254781056

254781056

phage-related lysozyme

GeneID in NCBI database:8210079Locus tag:CLIBASIA_04790
Protein GI in NCBI database:254781056Protein Accession:YP_003065469.1
Gene range:+(1061333, 1061848)Protein Length:171aa
Gene description:phage-related lysozyme
COG prediction:[R] Phage-related lysozyme (muraminidase)
KEGG prediction:phage-related lysozyme; K01185 lysozyme [EC:3.2.1.17]
SEED prediction:prophage LambdaMc01, lysozyme( EC:3.2.1.17 )
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
cHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccEccccccccccEEEEEccccccccccccEccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHEEEEEEEccccccccHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcc
MCIINRIISFVKRMigmngddkhnkipvPNALIKMLKEFEGLRLTAYrdigggawtigyghtgsdvtegmtITEKEAEDFLLKDASKSLNLLLesspalkstseNRLVAVADFVFNlgignynkstfkQRVDAQDWEKAAEECKKWTKaggkvlpglvKRRDAEVKLLLES
MCIINRIISFVKRmigmngddkhnkIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSpalkstsenRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKwtkaggkvlpglvkrrdaevkllles
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
*CIINRIISFVKRMIGMNGDD****IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
254781058102 phage-related lysozyme [Candidatus Liberibacter as 1e-39
25478105743 hypothetical protein CLIBASIA_04795 [Candidatus Li 3e-10
>gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Back     alignment 
 Score =  154 bits (388), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%)

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129
           MTIT KEAED LL D    L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ
Sbjct: 1   MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60

Query: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           RVDAQDWEKAAEECKKWTKAGG+ L G+  RR     +LL
Sbjct: 61  RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100
>gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Back     alignment 
 Score = 56.2 bits (134), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 6/48 (12%)

Query: 17 MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS 64
          MNG  K     + NALI++ K +EGL+LTAYRD  GG WTIGYGH+GS
Sbjct: 1  MNGSSK-----ILNALIEITKRYEGLKLTAYRDP-GGTWTIGYGHSGS 42

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
315121922149 phage-related lysozyme [Candidatus Liberibacter solanac 1 4e-37
254781058102 phage-related lysozyme [Candidatus Liberibacter asiatic 1 5e-36
315122498146 phage-related lysozyme [Candidatus Liberibacter solanac 1 3e-35
315122565133 phage-related lysozyme [Candidatus Liberibacter solanac 1 8e-32
152982881174 phage-related lysozyme [Janthinobacterium sp. Marseille 1 2e-27
161525479154 glycoside hydrolase family protein [Burkholderia multiv 1 3e-27
17545602153 lysozyme (endolysin) protein [Ralstonia solanacearum GM 1 8e-27
152983117171 phage-related lysozyme [Janthinobacterium sp. Marseille 1 2e-26
53803105152 prophage LambdaMc01, lysozyme [Methylococcus capsulatus 1 2e-26
300697169153 lysozyme (endolysin) protein [Ralstonia solanacearum CF 1 3e-26
>gi|315121922|ref|YP_004062411.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 149 Back     alignment and organism information
 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/144 (55%), Positives = 98/144 (68%), Gaps = 1/144 (0%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +P+ LI ++K FEGLRL AYR    G WTIGYGHTG+DV E + ITEK+A D L  D SK
Sbjct: 1   MPHLLIDLVKGFEGLRLKAYR-CSAGIWTIGYGHTGNDVFENLAITEKQANDLLKWDVSK 59

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            L+ +   SP L +  ENR+ A+ DFVFNLGIG Y  ST ++RVD +DW  A+ E  KW 
Sbjct: 60  CLSQVFTVSPILINAGENRISAIGDFVFNLGIGRYRNSTLRKRVDREDWINASHEICKWV 119

Query: 148 KAGGKVLPGLVKRRDAEVKLLLES 171
            AGGK L GLV RR+ E  LLL+S
Sbjct: 120 FAGGKKLKGLVIRREIEADLLLKS 143



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Back     alignment and organism information
>gi|315122498|ref|YP_004062987.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 146 Back     alignment and organism information
>gi|315122565|ref|YP_004063054.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 133 Back     alignment and organism information
>gi|152982881|ref|YP_001354478.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 174 Back     alignment and organism information
>gi|161525479|ref|YP_001580491.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC 17616] Length = 154 Back     alignment and organism information
>gi|17545602|ref|NP_519004.1| lysozyme (endolysin) protein [Ralstonia solanacearum GMI1000] Length = 153 Back     alignment and organism information
>gi|152983117|ref|YP_001354418.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 171 Back     alignment and organism information
>gi|53803105|ref|YP_115084.1| prophage LambdaMc01, lysozyme [Methylococcus capsulatus str. Bath] Length = 152 Back     alignment and organism information
>gi|300697169|ref|YP_003747830.1| lysozyme (endolysin) protein [Ralstonia solanacearum CFBP2957] Length = 153 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
COG3772152 COG3772, COG3772, Phage-related lysozyme (muraminidase) 3e-30
pfam00959108 pfam00959, Phage_lysozyme, Phage lysozyme 4e-16
PHA02596 576 PHA02596, 5, baseplate hub subunit and tail lysozyme; P 7e-07
cd00735164 cd00735, bacteriophage_T4-like_lysozyme, Bacteriophage 1e-05
cd00737133 cd00737, endolysin_autolysin, Endolysins and autolysins 5e-33
>gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|144526 pfam00959, Phage_lysozyme, Phage lysozyme Back     alignment and domain information
>gnl|CDD|177423 PHA02596, 5, baseplate hub subunit and tail lysozyme; Provisional Back     alignment and domain information
>gnl|CDD|29559 cd00735, bacteriophage_T4-like_lysozyme, Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls Back     alignment and domain information
>gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 171 phage-related lysozyme [Candidatus Liberibacter asiatic
