254781058

254781058

phage-related lysozyme

GeneID in NCBI database:8210081Locus tag:CLIBASIA_04800
Protein GI in NCBI database:254781058Protein Accession:YP_003065471.1
Gene range:+(1062025, 1062333)Protein Length:102aa
Gene description:phage-related lysozyme
COG prediction:[R] Phage-related lysozyme (muraminidase)
KEGG prediction:phage-related lysozyme
SEED prediction:prophage LambdaMc01, lysozyme
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
ccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHEEEEEEEEccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcc
MTITAKEAEDLLLSDLRSHLDLLLdasptlksaseNRLVAVADFVFNlgignynkstfkQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPtlksasenRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKkwtkaggqslrgienrraegatmllng
MTITAKEAEdlllsdlrshldllldASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
254781056171 phage-related lysozyme [Candidatus Liberibacter as 4e-40
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Back     alignment
 Score =  154 bits (388), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%)

Query: 1   MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60
           MTIT KEAED LL D    L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ
Sbjct: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129

Query: 61  RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100
           RVDAQDWEKAAEECKKWTKAGG+ L G+  RR     +LL
Sbjct: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
254781056171 phage-related lysozyme [Candidatus Liberibacter asiatic 1 5e-36
315122346102 phage-related lysozyme [Candidatus Liberibacter solanac 1 6e-21
315122498146 phage-related lysozyme [Candidatus Liberibacter solanac 1 9e-21
315121922149 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-18
315122678102 phage-related lysozyme [Candidatus Liberibacter solanac 1 1e-16
315122565133 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-16
152982881174 phage-related lysozyme [Janthinobacterium sp. Marseille 1 5e-16
78358460148 prophage LambdaMc01, lysozyme [Desulfovibrio desulfuric 1 3e-15
161525479154 glycoside hydrolase family protein [Burkholderia multiv 1 6e-15
152983117171 phage-related lysozyme [Janthinobacterium sp. Marseille 1 2e-14
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Back     alignment and organism information
 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%)

Query: 1   MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60
           MTIT KEAED LL D    L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ
Sbjct: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129

Query: 61  RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100
           RVDAQDWEKAAEECKKWTKAGG+ L G+  RR     +LL
Sbjct: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122346|ref|YP_004062835.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Back     alignment and organism information
>gi|315122498|ref|YP_004062987.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 146 Back     alignment and organism information
>gi|315121922|ref|YP_004062411.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 149 Back     alignment and organism information
>gi|315122678|ref|YP_004063167.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Back     alignment and organism information
>gi|315122565|ref|YP_004063054.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 133 Back     alignment and organism information
>gi|152982881|ref|YP_001354478.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 174 Back     alignment and organism information
>gi|78358460|ref|YP_389909.1| prophage LambdaMc01, lysozyme [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 148 Back     alignment and organism information
>gi|161525479|ref|YP_001580491.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC 17616] Length = 154 Back     alignment and organism information
>gi|152983117|ref|YP_001354418.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 171 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
COG3772152 COG3772, COG3772, Phage-related lysozyme (muraminidase) 8e-11
pfam00959108 pfam00959, Phage_lysozyme, Phage lysozyme 3e-09
cd00737133 cd00737, endolysin_autolysin, Endolysins and autolysins 5e-15
>gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|144526 pfam00959, Phage_lysozyme, Phage lysozyme Back     alignment and domain information
>gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 102 phage-related lysozyme [Candidatus Liberibacter asiatic
cd00737133 endolysin_autolysin Endolysins and autolysins are found 99.97
pfam00959108 Phage_lysozyme Phage lysozyme. This family includes lam 99.96
COG3772152 Phage-related lysozyme (muraminidase) [General function 99.96
