HHsearch alignment for GI: 254781055 and conserved domain: TIGR02731

>TIGR02731 phytoene_desat phytoene desaturase; InterPro: IPR014102 Plants and cyanobacteria (and, supposedly, Chlorobium tepidum) have a conserved pathway from two molecules geranylgeranyl-PP to one of all-trans-lycopene. Members of this family are the enzyme phytoene desaturase (also called phytoene dehydrogenase). This HMM does not include plant chloroplast transit peptides and the entry does not contain zeta-carotene desaturase, which is a closely related family in the same pathway..
Probab=94.31  E-value=0.072  Score=32.61  Aligned_cols=234  Identities=21%  Similarity=0.260  Sum_probs=104.4

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCC-CCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECC-CCCCCHHHHH
Q ss_conf             8998898679999999998899299997787-8614643568270889999999999984101773637-7544999999
Q gi|254781055|r    7 LVVIGAGSSGVRSARLAAQLGKKVAICEEYR-VGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVD-HKSFDWQSLI   84 (461)
Q Consensus         7 vvIIG~GpaG~~aA~~la~~g~kV~liE~~~-~GGtC~~~GCiPsK~l~~~a~~~~~~~~~~~~g~~~~-~~~~d~~~~~   84 (461)
T Consensus         2 v~~aGaGlaGl~~akyl~daGh~Pi~~e~~~vlGG~vaaW~d~d-------GdW~et-------Glh~ffGayPn~~~l~   67 (454)
T TIGR02731         2 VAIAGAGLAGLSCAKYLADAGHTPIVLEARDVLGGKVAAWKDED-------GDWYET-------GLHIFFGAYPNILQLL   67 (454)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEECHHHCCCCEEEEECCC-------CCCHHH-------HHHHHHCCCHHHHHHH
T ss_conf             57722745567788787635896268632100355023322478-------861131-------0455431457899999


Q ss_pred             HHHHHHHHHHHHHHHHHH----CCCCEEECCCCCCCCCCCCC--CCCCCCCCEE-EEEEEECCCCCEEEEEECCCCCC--
Q ss_conf             999999985546688643----00332001223322222222--2223221100-11123227764023320376221--
Q gi|254781055|r   85 TAQNKELSRLESFYHNRL----ESAGVEIFASKGILSSPHSV--YIANLNRTIT-SRYIVVSTGGSPNRMDFKGSDLC--  155 (461)
Q Consensus        85 ~~~~~~~~~l~~~~~~~l----~~~gv~vi~g~a~~~~~~~v--~V~~~~~~i~-a~~iiIATGs~p~~p~i~g~~~~--  155 (461)
T Consensus        68 ~e-l~i~drlqWk~h~~if~~~~~PG~~s~f~~P~~P~P~n~~~~il~nn~ml~W~~k~~fa~Gl~~~~~--~Gq~yve~  144 (454)
T TIGR02731        68 KE-LNIEDRLQWKEHSLIFNQPDKPGTLSRFDFPDIPAPVNGVAAILRNNDMLTWEEKIKFAIGLLPAIV--RGQKYVEE  144 (454)
T ss_pred             HH-CCCHHHHHHHHHEEEEECCCCCCCCEECCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH--CCHHHHHH
T ss_conf             86-1502222221100134046888740010477877518999998722421223666666753468874--22056776


Q ss_pred             ---CCCCCCCCCCCCCCCC------------CCCCCCCCCCHH-HHHHHC-----CCCCCCEECCCCCCCCCCCCCCCCC
Q ss_conf             ---1237851123333443------------212345453011-244210-----1221000001111222222321222
Q gi|254781055|r  156 ---ITSDEIFSLKSLPQST------------LIIGGGYIAVEF-AGILNS-----LGSKTTLVTRGNSILSKFDSDIRQG  214 (461)
Q Consensus       156 ---~ts~~~~~l~~~P~~i------------~IiGgG~ig~E~-A~~~~~-----lG~~Vtli~~~~~~l~~~d~~~~~~  214 (461)
T Consensus       145 ~d~~~~~~Wl~~~~~~~rv~~~vf~a~~kal~f~~Pde~s~~~~l~alnrfl~e~~Gsk~afldG~P------~erlC~P  218 (454)
T TIGR02731       145 QDKYTVSEWLKKQGVPERVNDEVFIAMSKALNFINPDEVSATVVLTALNRFLQERYGSKIAFLDGAP------PERLCQP  218 (454)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC------HHHHHHH
T ss_conf             5314489898743711344567888788774015702567889999999987430477167626888------0455578


Q ss_pred             CCCCCCCCCCCCCCCCEEEECC-CCCCCCEEE-EE--CC---CCCCCCCCEECCCC
Q ss_conf             2222222233233220001102-445761024-31--27---53222210000152
Q gi|254781055|r  215 LTDVMISRGMQVFHNDTIESVV-SESGQLKSI-LK--SG---KIVKTDQVILAVGR  263 (461)
Q Consensus       215 ~~~~l~~~Gv~i~~~~~v~~i~-~~~~~~~~~-~~--~g---~~~~~D~vl~a~Gr  263 (461)
T Consensus       219 ~v~~~~~~GGe~~~~~~l~~i~l~~d~~v~~f~~~~~~g~~~~~~~~d~y~~a~~v  274 (454)
T TIGR02731       219 IVDYITSRGGEVRLNARLKEIVLNEDGSVKAFALADGEGKDSFEVTADAYVSALPV  274 (454)
T ss_pred             HHHHHHHCCCEEEECCCEEEEEECCCCCEEHEEEECCCCCCCCEEECCCEEEHHHH
T ss_conf             99999724881664131001343577621000220445642001110100111125