cd00737133 endolysin_autolysin Endolysins and autolysins are found 100.0
COG3772152 Phage-related lysozyme (muraminidase) [General function 100.0
cd00735164 bacteriophage_T4-like_lysozyme Bacteriophage T4-like ly 99.93
pfam00959108 Phage_lysozyme Phage lysozyme. This family includes lam 100.0
cd00442105 lysozyme_like lysozyme_like domain. This contains sever 95.89
>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information
>COG3772 Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>cd00735 bacteriophage_T4-like_lysozyme Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls Back     alignment and domain information
>pfam00959 Phage_lysozyme Phage lysozyme Back     alignment and domain information
>cd00442 lysozyme_like lysozyme_like domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
3hde_A165 Crystal Structure Of Full-Length Endolysin R21 From 5e-30
3hdf_A140 Crystal Structure Of Truncated Endolysin R21 From P 1e-29
2anv_A146 Crystal Structure Of P22 Lysozyme Mutant L86m Lengt 3e-27
1xju_A163 Crystal Structure Of Secreted Inactive Form Of P1 P 3e-21
3oe0_A499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 8e-09
2z6b_A 584 Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugate 9e-09
1wth_A 584 Crystal Structure Of Gp5-S351l Mutant And Gp27 Comp 9e-09
1pdl_A 575 Fitting Of Gp5 In The Cryoem Reconstruction Of The 9e-09
1k28_A 584 The Structure Of The Bacteriophage T4 Cell-Puncturi 9e-09
1p37_A164 T4 Lysozyme Core Repacking Back-Revertant L102mCORE 3e-08
1pqi_A164 T4 Lysozyme Core Repacking Mutant I118lCORE7TA Leng 4e-08
1p3n_A164 Core Redesign Back-Revertant I103vCORE10 Length = 1 5e-08
1pqk_A164 Repacking Of The Core Of T4 Lysozyme By Automated D 5e-08
3oe6_A 508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 6e-08
176l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 6e-08
3odu_A502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 6e-08
239l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 6e-08
1pqd_A164 T4 Lysozyme Core Repacking Mutant Core10TA Length = 7e-08
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 7e-08
235l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 8e-08
1l70_A164 Multiple Stabilizing Alanine Replacements Within Al 8e-08
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 9e-08
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 9e-08
1dya_A164 Determination Of Alpha-Helix Propensity Within The 9e-08
1l55_A164 Analysis Of The Interaction Between Charged Side Ch 9e-08
1l21_A164 Contributions Of Left-Handed Helical Residues To Th 1e-07
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 1e-07
189l_A164 Enhancement Of Protein Stability By The Combination 1e-07
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 1e-07
1kni_A164 Stabilizing Disulfide Bridge Mutant Of T4 Lysozyme 1e-07
1l22_A164 Contributions Of Left-Handed Helical Residues To Th 1e-07
1b6i_A164 T4 Lysozyme Mutant With Cys 54 Replaced By Thr, Cys 1e-07
1cv5_A164 T4 Lysozyme Mutant L133m Length = 164 1e-07
1dyg_A164 Determination Of Alpha-Helix Propensity Within The 1e-07
213l_A165 Protein Structure Plasticity Exemplified By Inserti 1e-07
1p2r_A164 T4 Lysozyme Core Repacking Mutant I78vTA Length = 1 1e-07
232l_A164 T4 Lysozyme Mutant M120k Length = 164 1e-07
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 1e-07
1p64_A164 T4 Lysozyme Core Repacking Mutant L133fTA Length = 2e-07
230l_A164 T4 Lysozyme Mutant M6l Length = 164 2e-07
1cu3_A164 T4 Lysozyme Mutant V87m Length = 164 2e-07
2a4t_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (V131 2e-07
1jqu_A164 Are Carboxy Terminii Of Helices Coded By The Local 2e-07
1l33_A164 Contributions Of Left-Handed Helical Residues To Th 2e-07
1jtm_A178 Alternative Structures Of A Sequence Extended T4 Ly 2e-07
160l_A164 Control Of Enzyme Activity By An Engineered Disulfi 2e-07
1p46_A164 T4 Lysozyme Core Repacking Mutant M106iTA Length = 2e-07
1g0q_A164 Crystal Structure Of T4 Lysozyme Mutant V149i Lengt 2e-07
1pqm_A164 T4 Lysozyme Core Repacking Mutant V149iT152VTA Leng 2e-07
1tla_A164 Hydrophobic Core Repacking And Aromatic-Aromatic In 2e-07
163l_A164 Control Of Enzyme Activity By An Engineered Disulfi 2e-07
1kw7_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 2e-07
1d3f_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-07
3cdr_A164 R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K 2e-07
1l71_A164 Multiple Stabilizing Alanine Replacements Within Al 2e-07
1cv1_A164 T4 Lysozyme Mutant V111m Length = 164 2e-07
259l_A164 An Adaptable Metal-Binding Site Engineered Into T4 2e-07
233l_A164 T4 Lysozyme Mutant M120l Length = 164 2e-07
1p2l_A164 T4 Lysozyme Core Repacking Mutant V87iTA Length = 1 2e-07
123l_A164 The Energetic Cost And The Structural Consequences 2e-07
119l_A164 The Energetic Cost And The Structural Consequences 2e-07
120l_A164 The Energetic Cost And The Structural Consequences 2e-07
206l_A164 Phage T4 Lysozyme Length = 164 2e-07
1cup_A164 Methionine Core Mutant Of T4 Lysozyme Length = 164 2e-07
221l_A164 The Energetic Cost And The Structural Consequences 2e-07
1pqj_A164 T4 Lysozyme Core Repacking Mutant A111vCORE10TA Len 2e-07
1p6y_A164 T4 Lysozyme Core Repacking Mutant M120yTA Length = 2e-07
128l_A164 The Energetic Cost And The Structural Consequences 2e-07
1dye_A164 Determination Of Alpha-Helix Propensity Within The 2e-07
224l_A164 The Energetic Cost And The Structural Consequences 2e-07
1l61_A164 Analysis Of The Interaction Between Charged Side Ch 2e-07
1l64_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-07
2o79_A170 T4 Lysozyme With C-Terminal Extension Length = 170 2e-07
112l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
2q9d_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 2e-07
1zyt_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (A82r 2e-07
1qtb_A162 The Introduction Of Strain And Its Effects On The S 2e-07
1l95_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-07
1g1v_A164 T4 Lysozyme Mutant C54tC97AI58T Length = 164 2e-07
