RPSBLAST alignment for GI: 254781053 and conserved domain: COG1233

>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 487
 Score = 47.4 bits (112), Expect = 7e-06
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 1  MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTC 41
           +YDV V+G G  G A A   A+   KV ++EK    GG  
Sbjct: 2  PMYDVVVIGAGLNGLAAAALLARAGLKVTVLEKNDRVGGRA 42