RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781054|ref|YP_003065467.1| ribose-5-phosphate isomerase A [Candidatus Liberibacter asiaticus str. psy62] (231 letters) >gnl|CDD|30469 COG0120, RpiA, Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism]. Length = 227 Score = 246 bits (629), Expect = 4e-66 Identities = 103/231 (44%), Positives = 141/231 (61%), Gaps = 4/231 (1%) Query: 1 MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTEN 60 MD ++K+ AA+ A++YV DGM +G+GTGSTA F+ L ++ + +P+S TE Sbjct: 1 MDQDELKKAAAKAALEYVKDGMVIGLGTGSTAAYFIEALGRRVKGELDIGGVPTSFQTEE 60 Query: 61 FCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGD 120 + IP+ S +V S+DL+IDG DE+D L LIKG GGALLREKI+A AA RFIVI D Sbjct: 61 LARELGIPVSSLNEVDSLDLAIDGADEVDPNLNLIKGGGGALLREKIVASAAKRFIVIVD 120 Query: 121 ESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYI 180 ESK V+ LG+ LP+E+ F + L L++ G LR G ++D GNYI Sbjct: 121 ESKLVEVLGKFPLPVEVIPFARSAVLRKLEK----LGGKPTLREGEGKDGPVITDNGNYI 176 Query: 181 VDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK 231 +D FG I DP+ + EL IPGV+E+GLF II +DG +L+K Sbjct: 177 LDVHFGRIEDPEELEKELNAIPGVVENGLFAGRAADVIIAGTDGGVKILEK 227 >gnl|CDD|73164 cd01398, RPI_A, RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway. This reaction leads to the conversion of phosphosugars into glycolysis intermediates, which are precursors for the synthesis of amino acids, vitamins, nucleotides, and cell wall components. In plants, RPI is part of the Calvin cycle as ribulose 5-phosphate is the carbon dioxide receptor in the first dark reaction of photosynthesis. There are two unrelated types of RPIs (A and B), which catalyze the same reaction, at least one type of RPI is present in an organism. RPI_A is more widely distributed than RPI_B in bacteria, eukaryotes, and archaea.. Length = 213 Score = 237 bits (607), Expect = 2e-63 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 5/217 (2%) Query: 6 MKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIAN-GFRVQVIPSSRNTENFCKI 64 +KR AAR A+ YV DGM +G+GTGST F+ L +++ G + +P+S TE + Sbjct: 1 LKRAAARAAVDYVEDGMVIGLGTGSTVAYFIEALGERVREEGLNIVGVPTSFQTEELARE 60 Query: 65 HHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKR 124 IPL ++V +DL+IDG DE+D L LIKG GGALLREKI+A AA +FIVI DESK Sbjct: 61 LGIPLTDLDEVPRLDLAIDGADEVDPDLNLIKGGGGALLREKIVASAAKKFIVIADESKL 120 Query: 125 VDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAF 184 V+ LG LP+E+ F + L++ G LR G V+D GNYI+D Sbjct: 121 VERLGEFPLPVEVVPFAWSYVARELEK----LGGKPVLREGSGKGGPVVTDNGNYILDVH 176 Query: 185 FGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGT 221 FG I DP+ + EL +IPGV+EHGLF+NM D I+GT Sbjct: 177 FGTIEDPEALEKELKSIPGVVEHGLFLNMADEVIVGT 213 >gnl|CDD|38285 KOG3075, KOG3075, KOG3075, Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism]. Length = 261 Score = 152 bits (385), Expect = 8e-38 Identities = 89/228 (39%), Positives = 123/228 (53%), Gaps = 10/228 (4%) Query: 5 QMKRNAARRAI-QYVVDGMTLGMGTGSTAKEFMILLADKIANG--FRVQVIPSSRNTENF 61 + KR AA +A+ YV +GM +G+G+GST + + + +G V +P+S + Sbjct: 26 EAKRLAAYKAVDNYVKNGMVIGIGSGSTVVYAVDRIGQLLFDGDLGNVVGVPTSFRSAQL 85 Query: 62 CKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDE 121 + IPL + +DL+IDG DE+D L LIKG GG LL+EK + AA +FIVI D Sbjct: 86 ALEYGIPLSDLDSHPVIDLAIDGADEVDENLNLIKGGGGCLLQEKDVEGAAKKFIVIADS 