cd00735164 bacteriophage_T4-like_lysozyme Bacteriophage T4-like ly 99.17
>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information
>pfam00959 Phage_lysozyme Phage lysozyme Back     alignment and domain information
>COG3772 Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>cd00735 bacteriophage_T4-like_lysozyme Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
3hde_A165 Crystal Structure Of Full-Length Endolysin R21 From 2e-25
3hdf_A140 Crystal Structure Of Truncated Endolysin R21 From P 4e-25
2anv_A146 Crystal Structure Of P22 Lysozyme Mutant L86m Lengt 2e-19
1xju_A163 Crystal Structure Of Secreted Inactive Form Of P1 P 3e-11
1xjt_A191 Crystal Structure Of Active Form Of P1 Phage Endoly 2e-10
3oe6_A 508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 1e-05
3oe0_A499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 1e-05
3odu_A502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 1e-05
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-05
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 2e-05
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 2e-05
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 2e-05
1pqk_A164 Repacking Of The Core Of T4 Lysozyme By Automated D 3e-05
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 3e-05
1p3n_A164 Core Redesign Back-Revertant I103vCORE10 Length = 1 3e-05
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-05
1l70_A164 Multiple Stabilizing Alanine Replacements Within Al 3e-05
1pqd_A164 T4 Lysozyme Core Repacking Mutant Core10TA Length = 4e-05
1p37_A164 T4 Lysozyme Core Repacking Back-Revertant L102mCORE 5e-05
1g0p_A164 Crystal Structure Of T4 Lysozyme Mutant V149g Lengt 6e-05
232l_A164 T4 Lysozyme Mutant M120k Length = 164 6e-05
1dya_A164 Determination Of Alpha-Helix Propensity Within The 6e-05
235l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 6e-05
1epy_A164 T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 7e-05
1dyg_A164 Determination Of Alpha-Helix Propensity Within The 8e-05
1l22_A164 Contributions Of Left-Handed Helical Residues To Th 8e-05
1l55_A164 Analysis Of The Interaction Between Charged Side Ch 8e-05
2a4t_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (V131 1e-04
1p6y_A164 T4 Lysozyme Core Repacking Mutant M120yTA Length = 1e-04
1l71_A164 Multiple Stabilizing Alanine Replacements Within Al 1e-04
1p64_A164 T4 Lysozyme Core Repacking Mutant L133fTA Length = 1e-04
1l33_A164 Contributions Of Left-Handed Helical Residues To Th 1e-04
160l_A164 Control Of Enzyme Activity By An Engineered Disulfi 1e-04
189l_A164 Enhancement Of Protein Stability By The Combination 1e-04
1jtm_A178 Alternative Structures Of A Sequence Extended T4 Ly 1e-04
233l_A164 T4 Lysozyme Mutant M120l Length = 164 1e-04
1g0m_A164 Crystal Structure Of T4 Lysozyme Mutant T152i Lengt 1e-04
1p46_A164 T4 Lysozyme Core Repacking Mutant M106iTA Length = 1e-04
1p2r_A164 T4 Lysozyme Core Repacking Mutant I78vTA Length = 1 1e-04
170l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 1e-04
1pqj_A164 T4 Lysozyme Core Repacking Mutant A111vCORE10TA Len 1e-04
163l_A164 Control Of Enzyme Activity By An Engineered Disulfi 1e-04
2o79_A170 T4 Lysozyme With C-Terminal Extension Length = 170 1e-04
1dye_A164 Determination Of Alpha-Helix Propensity Within The 1e-04
1pqi_A164 T4 Lysozyme Core Repacking Mutant I118lCORE7TA Leng 1e-04
3jr6_A170 Sequential Reorganization Of Beta-Sheet Topology By 1e-04
2o4w_A171 T4 Lysozyme Circular Permutant Length = 171 1e-04
201l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 1e-04
119l_A164 The Energetic Cost And The Structural Consequences 2e-04
1cv5_A164 T4 Lysozyme Mutant L133m Length = 164 2e-04
247l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
259l_A164 An Adaptable Metal-Binding Site Engineered Into T4 2e-04
129l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-04
1l77_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
123l_A164 The Energetic Cost And The Structural Consequences 2e-04
1jqu_A164 Are Carboxy Terminii Of Helices Coded By The Local 2e-04
120l_A164 The Energetic Cost And The Structural Consequences 2e-04
206l_A164 Phage T4 Lysozyme Length = 164 2e-04
221l_A164 The Energetic Cost And The Structural Consequences 2e-04
1l64_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1qt6_A164 E11h Mutant Of T4 Lysozyme Length = 164 2e-04
1t8a_A175 Use Of Sequence Duplication To Engineer A Ligand-Tr 2e-04
1g0l_A164 Crystal Structure Of T4 Lysozyme Mutant T152v Lengt 2e-04
238l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
237l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1qtb_A162 The Introduction Of Strain And Its Effects On The S 2e-04
2huk_A164 Crystal Structure Of T4 Lysozyme V131c Synthetic Di 2e-04
