Query gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 43 No_of_seqs 102 out of 399 Neff 4.1 Searched_HMMs 39220 Date Mon May 30 05:24:29 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781057.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 cd00737 endolysin_autolysin En 99.6 6E-17 1.5E-21 102.5 3.4 36 7-42 1-36 (133) 2 COG3772 Phage-related lysozyme 99.6 7.6E-17 1.9E-21 102.0 3.5 40 2-41 2-41 (152) 3 cd00735 bacteriophage_T4-like_ 98.9 5.2E-10 1.3E-14 69.5 2.7 30 11-40 2-31 (164) 4 cd00442 lysozyme_like lysozyme 93.2 0.022 5.7E-07 33.2 0.1 32 10-41 1-41 (105) 5 KOG4404 consensus 49.6 6.2 0.00016 21.6 0.6 10 32-41 92-101 (350) 6 TIGR00565 trpE_proteo anthrani 48.2 15 0.00038 19.8 2.4 33 1-35 416-448 (505) 7 TIGR00553 pabB para-aminobenzo 38.8 24 0.00061 18.8 2.2 29 1-31 277-305 (368) 8 TIGR00564 trpE_most anthranila 31.4 30 0.00077 18.3 1.8 32 1-34 441-472 (543) 9 PRK05940 anthranilate synthase 22.9 52 0.0013 17.2 1.8 31 1-33 366-396 (459) 10 KOG1223 consensus 21.5 62 0.0016 16.8 1.9 26 9-34 413-438 (508) 11 pfam11476 TgMIC1 Toxoplasma go 20.1 53 0.0014 17.1 1.3 17 26-42 62-80 (137) No 1 >cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall hetropolymer peptidoglycan and cell division. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan. Probab=99.65 E-value=6e-17 Score=102.47 Aligned_cols=36 Identities=56% Similarity=1.137 Sum_probs=34.6 Q ss_pred HHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCCC Q ss_conf 439999999975285124303789970662026666 Q gi|254781057|r 7 ILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGS 42 (43) Q Consensus 7 is~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg~ 42 (43) ||+++++|||.|||||++||+||+|+||||||||.. T Consensus 1 is~~gi~~ik~~EG~~~~~Y~D~~G~~TIGyGht~~ 36 (133) T cd00737 1 ISQAGLALIKRFEGCRLTPYKDPAGVWTIGYGHTGG 36 (133) T ss_pred CCHHHHHHHHHHHCCCCEEEECCCCCEEEEECCCCC T ss_conf 998999999998388203277899984781086248 No 2 >COG3772 Phage-related lysozyme (muraminidase) [General function prediction only] Probab=99.64 E-value=7.6e-17 Score=101.98 Aligned_cols=40 Identities=48% Similarity=0.971 Sum_probs=36.5 Q ss_pred CCCHHHHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCC Q ss_conf 8530343999999997528512430378997066202666 Q gi|254781057|r 2 NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG 41 (43) Q Consensus 2 ~g~~kis~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg 41 (43) .+.+.+|+.+++|||.|||++++||+||+|+||||||||+ T Consensus 2 ~~~~~~s~~gi~lIk~~EG~~~~pY~d~~GvwTIgyGhT~ 41 (152) T COG3772 2 GAMASISEIGIALIKEFEGCRLDPYRDPAGVWTIGYGHTG 41 (152) T ss_pred CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCC T ss_conf 5100145888999999754677641679987788628857 No 3 >cd00735 bacteriophage_T4-like_lysozyme Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1) as well as Dictyostelium. Probab=98.92 E-value=5.2e-10 Score=69.50 Aligned_cols=30 Identities=43% Similarity=0.690 Sum_probs=28.1 Q ss_pred HHHHHHHHCCCCCCCEECCCCCEEEECCCC Q ss_conf 999999752851243037899706620266 Q gi|254781057|r 11 LIEITKRYEGLKLTAYRDPGGTWTIGYGHS 40 (43) Q Consensus 11 ~i~lIk~~EG~r~~aY~d~~G~wTIGyGHT 40 (43) .++.||.+||+|+++|+|+.|.|||||||- T Consensus 2 L~e~ik~~EG~r~~~Y~Ds~G~~TIGiGhl 31 (164) T cd00735 2 IAEMLRQDEGLRLKVYWDTEGYPTIGIGHL 31 (164) T ss_pred HHHHHHHCCCEECCEEECCCCCEEEEECEE T ss_conf 789999807812402566999814765525 No 4 >cd00442 lysozyme_like lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. Probab=93.18 E-value=0.022 Score=33.22 Aligned_cols=32 Identities=31% Similarity=0.520 Sum_probs=28.2 Q ss_pred HHHHHHHHHCCCCCCCEEC--------CCCCEEEEC-CCCC Q ss_conf 9999999752851243037--------899706620-2666 Q gi|254781057|r 10 ALIEITKRYEGLKLTAYRD--------PGGTWTIGY-GHSG 41 (43) Q Consensus 10 a~i~lIk~~EG~r~~aY~d--------~~G~wTIGy-GHTg 41 (43) +.