RPSBLAST alignment for GI: 254781053 and conserved domain: TIGR03315

>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase. Length = 1012
 Score = 44.0 bits (104), Expect = 8e-05
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 257 DEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQF-QTSISTIYAIGDVV 315
            E +++ AD V+ A G +  T  L  ++ GI +D  G   +     +T+I+ ++ IGD  
Sbjct: 758 GETVDLPADTVIAAVGEQVDTDLL--QKNGIPLDEYGWPVVNQATGETNITNVFVIGDAN 815

Query: 316 RGPMLAHKAEDEGIAVAEII---SGQKGHVN 343
           RGP    +A  +G   A  I    G    V+
Sbjct: 816 RGPATIVEAIADGRKAANAILSREGLNSDVD 846