BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781054|ref|YP_003065467.1| ribose-5-phosphate isomerase A [Candidatus Liberibacter asiaticus str. psy62] (231 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781054|ref|YP_003065467.1| ribose-5-phosphate isomerase A [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Score = 468 bits (1204), Expect = e-134, Method: Compositional matrix adjust. Identities = 231/231 (100%), Positives = 231/231 (100%) Query: 1 MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTEN 60 MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTEN Sbjct: 1 MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTEN 60 Query: 61 FCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGD 120 FCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGD Sbjct: 61 FCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGD 120 Query: 121 ESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYI 180 ESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYI Sbjct: 121 ESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYI 180 Query: 181 VDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK 231 VDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK Sbjct: 181 VDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK 231 >537021.9.peg.753_1 Length = 1033 Score = 28.5 bits (62), Expect = 0.092, Method: Compositional matrix adjust. Identities = 30/112 (26%), Positives = 43/112 (38%), Gaps = 23/112 (20%) Query: 15 IQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPED 74 ++++ MTL M K+F + A F +Q++P S NT Sbjct: 785 VEFLAASMTLEMDNVEKIKKFC-----QDARQFNIQIMPPSVNT---------------- 823 Query: 75 VSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVD 126 VD + G + I L IKG G R + A A F + D RVD Sbjct: 824 -PCVDFKV-GDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVD 873 >gi|254780664|ref|YP_003065077.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 536 Score = 27.3 bits (59), Expect = 0.24, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 3 ALQMKRNAARRAIQYVVDGMTLGMGTGSTAK 33 A ++ ++ A+ Y DG T+G+G+G T++ Sbjct: 421 AFKVVKHVKSNAVVYAKDGRTVGIGSGQTSR 451 >gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Score = 24.6 bits (52), Expect = 1.5, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 61 FCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGA 101 F +IH L +PE+++ V L + G D R K GG+ Sbjct: 420 FLRIHRAGLCAPEEITPVSL-VSGRDRFRDDSRAFKVGGGS 459 >gi|254780659|ref|YP_003065072.1| hypothetical protein CLIBASIA_02730 [Candidatus Liberibacter asiaticus str. psy62] Length = 274 Score = 23.9 bits (50), Expect = 2.9, Method: Compositional matrix adjust. Identities = 14/51 (27%), Positives = 26/51 (50%) Query: 132 MLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVD 182 MLP I F ++ ++ + A FG+ E++ +G+ V GN++ D Sbjct: 21 MLPRLIRDFQLDFVIANGENSAGGFGITEKIFCEMMETGIDVITTGNHVWD 71 >gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Score = 23.5 bits (49), Expect = 3.7, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 13/16 (81%) Query: 40 ADKIANGFRVQVIPSS 55 ++K+ NGFRV+ P+S Sbjct: 69 SNKLKNGFRVECKPTS 84 >gi|254780754|ref|YP_003065167.1| inorganic polyphosphate/ATP-NAD kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 23.1 bits (48), Expect = 4.6, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 4 LQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMIL 38 L++K + R + V DG+ + GSTA F L Sbjct: 137 LEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSAL 171 >gi|254780788|ref|YP_003065201.1| transcription elongation factor NusA [Candidatus Liberibacter asiaticus str. psy62] Length = 526 Score = 23.1 bits (48), Expect = 4.9, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 149 LKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGV 204 + E+AS G +EE + G +G + + + +S ELC+IPG+ Sbjct: 392 ISEIASIEGFDEETAVEIQGRAREYLEGIDITLQKKIRELG----VSEELCSIPGI 443 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 21.9 bits (45), Expect = 8.8, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Query: 125 VDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGS 169 ++ LG +P+ D+FGV + S +E+A R+ RN S Sbjct: 618 IEVLGLQGMPMAGDKFGVVDSESRAREIAQY-----RQRVTRNKS 657 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.142 0.415 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 154,081 Number of Sequences: 1233 Number of extensions: 6820 Number of successful extensions: 18 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 11 length of query: 231 length of database: 328,796 effective HSP length: 71 effective length of query: 160 effective length of database: 241,253 effective search space: 38600480 effective search space used: 38600480 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)