1tla_A164 Hydrophobic Core Repacking And Aromatic-Aromatic In 2e-04
103l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1cv1_A164 T4 Lysozyme Mutant V111m Length = 164 2e-04
1cup_A164 Methionine Core Mutant Of T4 Lysozyme Length = 164 2e-04
234l_A164 T4 Lysozyme Mutant M106l Length = 164 2e-04
1qug_A162 E108v Mutant Of T4 Lysozyme Length = 162 2e-04
2q9d_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 2e-04
1zyt_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (A82r 2e-04
112l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
230l_A164 T4 Lysozyme Mutant M6l Length = 164 2e-04
1p5c_A167 Circular Permutation Of Helix A In T4 Lysozyme Leng 2e-04
1l86_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
254l_A164 Lysozyme Length = 164 2e-04
1qt7_A164 E11n Mutant Of T4 Lysozyme Length = 164 2e-04
1g06_A164 Crystal Structure Of T4 Lysozyme Mutant V149s Lengt 2e-04
1l95_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
130l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-04
1g0j_A164 Crystal Structure Of T4 Lysozyme Mutant T152s Lengt 2e-04
131l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-04
1qt8_A164 T26h Mutant Of T4 Lysozyme Length = 164 2e-04
1p56_A176 Duplication-Extension Of Helix A Of T4 Lysozyme Len 2e-04
1pqm_A164 T4 Lysozyme Core Repacking Mutant V149iT152VTA Leng 2e-04
261l_A173 Structural Characterisation Of An Engineered Tandem 2e-04
1llh_A164 Are Carboxy Terminii Of Helices Coded By The Local 2e-04
1g0q_A164 Crystal Structure Of T4 Lysozyme Mutant V149i Lengt 2e-04
245l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1dyb_A164 Determination Of Alpha-Helix Propensity Within The 2e-04
1c6p_A164 T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 AT 2e-04
126l_A164 The Energetic Cost And The Structural Consequences 2e-04
171l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-04
1t8g_A164 Crystal Structure Of Phage T4 Lysozyme Mutant L32aL 2e-04
107l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
255l_A164 Hydrolase Length = 164 2e-04
1l39_A164 Contributions Of Engineered Surface Salt Bridges To 2e-04
2l78_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
224l_A164 The Energetic Cost And The Structural Consequences 2e-04
3fad_A164 Evaulaution At Atomic Resolution Of The Role Of Str 2e-04
108l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
1qtz_A164 D20c Mutant Of T4 Lysozyme Length = 164 2e-04
114l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
115l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
1l23_A164 Enhanced Protein Thermostability From Site-Directed 2e-04
1qt3_A164 T26d Mutant Of T4 Lysozyme Length = 164 2e-04
1l87_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
1l66_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1cu2_A164 T4 Lysozyme Mutant L84m Length = 164 2e-04
1p36_A164 T4 Lyoszyme Core Repacking Mutant I100vTA Length = 2e-04
3g3w_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (T151 2e-04
176l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-04
137l_A164 Structural Basis Of Amino Acid Alpha Helix Propensi 2e-04
102l_A165 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1l35_A164 Structure Of A Thermostable Disulfide-Bridge Mutant 2e-04
1l67_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1g07_A164 Crystal Structure Of T4 Lysozyme Mutant V149c Lengt 2e-04
1g0k_A164 Crystal Structure Of T4 Lysozyme Mutant T152c Lengt 2e-04
3c80_A164 T4 Lysozyme Mutant R96y At Room Temperature Length 2e-04
3c82_A164 Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H 2e-04
111l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
253l_A164 Lysozyme Length = 164 2e-04
1l65_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1l61_A164 Analysis Of The Interaction Between Charged Side Ch 2e-04
1qt5_A164 D20e Mutant Structure Of T4 Lysozyme Length = 164 2e-04
2hul_A164 Crystal Structure Of T4 Lysozyme S44c Synthetic Dim 2e-04
1t8f_A164 Crystal Structure Of Phage T4 Lysozyme Mutant R14aK 2e-04
1qt4_A164 T26q Mutant Of T4 Lysozyme Length = 164 2e-04
1c60_A164 T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 2e-04
1l88_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
110l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
109l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
104l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1l47_A164 Cumulative Site-Directed Charge-Change Replacements 2e-04
213l_A165 Protein Structure Plasticity Exemplified By Inserti 2e-04
1d2w_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-04
217l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
1cv6_A164 T4 Lysozyme Mutant V149m Length = 164 2e-04
242l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1g0g_A164 Crystal Structure Of T4 Lysozyme Mutant T152a Lengt 2e-04