1l86_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-07
1c6p_A164 T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 AT 2e-07
1g0l_A164 Crystal Structure Of T4 Lysozyme Mutant T152v Lengt 2e-07
170l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-07
108l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
110l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
114l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
1l87_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-07
1g06_A164 Crystal Structure Of T4 Lysozyme Mutant V149s Lengt 2e-07
130l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-07
1g0j_A164 Crystal Structure Of T4 Lysozyme Mutant T152s Lengt 2e-07
1lwg_A164 Multiple Methionine Substitutions Are Tolerated In 3e-07
111l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
115l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
1l23_A164 Enhanced Protein Thermostability From Site-Directed 3e-07
126l_A164 The Energetic Cost And The Structural Consequences 3e-07
1g0m_A164 Crystal Structure Of T4 Lysozyme Mutant T152i Lengt 3e-07
1qug_A162 E108v Mutant Of T4 Lysozyme Length = 162 3e-07
1llh_A164 Are Carboxy Terminii Of Helices Coded By The Local 3e-07
238l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
137l_A164 Structural Basis Of Amino Acid Alpha Helix Propensi 3e-07
1cu2_A164 T4 Lysozyme Mutant L84m Length = 164 3e-07
1p36_A164 T4 Lyoszyme Core Repacking Mutant I100vTA Length = 3e-07
107l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
1l66_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
171l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-07
234l_A164 T4 Lysozyme Mutant M106l Length = 164 3e-07
166l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-07
1g0p_A164 Crystal Structure Of T4 Lysozyme Mutant V149g Lengt 3e-07
2l78_A164 Design And Structural Analysis Of Alternative Hydro 3e-07
122l_A164 The Energetic Cost And The Structural Consequences 3e-07
3g3w_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (T151 3e-07
172l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-07
217l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
109l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
1cu5_A164 T4 Lysozyme Mutant L91m Length = 164 3e-07
1l88_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
1c60_A164 T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 3e-07
149l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 3e-07
1epy_A164 T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 3e-07
129l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 3e-07
1l39_A164 Contributions Of Engineered Surface Salt Bridges To 3e-07
247l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1d2y_A164 N-Terminal Domain Core Methionine Mutation Length = 3e-07
1l67_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
1p56_A176 Duplication-Extension Of Helix A Of T4 Lysozyme Len 3e-07
1l68_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
237l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1cv6_A164 T4 Lysozyme Mutant V149m Length = 164 3e-07
242l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1l65_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
1l24_A164 Enhanced Protein Thermostability From Site-Directed 3e-07
1g0g_A164 Crystal Structure Of T4 Lysozyme Mutant T152a Lengt 3e-07
165l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-07
1pqo_A164 T4 Lysozyme Core Repacking Mutant L118iTA Length = 3e-07
1cv4_A164 T4 Lysozyme Mutant L118m Length = 164 3e-07
236l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1d3j_A164 N-Terminal Domain Core Methionine Mutation Length = 3e-07
244l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1l47_A164 Cumulative Site-Directed Charge-Change Replacements 3e-07
2hul_A164 Crystal Structure Of T4 Lysozyme S44c Synthetic Dim 3e-07
155l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-07
113l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
243l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1g07_A164 Crystal Structure Of T4 Lysozyme Mutant V149c Lengt 3e-07
1g0k_A164 Crystal Structure Of T4 Lysozyme Mutant T152c Lengt 3e-07
1l94_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
2igc_A164 Structure Of Spin Labeled T4 Lysozyme Mutant T115r1 3e-07
1l41_A164 Contributions Of Engineered Surface Salt Bridges To 3e-07
201l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 3e-07
1l92_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
212l_A168 Protein Structure Plasticity Exemplified By Inserti 3e-07
1p7s_A164 T4 Lysozyme Core Repacking Mutant V103iTA Length = 3e-07
1l97_A164 Structure Of A Hinge-Bending Bacteriophage T4 Lysoz 3e-07
102l_A165 How Amino-Acid Insertions Are Allowed In An Alpha-H 3e-07
1l93_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
1lyf_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 3e-07
2nth_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 4e-07
211l_A165 Protein Structure Plasticity Exemplified By Inserti 4e-07
161l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-07
1l16_A164 Structural Analysis Of The Temperature-Sensitive Mu 4e-07
3c7w_A164 Contributions Of All 20 Amino Acids At Site 96 To T 4e-07
1l17_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 4e-07
1l45_A164 Cumulative Site-Directed Charge-Change Replacements 4e-07
1l15_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l19_A164 Enhanced Protein Thermostability From Designed Muta 4e-07
1lyd_A164 Crystal Structure Of T4-Lysozyme Generated From Syn 4e-07
1l09_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
152l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 4e-07
2q9e_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 4e-07
2huk_A164 Crystal Structure Of T4 Lysozyme V131c Synthetic Di 4e-07
3hwl_A164 Crystal Structure Of T4 Lysozyme With The Unnatural 4e-07
1dyf_A164 Determination Of Alpha-Helix Propensity Within The 4e-07
1l14_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l52_A164 Structural And Thermodynamic Analysis Of The Packin 4e-07
