RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall hetropolymer peptidoglycan and cell division. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.. Length = 133 Score = 135 bits (342), Expect = 5e-33 Identities = 61/137 (44%), Positives = 87/137 (63%), Gaps = 4/137 (2%) Query: 28 VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87 + A + ++K FEG RLT Y+D G WTIGYGHTG V GMTITE++A+ L KD +K Sbjct: 1 ISQAGLALIKRFEGCRLTPYKDPAG-VWTIGYGHTGGVV-PGMTITEEQADALLAKDLAK 58 Query: 88 SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147 + + + ++N+ A+ F FN+G G + ST ++++A DW A + +W Sbjct: 59 AERAV--NRAVKVPLTQNQFDALVSFAFNVGAGAFRTSTLLRKLNAGDWAGACAQLPRWV 116 Query: 148 KAGGKVLPGLVKRRDAE 164 KAGGKVLPGLV+RR+AE Sbjct: 117 KAGGKVLPGLVRRREAE 133 >gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only]. Length = 152 Score = 126 bits (318), Expect = 3e-30 Identities = 59/145 (40%), Positives = 84/145 (57%), Gaps = 2/145 (1%) Query: 28 VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87 + I ++KEFEG RL YRD G WTIGYGHTG V GMT+T++E + + Sbjct: 7 ISEIGIALIKEFEGCRLDPYRD-PAGVWTIGYGHTGKPVGPGMTLTKEECDQANALERDL 65 Query: 88 SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147 + + ++ + A+ F +N+G GN+ ST +R++A DW A E+ ++W Sbjct: 66 AEAERAVNRYIKVPLTQPQFDALVSFAYNIGAGNFFSSTLLRRINAGDWSGACEQLRRWI 125 Query: 148 KA-GGKVLPGLVKRRDAEVKLLLES 171 KA GGKVLPGLV+RR+AE L L Sbjct: 126 KAGGGKVLPGLVRRREAERALFLWG 150 >gnl|CDD|144526 pfam00959, Phage_lysozyme, Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin. Length = 108 Score = 79.7 bits (197), Expect = 4e-16 Identities = 37/111 (33%), Positives = 48/111 (43%), Gaps = 8/111 (7%) Query: 55 WTIGYGHTGSDVTEGMTITEKEAED---FLLKDASKSLNLLLESSPALKSTSENRLVAVA 111 WTIG GH G+DV+ IT+ A F L A + + S NR A+ Sbjct: 2 WTIGIGHYGTDVSPHPRITKSTAAGRYQFDLDTAERGIKQYG-----KVDFSPNRQDALV 56 Query: 112 DFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRD 162 FN+G G ST + + W A K KAGGK GL +RR+ Sbjct: 57 SLAFNVGCGARGFSTLLRAGNQGQWVLACSAIWKSLKAGGKEYNGLKRRRE 107 >gnl|CDD|29559 cd00735, bacteriophage_T4-like_lysozyme, Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1) as well as Dictyostelium. . Length = 164 Score = 45.0 bits (106), Expect = 1e-05 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 26/136 (19%) Query: 34 KMLKEFEGLRLTAYRDIGGGAWTIGYGH--------------------TGSDVTEGMTIT 73 +ML++ EGLRL Y D G TIG GH G +VT G IT Sbjct: 4 EMLRQDEGLRLKVYWD-TEGYPTIGIGHLITRKKTKDLNAINSELSKQIGREVTNG-VIT 61 Query: 74 EKEAEDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR 130 +E E KD +K+ ++ + SP K + +R +A+ + VF +G+G K R Sbjct: 62 SEEVEALFEKDLAKAQRDIMSNPKLSPVYKKLNASRQMALENMVFQMGVGGVAKFKNSLR 121 Query: 131 -VDAQDWEKAAEECKK 145 + A+DW++A + + Sbjct: 122 AMAAKDWKEAYKGLRD 137 >gnl|CDD|30089 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward.. Length = 322 Score = 28.3 bits (63), Expect = 1.0 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Query: 51 GGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSP 97 GG A YG TGS T M E + + L A++ + LL Sbjct: 83 GGVATCFAYGQTGSGKTYTMLGDENQEGLYAL--AARDIFRLLAQPN 127 >gnl|CDD|34745 COG5144, TFB2, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB2 [Transcription / DNA replication, recombination, and repair]. Length = 447 Score = 27.7 bits (61), Expect = 1.7 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 6/63 (9%) Query: 79 DFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLG---IGNYNKSTF---KQRVD 132 FLL+ ++ L LL S VAV F+F LG +G K Q++ Sbjct: 184 QFLLQTINEQLWTLLLLYLKYFEGSVMDEVAVLHFLFMLGALAVGTAYKIDALSDTQQIM 243 Query: 133 AQD 135 D Sbjct: 244 LMD 246 >gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 1070 Score = 26.8 bits (59), Expect = 2.