148l_E164 A Covalent Enzyme-Substrate Intermediate With Sacch 2e-04
241l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1d2y_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-04
122l_A164 The Energetic Cost And The Structural Consequences 2e-04
239l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1l81_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
240l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1l68_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1dyf_A164 Determination Of Alpha-Helix Propensity Within The 2e-04
1l80_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
1i6s_A164 T4 Lysozyme Mutant C54tC97AN101A Length = 164 2e-04
1cu5_A164 T4 Lysozyme Mutant L91m Length = 164 2e-04
2q9e_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 2e-04
1oyu_A175 Long-Distance Conformational Changes In A Protein E 2e-04
205l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1kw7_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 2e-04
1l82_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
165l_A164 Control Of Enzyme Activity By An Engineered Disulfi 2e-04
159l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-04
1l94_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
244l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-04
1d3j_A164 N-Terminal Domain Core Methionine Mutation Length = 3e-04
3f9l_A164 Evaulaution At Atomic Resolution Of The Role Of Str 3e-04
1l93_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
212l_A168 Protein Structure Plasticity Exemplified By Inserti 3e-04
1l41_A164 Contributions Of Engineered Surface Salt Bridges To 3e-04
216l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-04
1l24_A164 Enhanced Protein Thermostability From Site-Directed 3e-04
161l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-04
1l45_A164 Cumulative Site-Directed Charge-Change Replacements 3e-04
174l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-04
3c81_A164 Mutant K85a Of T4 Lysozyme In Wildtype Background A 3e-04
113l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-04
1l91_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
1dyc_A164 Determination Of Alpha-Helix Propensity Within The 3e-04
248l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-04
3cdr_A164 R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K 3e-04
150l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 3e-04
1l92_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
1l34_A164 High-Resolution Structure Of The Temperature-Sensit 3e-04
1pqo_A164 T4 Lysozyme Core Repacking Mutant L118iTA Length = 3e-04
1p7s_A164 T4 Lysozyme Core Repacking Mutant V103iTA Length = 3e-04
3c7z_A164 T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Len 3e-04
1l79_A164 Design And Structural Analysis Of Alternative Hydro 3e-04
1qsq_A164 Cavity Creating Mutation Length = 164 3e-04
211l_A165 Protein Structure Plasticity Exemplified By Inserti 3e-04
1l97_A164 Structure Of A Hinge-Bending Bacteriophage T4 Lysoz 3e-04
1l21_A164 Contributions Of Left-Handed Helical Residues To Th 3e-04
1kw5_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 3e-04
1cv4_A164 T4 Lysozyme Mutant L118m Length = 164 3e-04
1l14_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
1l52_A164 Structural And Thermodynamic Analysis Of The Packin 3e-04
1ssw_A164 Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY 3e-04
1l08_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
1l09_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
229l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 3e-04
1l10_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 3e-04
2nth_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 3e-04
1ssy_A164 Crystal Structure Of Phage T4 Lysozyme Mutant G28aI 3e-04
1l15_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
1lyd_A164 Crystal Structure Of T4-Lysozyme Generated From Syn 3e-04
1cvk_A164 T4 Lysozyme Mutant L118a Length = 164 3e-04
1l76_A164 Tolerance Of T4 Lysozyme To Proline Substitutions W 3e-04
3fa0_A162 Evaulaution At Atomic Resolution Of The Role Of Str 3e-04
1l46_A164 Cumulative Site-Directed Charge-Change Replacements 3e-04
1l17_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 3e-04
1t6h_A164 Crystal Structure T4 Lysozyme Incorporating An Unna 4e-04
1ky0_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 4e-04
1l42_A164 Cumulative Site-Directed Charge-Change Replacements 4e-04
1l57_A164 Analysis Of The Interaction Between Charged Side Ch 4e-04
1l07_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
1l04_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
3c83_A164 Bacteriophage T4 Lysozyme Mutant D89a In Wildtype B 4e-04