1l10_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 4e-07
1l04_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1cuq_A164 T4 Lysozyme Mutant V103m Length = 164 4e-07
1dyc_A164 Determination Of Alpha-Helix Propensity Within The 4e-07
1i6s_A164 T4 Lysozyme Mutant C54tC97AN101A Length = 164 4e-07
3k2r_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 4e-07
1t6h_A164 Crystal Structure T4 Lysozyme Incorporating An Unna 4e-07
216l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 4e-07
1l91_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 4e-07
1l11_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1dyb_A164 Determination Of Alpha-Helix Propensity Within The 4e-07
1l12_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l07_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
2qb0_B241 Structure Of The 2tel Crystallization Module Fused 4e-07
1l0k_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 4e-07
159l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-07
1l57_A164 Analysis Of The Interaction Between Charged Side Ch 4e-07
3c80_A164 T4 Lysozyme Mutant R96y At Room Temperature Length 4e-07
1l08_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1cvk_A164 T4 Lysozyme Mutant L118a Length = 164 4e-07
1qsq_A164 Cavity Creating Mutation Length = 164 4e-07
162l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-07
138l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 4e-07
1l60_A164 Analysis Of The Interaction Between Charged Side Ch 4e-07
2hum_A164 Crystal Structure Of T4 Lysozyme D72c Synthetic Dim 4e-07
3fa0_A162 Evaulaution At Atomic Resolution Of The Role Of Str 4e-07
1kw5_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 4e-07
1l06_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l20_A164 Enhanced Protein Thermostability From Designed Muta 4e-07
1l46_A164 Cumulative Site-Directed Charge-Change Replacements 4e-07
1l79_A164 Design And Structural Analysis Of Alternative Hydro 4e-07
3c81_A164 Mutant K85a Of T4 Lysozyme In Wildtype Background A 4e-07
1cu0_A164 T4 Lysozyme Mutant I78m Length = 164 4e-07
1l18_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 4e-07
229l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 4e-07
1l56_A164 Analysis Of The Interaction Between Charged Side Ch 4e-07
1l02_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l98_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 4e-07
1l42_A164 Cumulative Site-Directed Charge-Change Replacements 4e-07
127l_A164 The Energetic Cost And The Structural Consequences 4e-07
1cv3_A164 T4 Lysozyme Mutant L121m Length = 164 5e-07
1ky1_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 5e-07
1l01_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 5e-07
1cx7_A164 T4 Lysozyme Methionine Core Mutant Length = 164 5e-07
1ky0_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 5e-07
1ctw_A164 T4 Lysozyme Mutant I78a Length = 164 5e-07
1l38_A164 Contributions Of Engineered Surface Salt Bridges To 5e-07
1l34_A164 High-Resolution Structure Of The Temperature-Sensit 5e-07
1l59_A164 Analysis Of The Interaction Between Charged Side Ch 5e-07
103l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 5e-07
1l53_A164 Structural And Thermodynamic Analysis Of The Packin 5e-07
1l99_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 5e-07
1l62_A164 Analysis Of The Interaction Between Charged Side Ch 5e-07
1l03_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 5e-07
1l76_A164 Tolerance Of T4 Lysozyme To Proline Substitutions W 5e-07
1l13_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 5e-07
104l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 5e-07
1l35_A164 Structure Of A Thermostable Disulfide-Bridge Mutant 5e-07
1l29_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 5e-07
1l77_A164 Design And Structural Analysis Of Alternative Hydro 5e-07
164l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-07
241l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 5e-07
3c83_A164 Bacteriophage T4 Lysozyme Mutant D89a In Wildtype B 5e-07
156l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-07
231l_A164 T4 Lysozyme Mutant M106k Length = 164 5e-07
1l58_A164 Analysis Of The Interaction Between Charged Side Ch 5e-07
1dyd_A164 Determination Of Alpha-Helix Propensity Within The 5e-07
139l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 6e-07
174l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 6e-07
1l37_A164 Contributions Of Engineered Surface Salt Bridges To 6e-07
3c82_A164 Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H 6e-07
3cdv_A164 Contributions Of All 20 Amino Acids At Site 96 To T 6e-07
143l_A164 Role Of Backbone Flexibility In The Accommodation O 6e-07
118l_A164 The Energetic Cost And The Structural Consequences 6e-07
1l00_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 6e-07
215l_A165 Protein Structure Plasticity Exemplified By Inserti 6e-07
158l_A164 Control Of Enzyme Activity By An Engineered Disulfi 6e-07
1ks3_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 6e-07
196l_A164 Thermodynamic And Structural Compensation In "size- 6e-07
125l_A164 The Energetic Cost And The Structural Consequences 6e-07
1t8g_A164 Crystal Structure Of Phage T4 Lysozyme Mutant L32aL 6e-07
250l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 6e-07
3f9l_A164 Evaulaution At Atomic Resolution Of The Role Of Str 7e-07
2ou9_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant T115r1 7e-07
1l27_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1l32_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1qtz_A164 D20c Mutant Of T4 Lysozyme Length = 164 7e-07
3c7z_A164 T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Len 7e-07
1c6c_A164 T4 Lysozyme Mutant C54tC97AL99A IN THE PRESENCE OF 7e-07
1qs9_A162 The Introduction Of Strain And Its Effects On The S 7e-07
197l_A164 Thermodynamic And Structural Compensation In "size- 7e-07
1l30_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1qth_A164 The Introduction Of Strain And Its Effects On The S 7e-07