145 Query: 122 SKRVDFLGRGML---PIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNG-SGLFVSDGG 177 K LG P+E+ K L L E + FG +LR+ G +G +V+D G Sbjct: 146 RKGSKGLGGSGKQGVPVEVVPLAWLKLLENLSEFS--FGCEAKLRMGAEGKAGPYVTDNG 203 Query: 178 NYIVDAFF-GFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDG 224 N+I+D F I D S + IPGV+EHGLFI M D II SDG Sbjct: 204 NFIIDVQFETPIRDLNAASTSIKKIPGVVEHGLFIGMADTVIIAESDG 251 >gnl|CDD|109510 pfam00455, DeoR, Bacterial regulatory proteins, deoR family. Length = 157 Score = 39.5 bits (93), Expect = 7e-04 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Query: 6 MKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTEN 60 KR A++A + DG T+ + G+T +E LA + + VI +S N Sbjct: 3 EKRRIAKKAASLIEDGDTIFLDAGTTVEE----LARALLGHINLTVITNSLPIAN 53 >gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual group of GRKs and is expressed in retinal cells. It phosphorylates rhodopsin in rod cells, which leads to termination of the phototransduction cascade. Mutations in GRK1 are associated to a recessively inherited form of stationary nightblindness called Oguchi disease. Length = 280 Score = 33.7 bits (77), Expect = 0.049 Identities = 14/27 (51%), Positives = 20/27 (74%) Query: 91 RLRLIKGYGGALLREKIIAHAASRFIV 117 RL+ KGY GA++ ++I+A SRFIV Sbjct: 30 RLKKRKGYEGAMVEKRILAKVHSRFIV 56 >gnl|CDD|30932 COG0587, DnaE, DNA polymerase III, alpha subunit [DNA replication, recombination, and repair]. Length = 1139 Score = 31.8 bits (72), Expect = 0.18 Identities = 25/119 (21%), Positives = 39/119 (32%), Gaps = 9/119 (7%) Query: 62 CKIHHIPLHSPE-DVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGD 120 + I + P+ + S D +++ I L IKG G + E + A F + D Sbjct: 794 ARRMGIEVLPPDINRSGWDFTVEEKKAIRLGLGAIKGVGEDAIEEIVEARKEKPFKSLED 853 Query: 121 ESKRVDFLGRGMLPIE-------IDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLF 172 R+D G +E D FG N+ L + LF Sbjct: 854 FCDRIDRKGLNKRVLESLIKAGAFDSFGKNR-AQLLAALDDLLDAASGTAKNSGQLSLF 911 >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of G protein signaling) homology (RH) domain and several motifs. The C-terminus diverges among different groups of GRKs. There are seven types of GRKs, named GRK1 to GRK7. They are subdivided into three main groups: visual (GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is widespread while GRK1/4/7 show a limited tissue distribution. The substrate spectrum of the widely expressed GRKs partially overlaps. GRKs play important roles in the cardiovascular, immune, respiratory, skeletal, and nervous systems. Length = 277 Score = 31.3 bits (71), Expect = 0.24 Identities = 13/27 (48%), Positives = 17/27 (62%) Query: 91 RLRLIKGYGGALLREKIIAHAASRFIV 117 RL+ KG AL +KI+ +SRFIV Sbjct: 30 RLKKRKGEQMALNEKKILEKVSSRFIV 56 >gnl|CDD|31540 COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism]. Length = 253 Score = 31.0 bits (70), Expect = 0.28 Identities = 15/59 (25%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Query: 7 KRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIH 65 KR A+ A + DG T+ + G+T + LA + + + VI +S N Sbjct: 78 KRAIAKAAATLIEDGDTIFLDAGTT----TLALARALPDDNNLTVITNSLNIAAALLEK 132 >gnl|CDD|30998 COG0653, SecA, Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]. Length = 822 Score = 29.0 bits (65), Expect = 1.0 