLVEALKD 338 (389) T ss_pred EECCCHHHHHHHHHHHHHHCCCCCEECCCCCCCCH-HHHHHHHHHHHCCCCCEEEEEEE-CCCEECHHHHHHHHHHHHHC T ss_conf 97043567899999999718895302245878898-99999989873599820899970-68600187887889999831 Q ss_pred CCCCCCEEEEEEEECCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCC-----CEECCCHHHHHHHHHHHH Q ss_conf 26755268998430157655322001122488889999999999889-----757889899999999998 Q gi|254781050|r 233 RGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAG-----ICIAPSPARIGRSLVELL 297 (300) Q Consensus 233 ~~~~KPVva~~~GrtAp~g~~~gHaGAi~~~~~g~a~~k~~al~~aG-----v~v~~s~~el~~~l~~~l 297 (300) T Consensus 339 ~~~~VP~VvRL~GTN~E~G~~--------------------iL~e~gkdr~ni~~~~sm~~aA~kaV~~~ 388 (389) T TIGR01016 339 VGVNVPVVVRLEGTNVEEGKK--------------------ILQESGKDRLNIIFATSMEEAAEKAVELA 388 (389) T ss_pred CCCCCCEEEECCCCCHHHHHH--------------------HHHHHCCCCCCCCCCCCHHHHHHHHHHHH T ss_conf 885368789815788788889--------------------99972767788632268788999999983

HHsearch alignment for GI: 254781050 and conserved domain: TIGR01016