1quo_A162 L99aE108V MUTANT OF T4 LYSOZYME Length = 162 7e-07
150l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 7e-07
1l28_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1g1w_A164 T4 Lysozyme Mutant C54tC97AQ105M Length = 164 7e-07
218l_A165 Protein Structure Plasticity Exemplified By Inserti 7e-07
205l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 7e-07
1l51_A164 Structural And Thermodynamic Analysis Of The Packin 7e-07
1quh_A162 L99gE108V MUTANT OF T4 LYSOZYME Length = 162 7e-07
1lyi_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 7e-07
2b6t_A162 T4 Lysozyme Mutant L99a At 200 Mpa Length = 162 7e-07
1qsb_A162 The Introduction Of Strain And Its Effects On The S 7e-07
1c6l_A164 T4 Lysozyme Mutant C54tC97AL99AF153A IN THE PRESENC 7e-07
1c63_A164 T4 Lysozyme Mutant C54tC97AL121A IN THE PRESENCE OF 8e-07
1l26_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-07
1cu6_A164 T4 Lysozyme Mutant L91a Length = 164 8e-07
1l72_A164 Multiple Stabilizing Alanine Replacements Within Al 8e-07
1l25_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-07
1l81_A164 Design And Structural Analysis Of Alternative Hydro 8e-07
1d9w_A164 Bacteriophage T4 Lysozyme Mutant Length = 164 8e-07
1qud_A162 L99g Mutant Of T4 Lysozyme Length = 162 8e-07
1d3m_A164 Methionine Core Mutation Length = 164 8e-07
1l31_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-07
3c8s_A164 Contributions Of All 20 Amino Acids At Site 96 To T 8e-07
3fad_A164 Evaulaution At Atomic Resolution Of The Role Of Str 9e-07
1l44_A164 Cumulative Site-Directed Charge-Change Replacements 9e-07
1l82_A164 Design And Structural Analysis Of Alternative Hydro 9e-07
3fi5_A164 Crystal Structure Of T4 Lysozyme Mutant R96w Length 9e-07
167l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 9e-07
1l80_A164 Design And Structural Analysis Of Alternative Hydro 9e-07
1l48_A164 Structural And Thermodynamic Analysis Of The Packin 9e-07
175l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 9e-07
1lyg_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 9e-07
1l49_A164 Structural And Thermodynamic Analysis Of The Packin 9e-07
151l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 9e-07
245l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 1e-06
220l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 1e-06
3c8q_A164 Contribution Of All 20 Amino Acids At Site 96 To Th 1e-06
1c69_A164 T4 Lysozyme Mutant C54tC97AL133A IN THE PRESENCE OF 1e-06
1qs5_A162 The Introduction Of Strain And Its Effects On The S 1e-06
3cdt_A164 Contributions Of All 20 Amino Acids At Site 96 To T 1e-06
1l0j_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 1e-06
3cdo_A164 Bacteriophage T4 Lysozyme Mutant R96v In Wildtype B 1e-06
3cdq_A164 Contributions Of All 20 Amino Acids At Site 96 To T 1e-06
246l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 1e-06
2qar_C163 Structure Of The 2tel Crystallization Module Fused 1e-06
3jr6_A170 Sequential Reorganization Of Beta-Sheet Topology By 1e-06
1l50_A164 Structural And Thermodynamic Analysis Of The Packin 1e-06
177l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 1e-06
173l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 1e-06
144l_A164 Role Of Backbone Flexibility In The Accommodation O 1e-06
3c7y_A164 Mutant R96a Of T4 Lysozyme In Wildtype Background A 1e-06
3guj_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 1e-06
190l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 1e-06
1lyh_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 1e-06
141l_A164 Role Of Backbone Flexibility In The Accommodation O 1e-06
1swy_A164 Use Of A Halide Binding Site To Bypass The 1000-Ato 1e-06
1cv0_A164 T4 Lysozyme Mutant F104m Length = 164 2e-06
131l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-06
252l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 2e-06
1lyj_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 2e-06
1d2w_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-06
223l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 2e-06
195l_A164 Thermodynamic And Structural Compensation In "size- 2e-06
146l_A164 Role Of Backbone Flexibility In The Accommodation O 2e-06
214l_A165 Protein Structure Plasticity Exemplified By Inserti 2e-06
1l54_A164 The Structural And Thermodynamic Consequences Of Bu 2e-06
140l_A164 Role Of Backbone Flexibility In The Accommodation O 2e-06
199l_A164 Thermodynamic And Structural Compensation In "size- 2e-06
147l_A164 Role Of Backbone Flexibility In The Accommodation O 2e-06
3l2x_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 2e-06
3c8r_A164 Contributions Of All 20 Amino Acids At Site 96 To S 2e-06
1c66_A164 T4 Lysozyme Mutant C54tC97AL121AL133A IN THE PRESEN 2e-06
240l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-06
3gui_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 2e-06
1qt5_A164 D20e Mutant Structure Of T4 Lysozyme Length = 164 2e-06
255l_A164 Hydrolase Length = 164 2e-06
1qt8_A164 T26h Mutant Of T4 Lysozyme Length = 164 2e-06
1lye_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 2e-06
210l_A163 Protein Structure Plasticity Exemplified By Inserti 2e-06
254l_A164 Lysozyme Length = 164 2e-06
1qtc_A162 The Introduction Of Strain And Its Effects On The S 2e-06
249l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-06
227l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 3e-06
1qt7_A164 E11n Mutant Of T4 Lysozyme Length = 164 3e-06
142l_A164 Role Of Backbone Flexibility In The Accommodation O 3e-06
1qt3_A164 T26d Mutant Of T4 Lysozyme Length = 164 3e-06
1oyu_A175 Long-Distance Conformational Changes In A Protein E 3e-06
253l_A164 Lysozyme Length = 164 3e-06
1t8a_A175 Use Of Sequence Duplication To Engineer A Ligand-Tr 4e-06
248l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 4e-06
145l_A164 Role Of Backbone Flexibility In The Accommodation O 4e-06
198l_A164 Thermodynamic And Structural Compensation In "size- 5e-06
1lgu_A164 T4 Lysozyme Mutant L99aM102Q Length = 164 5e-06