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 112 DFVFNLGIGNYNKSTFKQRVD-AQDWEKAAEECKKW 146 D V +GI YN K + + +WEK E +W Sbjct: 105 DDVMKMGIDKYNNECRKIVMRYSSEWEKTVERLGRW 140 >gnl|CDD|153385 cd07373, 2A5CPDO_A, The alpha subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol. 2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO) catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the alpha subunit, which does not contain a potential metal binding site and may not possess catalytic activity. Length = 271 Score = 26.8 bits (59), Expect = 3.0 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 6/45 (13%) Query: 104 ENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148 +N+ VAV +G+G + S F++ +D ++ A EE KW + Sbjct: 165 QNKRVAV------VGVGGLSGSLFREEIDPREDHIANEEDDKWNR 203 >gnl|CDD|32176 COG1993, COG1993, Uncharacterized conserved protein [Function unknown]. Length = 109 Score = 26.7 bits (59), Expect = 3.1 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 8/59 (13%) Query: 6 RIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLR-LTAYRDIGGGAWTIGYGHTG 63 + + I + +DKH P+ A+++ L+E EG+R T R I G+G G Sbjct: 2 KRMKSKLLRIYLGENDKHEGKPLYEAIVERLRE-EGIRGATVLRGI------AGFGKDG 53 >gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]. Length = 606 Score = 26.5 bits (58), Expect = 3.8 Identities = 14/65 (21%), Positives = 20/65 (30%), Gaps = 6/65 (9%) Query: 108 VAVADFVFNLGIGNYNKSTFKQRVDAQD------WEKAAEECKKWTKAGGKVLPGLVKRR 161 VA G + + A E A ++ K GK + G KR Sbjct: 20 TVVAGGTAVGGYYYLQQWQLALQDGAPLKIGEGKNEAAKVVKEEDLKDSGKDVEGAKKRA 79 Query: 162 DAEVK 166 A+ K Sbjct: 80 KAKNK 84 >gnl|CDD|35718 KOG0497, KOG0497, KOG0497, Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism]. Length = 760 Score = 26.4 bits (58), Expect = 4.2 Identities = 22/93 (23%), Positives = 34/93 (36%), Gaps = 17/93 (18%) Query: 47 YRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA---LKSTS 103 YR I G WT SD +G +++ AE + LLL S P+ + Sbjct: 464 YRHISKGGWTF------SDRDQGWPVSDCTAE-------ALKCCLLLSSMPSEIVGEKID 510 Query: 104 ENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDW 136 RL D + L N + + + +W Sbjct: 511 VERLYDAVDVLLYLQSENGGFAAY-EPARGYEW 542 >gnl|CDD|58126 cd03721, SOCS_ASB2, SOCS (suppressors of cytokine signaling) box of ASB2-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. ASB2 targets specific proteins to destruction by the proteasome in leukemia cells that have been induced to differentiate. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.. Length = 45 Score = 26.4 bits (58), Expect = 4.4 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 11 VKRMIGMNGDDKHNKIPVPNALIKMLK 37 V+ +IG+N + +P+P LI+ L Sbjct: 14 VRTLIGINRIKLIDTLPLPPRLIRYLN 40 >gnl|CDD|35483 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subunit [Transcription]. Length = 1640 Score = 26.1 bits (57), Expect = 5.2 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 8/74 (10%) Query: 35 MLKEFEGLRL---TAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE-----AEDFLLKDAS 86 ++K EGL++ RD G YG G D+T+ + +KE E LLK S Sbjct: 995 LIKHLEGLKVHYDLTVRDSDGSVVQFMYGEDGLDITKSSFLNKKEFPTDNYEAVLLKYKS 1054 Query: 87 KSLNLLLESSPALK 100 +S+ + A K Sbjct: 1055 ESVLSAFDIKKASK 1068 >gnl|CDD|37107 KOG1896, KOG1896, KOG1896, mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification]. Length = 1366 Score = 26.1 bits (57), Expect = 5.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Query: 80 FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGI 119 FL+ DA +++++ + + ++S S RLV ADF + Sbjct: 1198 FLVSDADRNIHVYMYAPENIESLSGQRLVRRADFHVGAHV 1237 >gnl|CDD|29558 cd00442, lysozyme_like, lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.. Length = 105 Score = 25.4 bits (55), Expect = 8.0 Identities = 21/70 (30%), Positives = 27/70 (38%), Gaps = 10/70 (14%) Query: 31 ALIKMLKEFEGLRLTAYRDIGG-------GAWTIG-YGHT--GSDVTEGMTITEKEAEDF 80 A+I ML EG L AY+D G + IG Y T SD I K Sbjct: 1 AIIDMLASSEGTDLKAYKDRGHGTLNPGERGYGIGLYQLTSRWSDAYRARGIGLKLLAQL 60 Query: 81 LLKDASKSLN 90 +LK + + Sbjct: 61 ILKLFNPKVQ 70 >gnl|CDD|36002 KOG0783, KOG0783, KOG0783, Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown]. Length = 1267 Score = 25.4 bits (55), Expect = 8.7 Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Query: 83 KDASKSLNLLLESSPA---LKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVD 132 K+ L L + N + V LGIGN + + +RVD Sbjct: 117 KEGLSPLQFLSRVLSSTIHPVLDLPNDVYGWGTNVNNTLGIGNGKEPSSPERVD 170 >gnl|CDD|35265 KOG0042, KOG0042, KOG0042, Glycerol-3-phosphate dehydrogenase [Energy production and conversion]. Length = 680 Score = 25.3 bits (55), Expect = 9.1 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Query: 50 IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92 IGGGA G G T G+ EA DF +SKS L+ Sbjct: 73 IGGGA--TGAGCALDAATRGLKTALVEAGDFASGTSSKSTKLI 113 >gnl|CDD|143580 cd07176, terB, tellurite resistance protein terB. This family contains uncharacterized bacterial proteins involved in tellurium resistance. The prototype of this CD is the Kp-terB protein from Klebsiella pneumoniae, whose 3D structure was recently determined. The biological function of terB and the mechanism responsible for tellurium resistance are unknown. Length = 111 Score = 25.3 bits (56), Expect = 9.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Query: 92 LLESSPALKSTSENRLVAVADFVFNL 117 LL S P L RL+A+ D + L Sbjct: 30 LLRSLPVLSGFDRERLIALLDKLLAL 55 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.135 0.389 Gapped Lambda K H 0.267 0.0701 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,998,069 Number of extensions: 96009 Number of successful extensions: 234 Number of sequences better than 10.0: 1 Number of HSP's gapped: 226 Number of HSP's successfully gapped: 21 Length of query: 171 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 84 Effective length of database: 4,383,754 Effective search space: 368235336 Effective search space used: 368235336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.6 bits)