HHsearch alignment for GI: 254781055 and conserved domain: PRK07845

>PRK07845 flavoprotein disulfide reductase; Reviewed.
Probab=97.60  E-value=0.00057  Score=48.06  Aligned_cols=95  Identities=20%  Similarity=0.345  Sum_probs=58.9

Q ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC-CCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCCCCCCHHHHH
Q ss_conf             68998898679999999998899299997787-86146435682708899999999999841017736377544999999
Q gi|254781055|r    6 DLVVIGAGSSGVRSARLAAQLGKKVAICEEYR-VGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLI   84 (461)
Q Consensus         6 DvvIIG~GpaG~~aA~~la~~g~kV~liE~~~-~GGtC~~~GCiPsK~l~~~a~~~~~~~~~~~~g~~~~~~~~d~~~~~   84 (461)
T Consensus       180 ~l~ViGgG~ig~E~A~~~~~lG~~Vtlv~~~~~~------------------------L------------~~~d~-~~~  222 (467)
T PRK07845        180 HLIVVGSGVTGAEFASAYTELGVKVTLVSSRDRV------------------------L------------PGEDA-DAA  222 (467)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEEECCCC------------------------C------------CCCCH-HHH
T ss_conf             6999898799999999999739879999955744------------------------5------------43188-899


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEECCCCC--CC-CCCCCCCCC-CCCCCEEEEEEEECCCCCEEEEE
Q ss_conf             999999985546688643003320012233--22-222222222-32211001112322776402332
Q gi|254781055|r   85 TAQNKELSRLESFYHNRLESAGVEIFASKG--IL-SSPHSVYIA-NLNRTITSRYIVVSTGGSPNRMD  148 (461)
Q Consensus        85 ~~~~~~~~~l~~~~~~~l~~~gv~vi~g~a--~~-~~~~~v~V~-~~~~~i~a~~iiIATGs~p~~p~  148 (461)
T Consensus       223 ~-----------~~~~~l~~~gv~i~~~~~~~~v~~~~~~~~v~~~~g~~i~~d~vl~a~Gr~Pn~~~  279 (467)
T PRK07845        223 A-----------VLEEVFARRGMTLLKRSRAESVTRTGDGVLVTLTDGRTVEGSHALMAVGSVPNTAG  279 (467)
T ss_pred             H-----------HHHHHHHHCCEEEECCCEEEEEEECCCEEEEEECCCCEEEEEEEEEECCCCCCCCC
T ss_conf             9-----------99999997690997288799999809826999889979987799995450255255