Identities = 31/117 (26%), Positives = 44/117 (37%), Gaps = 18/117 (15%) Query: 86 DEIDS------RLRLI---KGYGGALLREKIIA----HAASRFIVIGDESKRVDFLGRGM 132 DE+DS R LI + L +K+ + I ++SK V G+ Sbjct: 207 DEVDSILIDEARTPLIISGPAEDSSELYKKVDDLVRLLSEDEDFTIDEKSKNVSLTESGL 266 Query: 133 LPIEIDQFGVNKTLSALKEVASCFGLNEELRLR---RNGSGLFVSDGGNYIVDAFFG 186 E + G+ + L L+ V LN+ LR V DG IVD F G Sbjct: 267 EKAE-ELLGI-ENLYDLENVNLVHHLNQALRAHILFFRDVDYIVRDGEVVIVDEFTG 321 >gnl|CDD|145796 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389. Length = 176 Score = 27.8 bits (63), Expect = 2.8 Identities = 10/58 (17%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Query: 19 VDGMTLG-MGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDV 75 + G T+G +G G + + F ++VI R + + S +++ Sbjct: 34 LSGKTVGIIGLGRIGRAVA-----RRLKAFGMKVIAYDRYPKAEAEALGARYVSLDEL 86 >gnl|CDD|30828 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]. Length = 697 Score = 27.5 bits (61), Expect = 3.0 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Query: 116 IVIGDESKRVDFLGRGM-LPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLF 172 VIGD + R RG L +E G + A +A FG +LR G F Sbjct: 617 DVIGDLNSR-----RGQILGMEQRPGGGLDVIKAEVPLAEMFGYATDLRSATQGRASF 669 >gnl|CDD|143857 pfam00075, RnaseH, RNase H. RNase H digests the RNA strand of an RNA/DNA hybrid. Important enzyme in retroviral replication cycle, and often found as a domain associated with reverse transcriptases. Structure is a mixed alpha+beta fold with three a/b/a layers. Length = 126 Score = 27.2 bits (61), Expect = 4.0 Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 13/56 (23%) Query: 16 QYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHS 71 QYV+ G+ G T S +K + + + V I +P HS Sbjct: 67 QYVIGGILNGWPTKSESKPIKNEIWELLLKKHAVY-------------IQWVPGHS 109 >gnl|CDD|145337 pfam02128, Peptidase_M36, Fungalysin metallopeptidase (M36). Length = 368 Score = 26.9 bits (60), Expect = 4.6 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 9/39 (23%) Query: 13 RAIQYVVDGMTL-----GMGTGSTAKEFMILLADKIANG 46 A++ V+DGM L G A IL ADK G Sbjct: 313 LAMKLVMDGMKLQPCNPGFVDARDA----ILDADKALTG 347 >gnl|CDD|35482 KOG0261, KOG0261, KOG0261, RNA polymerase III, large subunit [Transcription]. Length = 1386 Score = 26.8 bits (59), Expect = 5.5 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 11/73 (15%) Query: 123 KRVDFLGRGMLP----IEIDQFGV----NKTLSALKEVASCFGLNEELRLRRNGSGLFVS 174 KRVDF GR ++ + ID+ GV K L+ E + + + +L RNG V Sbjct: 357 KRVDFSGRTVISPDPNLRIDEVGVPIRVAKILT-FPERVTRANIRKLRQLVRNGPN--VH 413 Query: 175 DGGNYIVDAFFGF 187 G NY+V GF Sbjct: 414 PGANYVVQRGEGF 426 >gnl|CDD|143499 cd06826, PLPDE_III_AR2, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme, Alanine Racemase 2. This subfamily is composed of bacterial alanine racemases (EC 5.1.1.1) with similarity to Yersinia pestis and Vibrio cholerae alanine racemase (AR) 2. ARs catalyze the interconversion between L- and D-alanine, an essential component of the peptidoglycan layer of bacterial cell walls. These proteins are similar to other bacterial ARs and are fold type III PLP-dependent enzymes containing contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Length = 365 Score = 26.5 bits (59), Expect = 5.7 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 5/66 (7%) Query: 63 