HHsearch alignment for GI: 254781055 and conserved domain: PRK07494

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional.
Probab=98.72  E-value=7.3e-08  Score=76.62  Aligned_cols=55  Identities=20%  Similarity=0.187  Sum_probs=40.2

Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCCEEEEECCCCCCCCCCEECCCCEEEEC
Q ss_conf             2222222223323322000110244576102431275322221000015222001
Q gi|254781055|r  214 GLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTT  268 (461)
Q Consensus       214 ~~~~~l~~~Gv~i~~~~~v~~i~~~~~~~~~~~~~g~~~~~D~vl~a~Gr~Pn~~  268 (461)
T Consensus       114 ~L~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~dg~~i~a~llIgADG~~S~vR  168 (386)
T PRK07494        114 ALEARAAELPNIDRFDDEAESVRPRGDEVTVTLADGTTLSARLVVAADGRNSPAR  168 (386)
T ss_pred             HHHHHHHHCCCEEEECCCEEEEEECCCEEEEEECCCCEEEEEEEEEECCCCCCCC
T ss_conf             9999997189979977706899966984899978996999869999058887431