+++|+..||.++++|+| ..+..|||. |||. T Consensus 1 ai~~~l~~~Eg~~lk~~k~~g~~~~~~~~r~ygiG~~q~t~ 41 (105) T cd00442 1 AIIDMLASSEGTDLKAYKDRGHGTLNPGERGYGIGLYQLTS 41 (105) T ss_pred CHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH T ss_conf 95566432236656666678876348542343125889998 No 5 >KOG4404 consensus Probab=49.63 E-value=6.2 Score=21.58 Aligned_cols=10 Identities=70% Similarity=1.016 Sum_probs=8.1 Q ss_pred CEEEECCCCC Q ss_conf 7066202666 Q gi|254781057|r 32 TWTIGYGHSG 41 (43) Q Consensus 32 ~wTIGyGHTg 41 (43) +-||||||+. T Consensus 92 ItTIGyGhst 101 (350) T KOG4404 92 ITTIGYGHST 101 (350) T ss_pred EEEECCCCCC T ss_conf 8642367788 No 6 >TIGR00565 trpE_proteo anthranilate synthase component I; InterPro: IPR005257 This family represents anthranilate/para-aminobenzoate synthase component I from proteobacteria and actinobacteria. This enzyme resembles some other chorismate-binding enzymes, including para-aminobenzoate synthase (pabB) and isochorismate synthase. There is a fairly deep split between two sets, seen in the pattern of gaps as well as in amino acid sequence differences. This group includes proteobacteria such as Escherichia coli and Helicobacter pylori but also the Gram-positive organism Corynebacterium glutamicum. The second group (IPR005256 from INTERPRO) includes eukaryotes, archaea, and most other bacterial lineages; sequences from the second group may resemble pabB more closely than other trpE from this group. ; GO: 0004049 anthranilate synthase activity, 0009058 biosynthetic process. Probab=48.16 E-value=15 Score=19.79 Aligned_cols=33 Identities=21% Similarity=0.335 Sum_probs=27.9 Q ss_pred CCCCHHHHHHHHHHHHHHCCCCCCCEECCCCCEEE Q ss_conf 98530343999999997528512430378997066 Q gi|254781057|r 1 MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTI 35 (43) Q Consensus 1 m~g~~kis~a~i~lIk~~EG~r~~aY~d~~G~wTI 35 (43) .+|++||+ ++.||-++|+-|.-.|=-..|..|- T Consensus 416 LsGAPKi~--A~qLIyq~E~qrRgSYGGaVGYlts 448 (505) T TIGR00565 416 LSGAPKIK--AMQLIYQLENQRRGSYGGAVGYLTS 448 (505) T ss_pred CCCCHHHH--HHHHHHHHHCCCCCCCCCCCEEECC T ss_conf 46652789--9999999716801566764201415 No 7 >TIGR00553 pabB para-aminobenzoate synthase, component I; InterPro: IPR005802 Para-aminobenzoate synthase component I (pabB) is closely related to anthranilate synthase component I (trpE). The apparent orthologs of pabB in Aquifex aeolicus and Helicobacter pylori score well below most TrpE proteins because of a different architecture, in which the less strongly conserved N-terminal domain is absent. The noise cut off is set to exclude most examples of TrpE.; GO: 0009396 folic acid and derivative biosynthetic process. Probab=38.79 E-value=24 Score=18.80 Aligned_cols=29 Identities=28% Similarity=0.387 Sum_probs=23.0 Q ss_pred CCCCHHHHHHHHHHHHHHCCCCCCCEECCCC Q ss_conf 9853034399999999752851243037899 Q gi|254781057|r 1 MNGSSKILNALIEITKRYEGLKLTAYRDPGG 31 (43) Q Consensus 1 m~g~~kis~a~i~lIk~~EG~r~~aY~d~~G 31 (43) |+|+.|+ .++++|+++|.-+.-+|=-..