KIHHIPLHSP-EDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDE 121 KI I H P ED V + F+E LI L REKI HAA+ F + Sbjct: 156 KIVGIMTHFPVEDEDDVRAKLARFNE--DTAWLISN--AKLKREKITLHAANSFATLNVP 211 Query: 122 SKRVDF 127 +D Sbjct: 212 EAHLDM 217 >gnl|CDD|48068 cd00316, Oxidoreductase_nitrogenase, The nitrogenase enzyme system catalyzes the ATP-dependent reduction of dinitrogen to ammonia. This group contains both alpha and beta subunits of component 1 of the three known genetically distinct types of nitrogenase systems: a molybdenum-dependent nitrogenase (Mo-nitrogenase), a vanadium-dependent nitrogenase (V-nitrogenase), and an iron-only nitrogenase (Fe-nitrogenase) and, both subunits of Protochlorophyllide (Pchlide) reductase and chlorophyllide (chlide) reductase. The nitrogenase systems consist of component 1 (MoFe protein, VFe protein or, FeFe protein respectively) and, component 2 (Fe protein). The most widespread and best characterized nitrogenase is the Mo-nitrogenase. MoFe is an alpha2beta2 tetramer, the alternative nitrogenases are alpha2beta2delta2 hexamers whose alpha and beta subunits are similar to the alpha and beta subunits of MoFe. For MoFe, each alphabeta pair contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha subunit. The Fe protein contains a single [4Fe-4S] cluster from which, electrons are transferred to the P-cluster of the MoFe and in turn, to FeMoCo at the site of substrate reduction. The V-nitrogenase requires an iron-vanadium cofactor (FeVco), the iron only-nitrogenase an iron only cofactor (FeFeco). These cofactors are analogous to the FeMoco. The V-nitrogenase has P clusters identical to those of MoFe. Pchlide reductase and chlide reductase participate in the Mg-branch of the tetrapyrrole biosynthetic pathway. Pchlide reductase catalyzes the reduction of the D-ring of Pchlide during the synthesis of chlorophylls (Chl) and bacteriochlorophylls (BChl). Chlide-a reductase catalyzes the reduction of the B-ring of Chlide-a during the synthesis of BChl-a. The Pchlide reductase NB complex is a an N2B2 heterotetramer resembling nitrogenase FeMo, N and B proteins are homologous to the FeMo alpha and beta subunits respectively. The NB complex may serve as a catalytic site for Pchlide reduction and, the ZY complex as a site of chlide reduction, similar to MoFe for nitrogen reduction.. Length = 399 Score = 26.4 bits (58), Expect = 6.4 Identities = 30/161 (18%), Positives = 55/161 (34%), Gaps = 22/161 (13%) Query: 23 TLGMGTGSTAKEFMILLADKI----ANGFRVQVIPSSRNT-----ENFCKIHHIPLHSPE 73 +G + AKE + + GFR ++ P Sbjct: 94 LIGDDIEAVAKEASKEIGIPVVPASTPGFRGSQSAGYDAAVKAIIDHLVGTAEPEETEPG 153 Query: 74 DVSSVDLSIDGFDEIDSRLRLIKGYG---------GALLREKIIAHAASRFIVIGDESKR 124 V+ + G ++ RL++ G G + E A +V+ ES Sbjct: 154 SVNLIGGYNLGGGDLRELKRLLEEMGIRVNALFDGGTTVEELRELGNAKLNLVLCRESGL 213 Query: 125 --VDFLGR--GMLPIEIDQFGVNKTLSALKEVASCFGLNEE 161 +L G+ I I+ G+ T + L+++A FG+ +E Sbjct: 214 YLARYLEEKYGIPYILINPIGLEATDAFLRKLAELFGIEKE 254 >gnl|CDD|31618 COG1429, CobN, Cobalamin biosynthesis protein CobN and related Mg-chelatases [Coenzyme metabolism]. Length = 1388 Score = 26.5 bits (58), Expect = 6.6 Identities = 19/70 (27%), Positives = 24/70 (34%), Gaps = 14/70 (20%) Query: 110 HAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGS 169 A