1qt4_A164 T26q Mutant Of T4 Lysozyme Length = 164 5e-06
261l_A173 Structural Characterisation Of An Engineered Tandem 5e-06
3ht6_A164 2-Methylphenol In Complex With T4 Lysozyme L99aM102 6e-06
148l_E164 A Covalent Enzyme-Substrate Intermediate With Sacch 6e-06
2rbn_A162 N-Phenylglycinonitrile In Complex With T4 Lysozyme 6e-06
3huq_A162 Thieno[3,2-B]thiophene In Complex With T4 Lysozyme 7e-06
3dke_X164 Polar And Non-Polar Cavities In Phage T4 Lysozyme L 7e-06
1qtd_A162 The Introduction Of Strain And Its Effects On The S 9e-06
157l_A164 Control Of Enzyme Activity By An Engineered Disulfi 1e-05
3dn8_A164 Iodopentafluorobenzene Binding In The Hydrophobic C 1e-05
1ssy_A164 Crystal Structure Of Phage T4 Lysozyme Mutant G28aI 4e-05
209l_A167 Protein Structure Plasticity Exemplified By Inserti 2e-04
1ssw_A164 Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY 2e-04
1d3n_A164 Methionine Core Mutation Length = 164 3e-04
1cx6_A164 T4 Lysozyme Substituted With Selenomethionine Lengt 0.001
1lwk_A164 Multiple Methionine Substitutions Are Tolerated In 0.002
1lpy_A164 Multiple Methionine Substitutions In T4 Lysozyme Le 0.004
1xjt_A191 Crystal Structure Of Active Form Of P1 Phage Endoly 2e-21
169l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-05
168l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-05
1l74_A164 Multiple Stabilizing Alanine Replacements Within Al 3e-05
1l36_A164 Toward A Simplification Of The Protein Folding Prob 3e-05
192l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 4e-05
1l75_A164 Multiple Stabilizing Alanine Replacements Within Al 5e-05
1l73_A164 Multiple Stabilizing Alanine Replacements Within Al 5e-05
191l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 1e-04
gi|262367957|pdb|3HDE|A Chain A, Crystal Structure Of Full-Length Endolysin R21 From Phage 21 Length = 165 Back     alignment and structure 
 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 70/130 (53%), Gaps = 3/130 (2%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG+    Y+DI  G WT+ +GHTG D+  G T T+ E +  L KD +     +       
Sbjct: 35  EGVSYIPYKDI-VGVWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIK-- 91

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
               E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+ 
Sbjct: 92  VDIPETMRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMT 151

Query: 160 RRDAEVKLLL 169
           RR+ E ++ L
Sbjct: 152 RREIEREICL 161
>gi|262367961|pdb|3HDF|A Chain A, Crystal Structure Of Truncated Endolysin R21 From Phage 21 Length = 140 Back     alignment and structure
>gi|90108744|pdb|2ANV|A Chain A, Crystal Structure Of P22 Lysozyme Mutant L86m Length = 146 Back     alignment and structure
>gi|60594001|pdb|1XJU|A Chain A, Crystal Structure Of Secreted Inactive Form Of P1 Phage Endolysin Lyz Length = 163 Back     alignment and structure
>gi|310689930|pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>gi|183448228|pdb|2Z6B|A Chain A, Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugated With Fe(Iii) Protoporphyrin Length = 584 Back     alignment and structure
>gi|62738309|pdb|1WTH|A Chain A, Crystal Structure Of Gp5-S351l Mutant And Gp27 Complex Length = 584 Back     alignment and structure
gi|34809729|pdb|1PDL|A Chain A, Fitting Of Gp5 In The Cryoem Reconstruction Of The Bacteriophage T4 Baseplate Length = 575 Back     alignment and structure
>gi|18655470|pdb|1K28|A Chain A, The Structure Of The Bacteriophage T4 Cell-Puncturing Device Length = 584 Back     alignment and structure
>gi|37927387|pdb|1P37|A Chain A, T4 Lysozyme Core Repacking Back-Revertant L102mCORE10 Length = 164 Back     alignment and structure
>gi|37927581|pdb|1PQI|A Chain A, T4 Lysozyme Core Repacking Mutant I118lCORE7TA Length = 164 Back     alignment and structure
>gi|37927389|pdb|1P3N|A Chain A, Core Redesign Back-Revertant I103vCORE10 Length = 164 Back     alignment and structure
>gi|37927585|pdb|1PQK|A Chain A, Repacking Of The Core Of T4 Lysozyme By Automated Design Length = 164 Back     alignment and structure
>gi|310689932|pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>gi|1065176|pdb|176L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|310689928|pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>gi|157834496|pdb|239L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|37927571|pdb|1PQD|A Chain A, T4 Lysozyme Core Repacking Mutant Core10TA Length = 164 Back     alignment and structure
>gi|310943018|pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>gi|157834492|pdb|235L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831726|pdb|1L70|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|319443693|pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>gi|159795485|pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein-Coupled Receptor Length = 500 Back     alignment and structure
>gi|157830899|pdb|1DYA|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831711|pdb|1L55|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831677|pdb|1L21|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|209447557|pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>gi|157829619|pdb|189L|A Chain A, Enhancement Of Protein Stability By The Combination Of Point Mutations In T4 Lysozyme Is Additive Length = 164 Back     alignment and structure
>gi|190613726|pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>gi|18158814|pdb|1KNI|A Chain A, Stabilizing Disulfide Bridge Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831678|pdb|1L22|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6980610|pdb|1B6I|A Chain A, T4 Lysozyme Mutant With Cys 54 Replaced By Thr, Cys 97 Replaced By Ala, Thr 21 Replaced By Cys And Lys 124 Replaced By Cys (C54t,C97a,T21c,K124c) Length = 164 Back     alignment and structure
>gi|6729790|pdb|1CV5|A Chain A, T4 Lysozyme Mutant L133m Length = 164 Back     alignment and structure
>gi|157830905|pdb|1DYG|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834467|pdb|213L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back     alignment and structure