3hwl_A164 Crystal Structure Of T4 Lysozyme With The Unnatural 4e-04
2igc_A164 Structure Of Spin Labeled T4 Lysozyme Mutant T115r1 4e-04
1l16_A164 Structural Analysis Of The Temperature-Sensitive Mu 4e-04
1l53_A164 Structural And Thermodynamic Analysis Of The Packin 4e-04
1l19_A164 Enhanced Protein Thermostability From Designed Muta 4e-04
1l12_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
1l03_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
1l11_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
172l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 4e-04
1l18_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 4e-04
3dke_X164 Polar And Non-Polar Cavities In Phage T4 Lysozyme L 4e-04
162l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-04
167l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 4e-04
166l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-04
149l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 4e-04
1c69_A164 T4 Lysozyme Mutant C54tC97AL133A IN THE PRESENCE OF 4e-04
1l01_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 4e-04
2b7w_B170 Sequential Reorganization Of Beta-Sheet Topology By 4e-04
1l06_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
164l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-04
1l02_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
177l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 4e-04
1l98_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 4e-04
231l_A164 T4 Lysozyme Mutant M106k Length = 164 4e-04
3c7w_A164 Contributions Of All 20 Amino Acids At Site 96 To T 4e-04
1cv3_A164 T4 Lysozyme Mutant L121m Length = 164 4e-04
1swy_A164 Use Of A Halide Binding Site To Bypass The 1000-Ato 4e-04
1cuq_A164 T4 Lysozyme Mutant V103m Length = 164 4e-04
1l56_A164 Analysis Of The Interaction Between Charged Side Ch 4e-04
1g1w_A164 T4 Lysozyme Mutant C54tC97AQ105M Length = 164 4e-04
220l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 4e-04
1lyf_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 4e-04
1l13_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
3fi5_A164 Crystal Structure Of T4 Lysozyme Mutant R96w Length 4e-04
1quh_A162 L99gE108V MUTANT OF T4 LYSOZYME Length = 162 4e-04
1l60_A164 Analysis Of The Interaction Between Charged Side Ch 4e-04
1quo_A162 L99aE108V MUTANT OF T4 LYSOZYME Length = 162 5e-04
155l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-04
1l72_A164 Multiple Stabilizing Alanine Replacements Within Al 5e-04
128l_A164 The Energetic Cost And The Structural Consequences 5e-04
196l_A164 Thermodynamic And Structural Compensation In "size- 5e-04
151l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 5e-04
1l58_A164 Analysis Of The Interaction Between Charged Side Ch 5e-04
1c63_A164 T4 Lysozyme Mutant C54tC97AL121A IN THE PRESENCE OF 5e-04
1l00_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 5e-04
125l_A164 The Energetic Cost And The Structural Consequences 5e-04
175l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 5e-04
3cdv_A164 Contributions Of All 20 Amino Acids At Site 96 To T 5e-04
2b6t_A162 T4 Lysozyme Mutant L99a At 200 Mpa Length = 162 5e-04
158l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-04
1c6c_A164 T4 Lysozyme Mutant C54tC97AL99A IN THE PRESENCE OF 5e-04
1qud_A162 L99g Mutant Of T4 Lysozyme Length = 162 5e-04
1qsb_A162 The Introduction Of Strain And Its Effects On The S 5e-04
197l_A164 Thermodynamic And Structural Compensation In "size- 5e-04
143l_A164 Role Of Backbone Flexibility In The Accommodation O 5e-04
173l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 5e-04
2qb0_B241 Structure Of The 2tel Crystallization Module Fused 5e-04
1c66_A164 T4 Lysozyme Mutant C54tC97AL121AL133A IN THE PRESEN 5e-04
1l38_A164 Contributions Of Engineered Surface Salt Bridges To 5e-04
3c8s_A164 Contributions Of All 20 Amino Acids At Site 96 To T 5e-04
1c6l_A164 T4 Lysozyme Mutant C54tC97AL99AF153A IN THE PRESENC 5e-04
1cu0_A164 T4 Lysozyme Mutant I78m Length = 164 6e-04
1b6i_A164 T4 Lysozyme Mutant With Cys 54 Replaced By Thr, Cys 6e-04
1l59_A164 Analysis Of The Interaction Between Charged Side Ch 6e-04
1l37_A164 Contributions Of Engineered Surface Salt Bridges To 6e-04
1ctw_A164 T4 Lysozyme Mutant I78a Length = 164 6e-04
2hum_A164 Crystal Structure Of T4 Lysozyme D72c Synthetic Dim 6e-04
3cdo_A164 Bacteriophage T4 Lysozyme Mutant R96v In Wildtype B 6e-04
252l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 6e-04
1qth_A164 The Introduction Of Strain And Its Effects On The S 6e-04
1qs9_A162 The Introduction Of Strain And Its Effects On The S 6e-04
1ks3_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 6e-04
3k2r_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 6e-04