R DE +++ V K ALKE GLNEE R + Sbjct: 967 DEAVRLAAALDEPPEMNY--------------VRKHSLALKEELLERGLNEEGAERLALT 1012 Query: 170 GLFVSDGGNY 179 +F G Y Sbjct: 1013 RIFGPPPGTY 1022 >gnl|CDD|147488 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3. This family consists of several eukaryotic proteins which are homologous to the yeast RRN3 protein. RRN3 is one of the RRN genes specifically required for the transcription of rDNA by RNA polymerase I (Pol I) in Saccharomyces cerevisiae. Length = 550 Score = 26.5 bits (59), Expect = 6.6 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Query: 152 VASCFGL---NEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDP 191 + C+ + N+ RL R G N +DA+F F DP Sbjct: 486 LVYCYSIIERNKRERLSRVFGGSSRDRESNQQLDAYFPF--DP 526 >gnl|CDD|36204 KOG0986, KOG0986, KOG0986, G protein-coupled receptor kinase [Signal transduction mechanisms]. Length = 591 Score = 26.4 bits (58), Expect = 7.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 91 RLRLIKGYGGALLREKIIAHAASRFIV 117 R++ KG AL ++I+ +S FIV Sbjct: 222 RIKKRKGETMALNEKQILEKVSSPFIV 248 >gnl|CDD|30953 COG0608, RecJ, Single-stranded DNA-specific exonuclease [DNA replication, recombination, and repair]. Length = 491 Score = 26.2 bits (57), Expect = 7.7 Identities = 14/73 (19%), Positives = 25/73 (34%), Gaps = 10/73 (13%) Query: 17 YVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVS 76 Y DG+T + + + L G V +R E + I + + + Sbjct: 45 YDADGITSA----AILAKALRRL------GADVDYYIPNRFEEGYGAIRKLKEEGADLII 94 Query: 77 SVDLSIDGFDEID 89 +VD +EI Sbjct: 95 TVDNGSGSLEEIA 107 >gnl|CDD|145132 pfam01808, AICARFT_IMPCHas, AICARFT/IMPCHase bienzyme. This is a family of bifunctional enzymes catalysing the last two steps in de novo purine biosynthesis. The bifunctional enzyme is found in both prokaryotes and eukaryotes. The second last step is catalysed by 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase EC:2.1.2.3 (AICARFT), this enzyme catalyses the formylation of AICAR with 10-formyl-tetrahydrofolate to yield FAICAR and tetrahydrofolate. The last step is catalysed by IMP (Inosine monophosphate) cyclohydrolase EC:3.5.4.10 (IMPCHase), cyclizing FAICAR (5-formylaminoimidazole-4-carboxamide ribonucleotide) to IMP. Length = 315 Score = 25.9 bits (57), Expect = 9.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 14 AIQYVVDGMTLGMGTG 29 AI Y +GMT+G+G G Sbjct: 285 AIVYAKNGMTVGIGAG 300 >gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis]. Length = 721 Score = 26.0 bits (57), Expect = 9.6 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Query: 116 IVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLF 172 VIGD +KR ID KT+ A + FG + ELR G G F Sbjct: 649 TVIGDLNKR------KAQITGIDSSEDYKTIKAEVPLNEMFGYSSELRSLTQGKGEF 699 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.142 0.415 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,889,432 Number of extensions: 159829 Number of successful extensions: 396 Number of sequences better than 10.0: 1 Number of HSP's gapped: 390 Number of HSP's successfully gapped: 29 Length of query: 231 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 140 Effective length of database: 4,297,318 Effective search space: 601624520 Effective search space used: 601624520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.3 bits)