| T Consensus 277 iTGAPK~--RAMeII~elE~~~RG~YcGaiG 305 (368) T TIGR00553 277 ITGAPKL--RAMEIIKELEKQPRGVYCGAIG 305 (368) T ss_pred CCCCHHH--HHHHHHHHHCCCCCCCCHHHHH T ss_conf 3581468--9999999863688895100133 No 8 >TIGR00564 trpE_most anthranilate synthase component I; InterPro: IPR005256 This enzyme resembles some other chorismate-binding enzymes, including para-aminobenzoate synthase (pabB) and isochorismate synthase. There is a fairly deep split between two sets, seen in the pattern of gaps as well as in amino acid sequence differences. This group includes eukaryotes, archaea, and many bacterial lineages; sequences from the second group may resemble pabB more closely than other trpE from the other group. The other group includes Gram-negative proteobacteria such as Escherichia coli and Helicobacter pylori but also the Gram-positive organism Corynebacterium glutamicum, and is described by IPR005257 from INTERPRO. A sequence from Bacillus subtilis that scores above the trusted cut-off is annotated as PabB rather than TrpE. However, it is part of an operon that is required for Trp as well as folate biosynthesis, is Trp-repressible, and contains TrpG. It is likely that this sequence annotated as PabB functions both as PabB and as TrpE. ; GO: 0004049 anthranilate synthase activity, 0000162 tryptophan biosynthetic process. Probab=31.38 E-value=30 Score=18.31 Aligned_cols=32 Identities=22% Similarity=0.347 Sum_probs=26.2 Q ss_pred CCCCHHHHHHHHHHHHHHCCCCCCCEECCCCCEE Q ss_conf 9853034399999999752851243037899706 Q gi|254781057|r 1 MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWT 34 (43) Q Consensus 1 m~g~~kis~a~i~lIk~~EG~r~~aY~d~~G~wT 34 (43) ++|+.|| .|+++|-++|.-|..+|=-..|.|+ T Consensus 441 lSGAPK~--RAme~I~ELE~~~RG~YgGavGyl~ 472 (543) T TIGR00564 441 LSGAPKV--RAMELIDELEPEKRGIYGGAVGYLS 472 (543) T ss_pred CCCCCHH--HHHHHHHHHCCCCCCCCCEEEECCC T ss_conf 5788448--9999999871788423530687116 No 9 >PRK05940 anthranilate synthase component I-like protein; Validated Probab=22.93 E-value=52 Score=17.18 Aligned_cols=31 Identities=19% Similarity=0.358 Sum_probs=24.8 Q ss_pred CCCCHHHHHHHHHHHHHHCCCCCCCEECCCCCE Q ss_conf 985303439999999975285124303789970 Q gi|254781057|r 1 MNGSSKILNALIEITKRYEGLKLTAYRDPGGTW 33 (43) Q Consensus 1 m~g~~kis~a~i~lIk~~EG~r~~aY~d~~G~w 33 (43) |+|+.||. ++++|.+.|..+.-+|--+.|.+ T Consensus 366 itGAPK~r--AmeiI~elE~~~Rg~Y~G~iGy~ 396 (459) T PRK05940 366 ITGCPKVR--CMEIIEELEPVRRNLFYGSCGYL 396 (459) T ss_pred CCCCCHHH--HHHHHHHHCCCCCCCCEEEEEEE T ss_conf 57862899--99999997599987715888999 No 10 >KOG1223 consensus Probab=21.53 E-value=62 Score=16.84 Aligned_cols=26 Identities=23% Similarity=0.408 Sum_probs=23.0 Q ss_pred HHHHHHHHHHCCCCCCCEECCCCCEE Q ss_conf 99999999752851243037899706 Q gi|254781057|r 9 NALIEITKRYEGLKLTAYRDPGGTWT 34 (43) Q Consensus 9 ~a~i~lIk~~EG~r~~aY~d~~G~wT 34 (43) ..+++||+..|+.+.-+|--+.|.|+ T Consensus 413 ~~A~~lI~elE~t~RG~yaG~iG~~~ 438 (508) T KOG1223 413 VKAMELIDELEGTPRGPYAGPIGGFS 438 (508) T ss_pred HHHHHHHHHHCCCCCCCCCCCCCCCC T ss_conf 87777776533777776567756566 No 11 >pfam11476 TgMIC1 Toxoplasma gondii micronemal protein 1 TgMIC1. TgMIC1 is released as part of a complex by Toxoplasma gondii prior to invasion. The complex which consists of TgMIC4-MIC1-MIC6 participates in host cell attachment and penetration and is critical in invasion. This is the C terminal domain of TgMIC1 which has a Galectin-like fold which interacts with and stabilizes TgMIC6 providing a mechanism for an exit from the early secretory compartments and trafficking of the complex to micronemes. Probab=20.05 E-value=53 Score=17.14 Aligned_cols=17 Identities=47% Similarity=0.945 Sum_probs=12.8 Q ss_pred EECCCC--CEEEECCCCCC Q ss_conf 037899--70662026666 Q gi|254781057|r 26 YRDPGG--TWTIGYGHSGS 42 (43) Q Consensus 26 Y~d~~G--~wTIGyGHTg~ 42 (43) -.||+| +.|||.||.|- T Consensus 62 ~~~~ag~~~ltiglg~~gr 80 (137) T pfam11476 62 VEEPAGPAVLTIGLGHKGR 80 (137) T ss_pred ECCCCCCEEEEEECCCCCE T ss_conf 4068886069984078853 Done!