HHsearch alignment for GI: 254781053 and conserved domain: pfam01134

>pfam01134 GIDA Glucose inhibited division protein A.
Probab=98.91  E-value=8.6e-09  Score=82.51  Aligned_cols=132  Identities=27%  Similarity=0.406  Sum_probs=72.1

Q ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEE-ECCCCCCEEEEEECCCCHHHHHHHHHHHHHH-------HHHHHHCCEEC--
Q ss_conf             1999989866899999999879939999-3799715025136673709899999999999-------98667558164--
Q gi|254781053|r    4 DVAVVGGGPAGYACAIKAAQLKNKVAII-EKEKTYGGTCLNIGCIPSKALLHASEMYSHI-------AKEAGDLGINI--   73 (466)
Q Consensus         4 DvvIIG~G~AG~~aA~~~~~~G~~V~lI-E~~~~~GGtC~~~GCiPsK~l~~~a~~~~~~-------~~~~~~~g~~~--   73 (466)
T Consensus         1 DViVIGgGhAG~EAA~aaAr~G~~v~Lit~~~~----~ig~msCnpSiGG~gkG~LvrEidaLgG~m~~~aD~s~Iq~r~   76 (391)
T pfam01134         1 DVIVIGGGHAGCEAALAAARMGAKVLLITHNTD----TIAELSCNPSIGGIAKGHLVREIDALGGLMGKAADKTGIQFRM   76 (391)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC----CCEEEECCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             979999878999999999868996899973424----3158865655687530439999987258999999997545653


Q ss_pred             ----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-CCCEEEEEEEEE-E-CCCCCCC-CCCCCCCCCCCCEEECCCCCC
Q ss_conf             ----775328999999999999987777787640-043101100111-0-0222102-357521123221000046766
Q gi|254781053|r   74 ----ASCHLDLKKMMSYKKSIVESNTQGINFLLK-KNKIITYHGSAR-I-VSNNKIL-VKGSSSEETIEAKNIVIATGS  144 (466)
Q Consensus        74 ----~~~~~d~~~~~~~~~~~v~~~~~~~~~~~~-~~~V~~~~g~a~-~-~~~~~v~-V~~~~~~~~i~ad~iviATGs  144 (466)
T Consensus        77 LN~skGpAv~a~R~q~Dr~~y----~~~~~~~l~~~~nl~i~~~eV~~l~~~~~~v~GV~~~~g-~~i~a~~vIltTGT  150 (391)
T pfam01134        77 LNTSKGPAVRALRAQVDRDLY----SKEMTETLENHPNLTLIQGEVTDLIPENGKVKGVVTEDG-EEYKAKAVVIATGT  150 (391)
T ss_pred             HCCCCCCCCCCCHHHHHHHHH----HHHHHHHHHCCCCCEEEECCCEEEECCCCEEEEEEECCC-CEEECCEEEEECCC
T ss_conf             044678766685899879999----999999997599939995464003026995999993799-78514459993156