HHsearch alignment for GI: 254781055 and conserved domain: PRK05868

>PRK05868 hypothetical protein; Validated.
Probab=98.00  E-value=2.2e-06  Score=65.73  Aligned_cols=57  Identities=14%  Similarity=0.200  Sum_probs=46.6

Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCCCCEEEEECCCCCCCCCCEECCCCEEEECCC
Q ss_conf             2222222222332332200011024457610243127532222100001522200126
Q gi|254781055|r  213 QGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGI  270 (461)
Q Consensus       213 ~~~~~~l~~~Gv~i~~~~~v~~i~~~~~~~~~~~~~g~~~~~D~vl~a~Gr~Pn~~~l  270 (461)
T Consensus       109 ~~L~~a~-~~~v~~~~g~~v~~i~~~~~~V~V~f~dg~~~~~DlVIGADGi~S~VR~~  165 (372)
T PRK05868        109 ELLYGAT-QPTVEYLFDDSISTLQDDGAAVRVTFERAAAREFDLVIGADGLHSNVRRL  165 (372)
T ss_pred             HHHHHHC-CCCEEEEECCEEEEEEECCCEEEEEEECCCEEEEEEEEECCCCCHHHHHH
T ss_conf             9998634-58809995788899996499799999079857865899747874177887