1p2l_A164 T4 Lysozyme Core Repacking Mutant V87iTA Length = 1 6e-04
1l62_A164 Analysis Of The Interaction Between Charged Side Ch 7e-04
3c8q_A164 Contribution Of All 20 Amino Acids At Site 96 To Th 7e-04
1l99_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 7e-04
1l0k_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 7e-04
1cu6_A164 T4 Lysozyme Mutant L91a Length = 164 7e-04
2ou9_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant T115r1 7e-04
236l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 7e-04
139l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 7e-04
142l_A164 Role Of Backbone Flexibility In The Accommodation O 7e-04
156l_A164 Control Of Enzyme Activity By An Engineered Disulfi 7e-04
1ky1_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 8e-04
1d9w_A164 Bacteriophage T4 Lysozyme Mutant Length = 164 8e-04
1d3f_A164 N-Terminal Domain Core Methionine Mutation Length = 8e-04
1l54_A164 The Structural And Thermodynamic Consequences Of Bu 8e-04
1l32_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
3cdq_A164 Contributions Of All 20 Amino Acids At Site 96 To T 8e-04
1l28_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
1l29_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
3c7y_A164 Mutant R96a Of T4 Lysozyme In Wildtype Background A 8e-04
2qar_C163 Structure Of The 2tel Crystallization Module Fused 8e-04
1l27_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
1qs5_A162 The Introduction Of Strain And Its Effects On The S 8e-04
1cx7_A164 T4 Lysozyme Methionine Core Mutant Length = 164 8e-04
1l26_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
190l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 8e-04
1l30_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 9e-04
127l_A164 The Energetic Cost And The Structural Consequences 9e-04
1cu3_A164 T4 Lysozyme Mutant V87m Length = 164 9e-04
3cdt_A164 Contributions Of All 20 Amino Acids At Site 96 To T 0.001
1l25_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 0.001
138l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 0.001
1l44_A164 Cumulative Site-Directed Charge-Change Replacements 0.001
246l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.001
1d3m_A164 Methionine Core Mutation Length = 164 0.001
3dn8_A164 Iodopentafluorobenzene Binding In The Hydrophobic C 0.001
1l51_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
1l49_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
1l48_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
195l_A164 Thermodynamic And Structural Compensation In "size- 0.001
1l31_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 0.001
141l_A164 Role Of Backbone Flexibility In The Accommodation O 0.001
1qtc_A162 The Introduction Of Strain And Its Effects On The S 0.001
3c8r_A164 Contributions Of All 20 Amino Acids At Site 96 To S 0.001
199l_A164 Thermodynamic And Structural Compensation In "size- 0.001
144l_A164 Role Of Backbone Flexibility In The Accommodation O 0.001
1l0j_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 0.001
1l50_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
140l_A164 Role Of Backbone Flexibility In The Accommodation O 0.001
1cv0_A164 T4 Lysozyme Mutant F104m Length = 164 0.001
2z6b_A 584 Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugate 0.002
1wth_A 584 Crystal Structure Of Gp5-S351l Mutant And Gp27 Comp 0.002
1pdl_A 575 Fitting Of Gp5 In The Cryoem Reconstruction Of The 0.002
1k28_A 584 The Structure Of The Bacteriophage T4 Cell-Puncturi 0.002
1lgu_A164 T4 Lysozyme Mutant L99aM102Q Length = 164 0.002
2rbn_A162 N-Phenylglycinonitrile In Complex With T4 Lysozyme 0.002
3l2x_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 0.002
146l_A164 Role Of Backbone Flexibility In The Accommodation O 0.002
215l_A165 Protein Structure Plasticity Exemplified By Inserti 0.002
227l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 0.002
1lyg_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 0.002
1lyi_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 0.002
210l_A163 Protein Structure Plasticity Exemplified By Inserti 0.002
1g1v_A164 T4 Lysozyme Mutant C54tC97AI58T Length = 164 0.002
198l_A164 Thermodynamic And Structural Compensation In "size- 0.002
243l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.003
214l_A165 Protein Structure Plasticity Exemplified By Inserti 0.003
1lwg_A164 Multiple Methionine Substitutions Are Tolerated In 0.003
249l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.003
250l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.003
218l_A165 Protein Structure Plasticity Exemplified By Inserti 2e-04
1kni_A164 Stabilizing Disulfide Bridge Mutant Of T4 Lysozyme 3e-04
223l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 4e-04