>gi|37927383|pdb|1P2R|A Chain A, T4 Lysozyme Core Repacking Mutant I78vTA Length = 164 Back     alignment and structure
>gi|157834489|pdb|232L|A Chain A, T4 Lysozyme Mutant M120k Length = 164 Back     alignment and structure
>gi|317455410|pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>gi|37927410|pdb|1P64|A Chain A, T4 Lysozyme Core Repacking Mutant L133fTA Length = 164 Back     alignment and structure
>gi|157834487|pdb|230L|A Chain A, T4 Lysozyme Mutant M6l Length = 164 Back     alignment and structure
>gi|6729781|pdb|1CU3|A Chain A, T4 Lysozyme Mutant V87m Length = 164 Back     alignment and structure
>gi|110590780|pdb|2A4T|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (V131r7) Length = 164 Back     alignment and structure
>gi|20150496|pdb|1JQU|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|157831689|pdb|1L33|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|20150541|pdb|1JTM|A Chain A, Alternative Structures Of A Sequence Extended T4 Lysozyme Show That The Highly Conserved Beta-Sheet Has Weak Intrinsic Folding Propensity Length = 178 Back     alignment and structure
>gi|157829593|pdb|160L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|37927406|pdb|1P46|A Chain A, T4 Lysozyme Core Repacking Mutant M106iTA Length = 164 Back     alignment and structure
>gi|14488753|pdb|1G0Q|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149i Length = 164 Back     alignment and structure
>gi|37927589|pdb|1PQM|A Chain A, T4 Lysozyme Core Repacking Mutant V149iT152VTA Length = 164 Back     alignment and structure
>gi|157833964|pdb|1TLA|A Chain A, Hydrophobic Core Repacking And Aromatic-Aromatic Interaction In The Thermostable Mutant Of T4 Lysozyme Ser 117 (Right Arrow) Phe Length = 164 Back     alignment and structure
>gi|157829596|pdb|163L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|31615480|pdb|1KW7|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|6729796|pdb|1D3F|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|223673921|pdb|3CDR|A Chain A, R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K Length = 164 Back     alignment and structure
>gi|157831727|pdb|1L71|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|9257165|pdb|1CV1|A Chain A, T4 Lysozyme Mutant V111m Length = 164 Back     alignment and structure
>gi|4930159|pdb|259L|A Chain A, An Adaptable Metal-Binding Site Engineered Into T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834490|pdb|233L|A Chain A, T4 Lysozyme Mutant M120l Length = 164 Back     alignment and structure
>gi|37927376|pdb|1P2L|A Chain A, T4 Lysozyme Core Repacking Mutant V87iTA Length = 164 Back     alignment and structure
>gi|157829551|pdb|123L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829547|pdb|119L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829548|pdb|120L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834454|pdb|206L|A Chain A, Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729784|pdb|1CUP|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834475|pdb|221L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|37927583|pdb|1PQJ|A Chain A, T4 Lysozyme Core Repacking Mutant A111vCORE10TA Length = 164 Back     alignment and structure
>gi|37927425|pdb|1P6Y|A Chain A, T4 Lysozyme Core Repacking Mutant M120yTA Length = 164 Back     alignment and structure
>gi|157829555|pdb|128L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157830903|pdb|1DYE|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834479|pdb|224L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831717|pdb|1L61|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831720|pdb|1L64|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|146387591|pdb|2O79|A Chain A, T4 Lysozyme With C-Terminal Extension Length = 170 Back     alignment and structure
>gi|157829541|pdb|112L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|151567976|pdb|2Q9D|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 Length = 164 Back     alignment and structure
>gi|114793376|pdb|1ZYT|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (A82r1) Length = 164 Back     alignment and structure
>gi|5542484|pdb|1QTB|A Chain A, The Introduction Of Strain And Its Effects On The Structure And Stability Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|157831750|pdb|1L95|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|14277902|pdb|1G1V|A Chain A, T4 Lysozyme Mutant C54tC97AI58T Length = 164 Back     alignment and structure
>gi|157831741|pdb|1L86|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|10835387|pdb|1C6P|A Chain A, T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 ATM ARGON Length = 164 Back     alignment and structure
>gi|14488750|pdb|1G0L|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152v Length = 164 Back     alignment and structure
>gi|157829601|pdb|170L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829533|pdb|108L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829537|pdb|110L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829544|pdb|114L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831742|pdb|1L87|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|14488744|pdb|1G06|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149s Length = 164 Back     alignment and structure
>gi|157829558|pdb|130L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|14488748|pdb|1G0J|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152s Length = 164 Back     alignment and structure
>gi|31615541|pdb|1LWG|A Chain A, Multiple Methionine Substitutions Are Tolerated In T4 Lysozyme And Have Coupled Effects On Folding And Stability Length = 164 Back     alignment and structure
>gi|157829539|pdb|111L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829545|pdb|115L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831679|pdb|1L23|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|157829553|pdb|126L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|14488751|pdb|1G0M|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152i Length = 164 Back     alignment and structure
