HHsearch alignment for GI: 254781053 and conserved domain: PRK07818

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed.
Probab=100.00  E-value=0  Score=849.44  Aligned_cols=461  Identities=37%  Similarity=0.602  Sum_probs=431.6

Q ss_pred             CC--CCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCEECCCCCC
Q ss_conf             93--3199998986689999999987993999937997150251366737098999999999999866755816477532
Q gi|254781053|r    1 MV--YDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHL   78 (466)
Q Consensus         1 M~--YDvvIIG~G~AG~~aA~~~~~~G~~V~lIE~~~~~GGtC~~~GCiPsK~l~~~a~~~~~~~~~~~~~g~~~~~~~~   78 (466)
T Consensus         1 M~~~YDviVIG~GpaG~~aA~~aa~~G~kv~iiE~~-~~GGtC~n~GCiPsK~l~~~a~~~~~~~~~~~~~gi~-~~~~~   78 (467)
T PRK07818          1 MMTHYDVVVLGAGPGGYVAAIRAAQLGLKTAVVEPK-YWGGVCLNVGCIPSKALLRNAELAHIFTKEAKTFGIS-GEVTF   78 (467)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHCCCEEEEEECC-CCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCC
T ss_conf             985687899997889999999999789909999489-9687506176011399999999999999788867977-42416


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCCCCCC-CCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             8999999999999987777787640043101100111002221023575-211232210000467665244457665321
Q gi|254781053|r   79 DLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGS-SSEETIEAKNIVIATGSEASGLPGMSIDFD  157 (466)
Q Consensus        79 d~~~~~~~~~~~v~~~~~~~~~~~~~~~V~~~~g~a~~~~~~~v~V~~~-~~~~~i~ad~iviATGs~p~~iP~~~~~~~  157 (466)
T Consensus        79 d~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~i~G~a~f~~~~~v~V~~~~~~~~~i~a~~iiIATGs~p~~lPg~~~---  155 (467)
T PRK07818         79 DYGAAFDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFTDANTLEVDLNDGGTETVTFDNAIIATGSSTRLLPGTSL---  155 (467)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECEEEEECCCEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCCCC---
T ss_conf             89999999999999987569999986793999430798248513897178962799952689876887665788678---


Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             00245305741111113332101234454332013220122011100001112212222112222222222222322002
Q gi|254781053|r  158 EQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSK  237 (466)
Q Consensus       158 ~~~~~t~~~~~~l~~~P~~ivIIGgG~ig~E~A~~~~~lG~~Vtli~~~~~ll~~~d~~~~~~~~~~l~~~gV~i~~~~~  237 (466)
T Consensus       156 ~~~~~~~~~~~~~~~lPk~v~IiGgG~ig~E~A~~~~~lG~~Vtiv~~~~~~l~~~d~~~~~~l~~~l~~~Gi~i~~~~~  235 (467)
T PRK07818        156 SENVVTYEEQILSRELPKSIVIAGAGAIGMEFAYVLKNYGVDVTIVEFLDRALPNEDAEVSKEIEKQYKKLGVKILTGTK  235 (467)
T ss_pred             CCCEEEEHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEECCCE
T ss_conf             88778535772334589669999987999999999983298777762113135442267899999999866988855976


Q ss_pred             HHHHHCCCCCCEEEEEEEC-CCCCCCEEEEEEECCCCEEEECCCCCEEEECCCCCCCCCCCCCCCEEECCCCEEECCCCC
Q ss_conf             3442014687216999721-332110000023204531210367840000126764223337763330268487024333
Q gi|254781053|r  238 VSSVKKVKGKAQVVYRSTD-DEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVR  316 (466)
Q Consensus       238 v~~i~~~~~~~~v~~~~~~-g~~~~i~~D~vl~a~G~~Pn~~~l~Le~~gi~~~~~G~I~vd~~~~Ts~p~IyA~GDv~g  316 (466)
T Consensus       236 v~~i~~~~~~~~v~~~~~~~g~~~~i~~d~vlva~Gr~Pn~~~L~L~~~gv~~~~~G~I~vd~~~~Ts~~~IyA~GDv~g  315 (467)
T PRK07818        236 VESIRDNGDGVEVTVTVSKDGKSEELKADKVLQAIGFAPNVEGYGLEKTGVALTDRGAIGIDDYMRTNVPHIYAIGDVTA  315 (467)
T ss_pred             EEEEEECCCEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCEEECCCCCEEECCCCCCCCCEEEEEECCCC
T ss_conf             89999849939999998889946999952589811675044434641355478799858689988647873999722688


Q ss_pred             CCCCCCEECCCCCCEEECCCCCCCC--CCCCCCCCCEEEHHHHHHHHHCHHHHHHCCCCEEEEEEEECCCCHHHHCCCCC
Q ss_conf             5434430001232012011122222--22333322100014455100147888623466589999604470344188983
Q gi|254781053|r  317 GPMLAHKAEDEGIAVAEIISGQKGH--VNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSID  394 (466)
Q Consensus       317 ~~~l~~~A~~~g~~aa~~i~~~~~~--~~~~~ip~~vft~peia~vGlte~~a~~~~~~~~v~~~~~~~~~ra~~~~~~~  394 (466)
T Consensus       316 ~~~Lah~A~~eg~~a~~~i~~~~~~~~~d~~~iP~~vft~PeiA~VGlte~eA~~~g~~~~~~~~~~~~~~ra~~~~~~~  395 (467)
T PRK07818        316 KLQLAHVAEAQGVVAAETIAGAETLPLGDYRMMPRATFCQPQVASFGLTEEQAREEGYDVKVAKFPFTANGKAHGLGDPS  395 (467)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCEEEEECCHHHHHHCCCCEEEEEEECCCCHHHHHCCCCC
T ss_conf             87871489999999999865999863345566654997578769973899999864998899998567477777568985


Q ss_pred             EEEEEEEECCCCEEEEEEEECCCHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCC
Q ss_conf             389999978998699999982998899999999998789878996378437788999999999860897749
Q gi|254781053|r  395 GFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM  466 (466)
Q Consensus       395 g~~kli~~~~~~~ilG~~~vg~~a~eli~~~a~ai~~~~t~~~l~~~~~~hPt~~E~l~~aa~~~~~~~~~~  466 (466)
T Consensus       396 G~vKlv~d~~~~~IlGa~ivg~~A~elI~~~~~ai~~~~t~~~l~~~i~~hPT~sE~l~~A~~~~~g~~~~~  467 (467)
T PRK07818        396 GFVKLVADAKYGELLGGHLVGPDVSELLPELTLAQKWDLTAEELARNVHTHPTLSEALQEAFHGLAGHMINF  467 (467)
T ss_pred             EEEEEEEECCCCEEEEEEEECCCHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             799999999989699999988999999999999998839899994067789887999999999751788789