1l20_A164 Enhanced Protein Thermostability From Designed Muta 4e-04
1dyd_A164 Determination Of Alpha-Helix Propensity Within The 4e-04
147l_A164 Role Of Backbone Flexibility In The Accommodation O 4e-04
118l_A164 The Energetic Cost And The Structural Consequences 5e-04
152l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 5e-04
3huq_A162 Thieno[3,2-B]thiophene In Complex With T4 Lysozyme 0.002
3ht6_A164 2-Methylphenol In Complex With T4 Lysozyme L99aM102 0.002
1qtd_A162 The Introduction Of Strain And Its Effects On The S 0.002
145l_A164 Role Of Backbone Flexibility In The Accommodation O 0.002
169l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 0.003
3guj_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 0.004
3gui_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 0.004
192l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 0.004
168l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 0.004
1l74_A164 Multiple Stabilizing Alanine Replacements Within Al 0.004
1l36_A164 Toward A Simplification Of The Protein Folding Prob 0.004
gi|262367957|pdb|3HDE|A Chain A, Crystal Structure Of Full-Length Endolysin R21 From Phage 21 Length = 165 Back     alignment and structure
 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 2/101 (1%)

Query: 2   TITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQR 61
           T T  E + LL  DL +    +           E    A+  FV+N+G GN+  ST  ++
Sbjct: 65  TYTKAECKALLNKDLATVARQINPYIKV--DIPETMRGALYSFVYNVGAGNFRTSTLLRK 122

Query: 62  VDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG 102
           ++  D + A ++ ++WT AGG+  +G+  RR     + L G
Sbjct: 123 INQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWG 163


>gi|262367961|pdb|3HDF|A Chain A, Crystal Structure Of Truncated Endolysin R21 From Phage 21 Length = 140 Back     alignment and structure
>gi|90108744|pdb|2ANV|A Chain A, Crystal Structure Of P22 Lysozyme Mutant L86m Length = 146 Back     alignment and structure
>gi|60594001|pdb|1XJU|A Chain A, Crystal Structure Of Secreted Inactive Form Of P1 Phage Endolysin Lyz Length = 163 Back     alignment and structure
>gi|60594000|pdb|1XJT|A Chain A, Crystal Structure Of Active Form Of P1 Phage Endolysin Lyz Length = 191 Back     alignment and structure
>gi|310689932|pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>gi|310689930|pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>gi|310689928|pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>gi|310943018|pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>gi|319443693|pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>gi|209447557|pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>gi|159795485|pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein-Coupled Receptor Length = 500 Back     alignment and structure
>gi|37927585|pdb|1PQK|A Chain A, Repacking Of The Core Of T4 Lysozyme By Automated Design Length = 164 Back     alignment and structure
>gi|190613726|pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>gi|37927389|pdb|1P3N|A Chain A, Core Redesign Back-Revertant I103vCORE10 Length = 164 Back     alignment and structure
>gi|317455410|pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>gi|157831726|pdb|1L70|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|37927571|pdb|1PQD|A Chain A, T4 Lysozyme Core Repacking Mutant Core10TA Length = 164 Back     alignment and structure
>gi|37927387|pdb|1P37|A Chain A, T4 Lysozyme Core Repacking Back-Revertant L102mCORE10 Length = 164 Back     alignment and structure
>gi|14488752|pdb|1G0P|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149g Length = 164 Back     alignment and structure
>gi|157834489|pdb|232L|A Chain A, T4 Lysozyme Mutant M120k Length = 164 Back     alignment and structure
>gi|157830899|pdb|1DYA|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834492|pdb|235L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|7767116|pdb|1EPY|A Chain A, T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 164 Back     alignment and structure
>gi|157830905|pdb|1DYG|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831678|pdb|1L22|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831711|pdb|1L55|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|110590780|pdb|2A4T|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (V131r7) Length = 164 Back     alignment and structure
>gi|37927425|pdb|1P6Y|A Chain A, T4 Lysozyme Core Repacking Mutant M120yTA Length = 164 Back     alignment and structure
>gi|157831727|pdb|1L71|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|37927410|pdb|1P64|A Chain A, T4 Lysozyme Core Repacking Mutant L133fTA Length = 164 Back     alignment and structure