>gi|5822381|pdb|1QUG|A Chain A, E108v Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|21466123|pdb|1LLH|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|157834495|pdb|238L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|575962|pdb|137L|A Chain A, Structural Basis Of Amino Acid Alpha Helix Propensity Length = 164 Back     alignment and structure
>gi|9257162|pdb|1CU2|A Chain A, T4 Lysozyme Mutant L84m Length = 164 Back     alignment and structure
>gi|37927385|pdb|1P36|A Chain A, T4 Lyoszyme Core Repacking Mutant I100vTA Length = 164 Back     alignment and structure
>gi|157829531|pdb|107L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831722|pdb|1L66|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157829602|pdb|171L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834491|pdb|234L|A Chain A, T4 Lysozyme Mutant M106l Length = 164 Back     alignment and structure
>gi|157829599|pdb|166L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|14488752|pdb|1G0P|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149g Length = 164 Back     alignment and structure
>gi|157835299|pdb|2L78|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829550|pdb|122L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|229597880|pdb|3G3W|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (T151r1) At 291 K Length = 164 Back     alignment and structure
>gi|157829603|pdb|172L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834470|pdb|217L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829535|pdb|109L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729782|pdb|1CU5|A Chain A, T4 Lysozyme Mutant L91m Length = 164 Back     alignment and structure
>gi|157831743|pdb|1L88|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|10835363|pdb|1C60|A Chain A, T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 8 ATM Argon Length = 164 Back     alignment and structure
>gi|157829582|pdb|149L|A Chain A, Conservation Of Solvent-Binding Sites In 10 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|7767116|pdb|1EPY|A Chain A, T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 164 Back     alignment and structure
>gi|157829556|pdb|129L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|157831695|pdb|1L39|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|157834504|pdb|247L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729795|pdb|1D2Y|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157831723|pdb|1L67|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157879603|pdb|1P56|A Chain A, Duplication-Extension Of Helix A Of T4 Lysozyme Length = 176 Back     alignment and structure
>gi|157831724|pdb|1L68|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157834494|pdb|237L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729791|pdb|1CV6|A Chain A, T4 Lysozyme Mutant V149m Length = 164 Back     alignment and structure
>gi|157834499|pdb|242L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831721|pdb|1L65|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157831680|pdb|1L24|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|14488747|pdb|1G0G|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152a Length = 164 Back     alignment and structure
>gi|157829598|pdb|165L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|37927591|pdb|1PQO|A Chain A, T4 Lysozyme Core Repacking Mutant L118iTA Length = 164 Back     alignment and structure
>gi|6729789|pdb|1CV4|A Chain A, T4 Lysozyme Mutant L118m Length = 164 Back     alignment and structure
>gi|157834493|pdb|236L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729797|pdb|1D3J|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157834501|pdb|244L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831703|pdb|1L47|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|118137975|pdb|2HUL|A Chain A, Crystal Structure Of T4 Lysozyme S44c Synthetic Dimer Length = 164 Back     alignment and structure
>gi|157829588|pdb|155L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157829543|pdb|113L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834500|pdb|243L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|14488745|pdb|1G07|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149c Length = 164 Back     alignment and structure
>gi|14488749|pdb|1G0K|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152c Length = 164 Back     alignment and structure
>gi|157831749|pdb|1L94|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|149242169|pdb|2IGC|A Chain A, Structure Of Spin Labeled T4 Lysozyme Mutant T115r1a Length = 164 Back     alignment and structure
>gi|157831697|pdb|1L41|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|494717|pdb|201L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 Back     alignment and structure
>gi|157831747|pdb|1L92|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834466|pdb|212L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 168 Back     alignment and structure
>gi|37927436|pdb|1P7S|A Chain A, T4 Lysozyme Core Repacking Mutant V103iTA Length = 164 Back     alignment and structure
>gi|443083|pdb|1L97|A Chain A, Structure Of A Hinge-Bending Bacteriophage T4 Lysozyme Mutant, Ile3-> Pro Length = 164 Back     alignment and structure
>gi|157829524|pdb|102L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 165 Back     alignment and structure
>gi|157831748|pdb|1L93|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157831901|pdb|1LYF|A Chain A, Dissection Of Helix Capping In T4 Lysozyme By Structural And Thermodynamic Analysis Of Six Amino Acid Substitutions At Thr 59 Length = 164 Back     alignment and structure
>gi|149242489|pdb|2NTH|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 Length = 164 Back     alignment and structure
>gi|157834465|pdb|211L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back