RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} (A:223-304) Length = 82 Score = 53.0 bits (127), Expect = 1e-08 Identities = 13/29 (44%), Positives = 19/29 (65%) Query: 11 LIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 + E+ + EGL+L Y+D G +TIG GH Sbjct: 3 IFEMLRIDEGLRLKIYKDTEGYYTIGIGH 31 >1xjt_A Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A {Enterobacteria phage P1} (A:1-118,A:160-191) Length = 150 Score = 51.1 bits (122), Expect = 5e-08 Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 2 NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHS 40 NG+ + A +E+ EG + Y P G WT G G++ Sbjct: 25 NGNVRTNQAGLELIGNAEGCRRDPYXCPAGVWTDGIGNT 63 >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3d4s_A* (A:238-318) Length = 81 Score = 50.7 bits (121), Expect = 6e-08 Identities = 13/28 (46%), Positives = 18/28 (64%) Query: 12 IEITKRYEGLKLTAYRDPGGTWTIGYGH 39 E+ + EGL+L Y+D G +TIG GH Sbjct: 3 FEMLRIDEGLRLKIYKDTEGYYTIGIGH 30 >1xju_A Lysozyme; secreted inactive conformation, hydrolase; 1.07A {Enterobacteria phage P1} (A:) Length = 163 Score = 49.3 bits (117), Expect = 2e-07 Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 6 KILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 + A +E+ EG + Y P G WT G G+ Sbjct: 1 RTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGN 34 >1wth_A Protein GP5, tail-associated lysozyme; triple-stranded beta-helix, OB fold, pseudohexamer, T4 tail lysozyme, GP5-GP27; 2.80A {Enterobacteria phage T4} PDB: 2z6b_A 1k28_A 1pdl_A (A:167-354) Length = 188 Score = 49.0 bits (116), Expect = 2e-07 Identities = 14/36 (38%), Positives = 19/36 (52%) Query: 4 SSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 ++ E+ +R EGL+L Y D G TIG GH Sbjct: 3 DDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGH 38 >2anv_A Lysozyme; direct methods, lanthinide binding sites, hydrolase; 1.04A {Enterobacteria phage P22} PDB: 2anx_A (A:) Length = 146 Score = 47.7 bits (113), Expect = 6e-07 Identities = 16/35 (45%), Positives = 20/35 (57%) Query: 6 KILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHS 40 +I + I KR EG +L AY D G TIG GH+ Sbjct: 3 QISSNGITRLKREEGERLKAYSDSRGIPTIGVGHT 37 >3hde_A Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.95A {Enterobacteria phage P21} (A:) Length = 165 Score = 45.1 bits (106), Expect = 3e-06 Identities = 10/37 (27%), Positives = 16/37 (43%) Query: 3 GSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 + +L EG+ Y+D G WT+ +GH Sbjct: 19 AIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGH 55 >1swy_A Lysozyme; RB+ binding sites, AB initio direct methods, hydrolase; 1.06A {Enterobacteria phage T4} (A:) Length = 164 Score = 45.2 bits (106), Expect = 3e-06 Identities = 13/28 (46%), Positives = 18/28 (64%) Query: 12 IEITKRYEGLKLTAYRDPGGTWTIGYGH 39 E+ + EGL+L Y+D G +TIG GH Sbjct: 4 FEMLRIDEGLRLKIYKDTEGYYTIGIGH 31 >2o4w_A Lysozyme; protein folding, protein stability, protein engineering, hydrolase; 1.90A {Enterobacteria phage T4} (A:) Length = 171 Score = 41.7 bits (97), Expect = 3e-05 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 21 LKLTAYRDPGGTWTIGYGH 39 L+L Y+D G +TIG GH Sbjct: 2 LRLKIYKDTEGYYTIGIGH 20 >2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli} (B:94-161) Length = 68 Score = 39.9 bits (93), Expect = 1e-04 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 23 LTAYRDPGGTWTIGYGH 39 L Y+D G +TIG GH Sbjct: 1 LKIYKDTEGYYTIGIGH 17 >1ecm_A Endo-oxabicyclic transition state analogue; P-protein, chorismate mutase domain; HET: TSA; 2.20A {Escherichia coli} (A:) Length = 109 Score = 29.0 bits (65), Expect = 0.23 Identities = 3/29 (10%), Positives = 11/29 (37%) Query: 6 KILNALIEITKRYEGLKLTAYRDPGGTWT 34 ++ +IE + + L + + + Sbjct: 75 RLFQLIIEDSVLTQQALLQQHLNKINPHS 103 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.136 0.424 Gapped Lambda K H 0.267 0.0530 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 343,470 Number of extensions: 9403 Number of successful extensions: 20 Number of sequences better than 10.0: 1 Number of HSP's gapped: 20 Number of HSP's successfully gapped: 11 Length of query: 43 Length of database: 4,956,049 Length adjustment: 15 Effective length of query: 28 Effective length of database: 4,448,974 Effective search space: 124571272 Effective search space used: 124571272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.5 bits)