RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >gnl|CDD|177423 PHA02596, 5, baseplate hub subunit and tail lysozyme; Provisional. Length = 576 Score = 48.6 bits (116), Expect = 7e-07 Identities = 47/159 (29%), Positives = 68/159 (42%), Gaps = 35/159 (22%) Query: 15 IGMNGDDKHN-KIPV---PNALI-KMLKEFEGLRLTAYRDIGGGAWTIGYGH-------- 61 + +N DD +IP P+ I KML+ EG+RL Y D G TIG GH Sbjct: 153 VAINPDDTPLDEIPPDDNPDFTIEKMLRRDEGIRLKVYWDSEGYP-TIGIGHLIIREKTR 211 Query: 62 ------------TGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESS---PALKSTSENR 106 G +VT G IT +EA +D +K + S P + +R Sbjct: 212 DMAQINKLLSKQVGREVTGG-RITAEEASKLFARDLAKVQRDISRHSKVGPVYNKLNRSR 270 Query: 107 LVAVADFVFNLGIGNYNKSTFKQRVDA---QDWEKAAEE 142 +A+ + F +G+G K FK + A DW+KA + Sbjct: 271 QMALENMAFQMGVGGVAK--FKNMLAAMLAGDWKKAYDA 307 >gnl|CDD|178165 PLN02550, PLN02550, threonine dehydratase. Length = 591 Score = 27.6 bits (61), Expect = 1.6 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 14/64 (21%) Query: 29 PNALIKMLKEFE---GLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85 P AL+K L F + L YR G G TG++V G+ + +E ++F K Sbjct: 521 PGALMKFLDAFSPRWNISLFHYR---------GQGETGANVLVGIQVPPEEMQEF--KSR 569 Query: 86 SKSL 89 + +L Sbjct: 570 ANAL 573 >gnl|CDD|185647 PTZ00468, PTZ00468, phosphofructokinase family protein; Provisional. Length = 1328 Score = 27.2 bits (60), Expect = 2.3 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 1 MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGL 42 M I++ I+ + + + KH + +P LI+ + EFE L Sbjct: 315 MSIVDEIVEMILKRDSL--GKKHGIVLLPEGLIEFIPEFETL 354 >gnl|CDD|149734 pfam08767, CRM1_C, CRM1 C terminal. CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES). CRM1 forms a complex with the NES containing protein and the small GTPase Ran. This region forms an alpha helical structure formed by six helical hairpin motifs that are structurally similar to the HEAT repeat, but share little sequence similarity to the HEAT repeat. Length = 235 Score = 27.2 bits (61), Expect = 2.3 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 7 IISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEG 41 I +FV + ++ D K K + + LI+ LKEF G Sbjct: 202 IKNFVVGLFNLSNDLKKFKGHLRDFLIQ-LKEFSG 235 >gnl|CDD|117609 pfam09043, Lys-AminoMut_A, D-Lysine 5,6-aminomutase alpha subunit. Members of his family are involved in the 1,2 rearrangement of the terminal amino group of DL-lysine and of L-beta-lysine, using adenosylcobalamin (AdoCbl) and pyridoxal-5'-phosphate as cofactors. The structure is predominantly a PLP-binding TIM barrel domain, with several additional alpha-helices and beta-strands at the N and C termini. These helices and strands form an intertwined accessory clamp structure that wraps around the sides of the TIM barrel and extends up toward the Ado ligand of the Cbl cofactor, providing most of the interactions observed between the protein and the Ado ligand of the Cbl, suggesting that its role is mainly in stabilising AdoCbl in the precatalytic resting state. Length = 509 Score = 27.0 bits (60), Expect = 2.6 Identities = 22/85 (25%), Positives = 46/85 (54%), Gaps = 9/85 (10%) Query: 11 VKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGM 70 V R++G++G D+ N +P+PN ++ LK+ GL L A + + G + ++ E + Sbjct: 38 VCRLLGIDGVDE-NGVPLPNVVVDHLKDKGGLGLGAAYWLANA--MVETGRSPQEIAEAV 94 Query: 71 TITEKE------AEDFLLKDASKSL 89 E + A++F +K A++++ Sbjct: 95 AAGELDLTSLPMADEFEIKAAARAI 119 >gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated. Length = 574 Score = 26.2 bits (58), Expect = 5.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 59 YGHTGSDVTEGMTITEKEAEDFLLKD 84 YGH G +T+ + K E F +KD Sbjct: 513 YGHVGIRITDLKDLKPKLEEAFAMKD 538 >gnl|CDD|129414 TIGR00314, cdhA, CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit. Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex. Carbon monoxide dehydrogenase is a synonym. The ACDS complex carries out an unusual reaction involving the reversible cleavage and synthesis of acetyl-CoA in methanogens. The model contains the prosite signature for 4Fe-4S ferredoxins [C-x(2)-C-x(2)-C-x(3)-C-[PEG]] between residues 448-462 of the model. Length = 784 Score = 26.0 bits (57), Expect = 5.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 137 EKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168 E EE ++W G +PG++ R + KLL Sbjct: 21 EIVEEEEEEWEPMGPTPMPGILTLRKWDFKLL 52 >gnl|CDD|183362 PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional. Length = 429 Score = 25.2 bits (55), Expect = 8.0 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Query: 15 IGMNGDDKHNKIPVPNALIKMLKEFEGLRLT 45 I + GD K+ + ++L+K+L + GL+ T Sbjct: 244 IALVGDLKYGR--TVHSLVKLLALYRGLKFT 272 >gnl|CDD|149353 pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases. Length = 95 Score = 24.9 bits (55), Expect = 9.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 134 QDWEKAAEECKKWTKAGGKVL 154 D E+A E + K GGK++ Sbjct: 74 PDPERALREIARVLKPGGKLV 94 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.135 0.389 Gapped Lambda K H 0.267 0.0701 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,752,277 Number of extensions: 163666 Number of successful extensions: 317 Number of sequences better than 10.0: 1 Number of HSP's gapped: 317 Number of HSP's successfully gapped: 14 Length of query: 171 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 84 Effective length of database: 4,114,577 Effective search space: 345624468 Effective search space used: 345624468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.6 bits)