HHsearch alignment for GI: 254781053 and conserved domain: PRK06184

>PRK06184 hypothetical protein; Provisional.
Probab=94.37  E-value=0.007  Score=39.48  Aligned_cols=59  Identities=8%  Similarity=0.141  Sum_probs=43.7

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEEC
Q ss_conf             222222222222232200234420146872169997213321100000232045312103
Q gi|254781053|r  219 AHCLKIMSKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTK  278 (466)
Q Consensus       219 ~~~~~~l~~~gV~i~~~~~v~~i~~~~~~~~v~~~~~~g~~~~i~~D~vl~a~G~~Pn~~  278 (466)
T Consensus       116 ~~L~~~l~~~g~~v~~g~~v~~~~q~~~~V~v~~~~~~~-~~~i~a~ylVGaDGa~S~VR  174 (503)
T PRK06184        116 EILRERLAELGHRVEFGCELVGFEQDPEGVTARVAGPAG-EETVRARYLVGADGGRSFVR  174 (503)
T ss_pred             HHHHHHHHHCCCEEEECCEEEEEEECCCEEEEEEECCCC-CEEEEEEEEECCCCCCHHHH
T ss_conf             999999986798699476688999819989999985997-18999877741577774668