>gi|157831689|pdb|1L33|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829593|pdb|160L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157829619|pdb|189L|A Chain A, Enhancement Of Protein Stability By The Combination Of Point Mutations In T4 Lysozyme Is Additive Length = 164 Back     alignment and structure
>gi|20150541|pdb|1JTM|A Chain A, Alternative Structures Of A Sequence Extended T4 Lysozyme Show That The Highly Conserved Beta-Sheet Has Weak Intrinsic Folding Propensity Length = 178 Back     alignment and structure
>gi|157834490|pdb|233L|A Chain A, T4 Lysozyme Mutant M120l Length = 164 Back     alignment and structure
>gi|14488751|pdb|1G0M|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152i Length = 164 Back     alignment and structure
>gi|37927406|pdb|1P46|A Chain A, T4 Lysozyme Core Repacking Mutant M106iTA Length = 164 Back     alignment and structure
>gi|37927383|pdb|1P2R|A Chain A, T4 Lysozyme Core Repacking Mutant I78vTA Length = 164 Back     alignment and structure
>gi|157829601|pdb|170L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|37927583|pdb|1PQJ|A Chain A, T4 Lysozyme Core Repacking Mutant A111vCORE10TA Length = 164 Back     alignment and structure
>gi|157829596|pdb|163L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|146387591|pdb|2O79|A Chain A, T4 Lysozyme With C-Terminal Extension Length = 170 Back     alignment and structure
>gi|157830903|pdb|1DYE|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|37927581|pdb|1PQI|A Chain A, T4 Lysozyme Core Repacking Mutant I118lCORE7TA Length = 164 Back     alignment and structure
>gi|261825045|pdb|3JR6|A Chain A, Sequential Reorganization Of Beta-Sheet Topology By Insertion Of A Single Strand Length = 170 Back     alignment and structure
>gi|146387572|pdb|2O4W|A Chain A, T4 Lysozyme Circular Permutant Length = 171 Back     alignment and structure
>gi|494717|pdb|201L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 Back     alignment and structure
>gi|157829547|pdb|119L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729790|pdb|1CV5|A Chain A, T4 Lysozyme Mutant L133m Length = 164 Back     alignment and structure
>gi|157834504|pdb|247L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|4930159|pdb|259L|A Chain A, An Adaptable Metal-Binding Site Engineered Into T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829556|pdb|129L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|157831733|pdb|1L77|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829551|pdb|123L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|20150496|pdb|1JQU|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|157829548|pdb|120L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834454|pdb|206L|A Chain A, Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834475|pdb|221L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831720|pdb|1L64|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|5822356|pdb|1QT6|A Chain A, E11h Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|52695672|pdb|1T8A|A Chain A, Use Of Sequence Duplication To Engineer A Ligand-Triggered Long-Distance Molecular Switch In T4 Lysosyme Length = 175 Back     alignment and structure
>gi|14488750|pdb|1G0L|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152v Length = 164 Back     alignment and structure
>gi|157834495|pdb|238L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157834494|pdb|237L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|5542484|pdb|1QTB|A Chain A, The Introduction Of Strain And Its Effects On The Structure And Stability Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|118137974|pdb|2HUK|A Chain A, Crystal Structure Of T4 Lysozyme V131c Synthetic Dimer Length = 164 Back     alignment and structure
>gi|157833964|pdb|1TLA|A Chain A, Hydrophobic Core Repacking And Aromatic-Aromatic Interaction In The Thermostable Mutant Of T4 Lysozyme Ser 117 (Right Arrow) Phe Length = 164 Back     alignment and structure
>gi|157829526|pdb|103L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 167 Back     alignment and structure
>gi|9257165|pdb|1CV1|A Chain A, T4 Lysozyme Mutant V111m Length = 164 Back     alignment and structure
>gi|6729784|pdb|1CUP|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834491|pdb|234L|A Chain A, T4 Lysozyme Mutant M106l Length = 164 Back     alignment and structure
>gi|5822381|pdb|1QUG|A Chain A, E108v Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|151567976|pdb|2Q9D|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 Length = 164 Back     alignment and structure
>gi|114793376|pdb|1ZYT|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (A82r1) Length = 164 Back     alignment and structure
>gi|157829541|pdb|112L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834487|pdb|230L|A Chain A, T4 Lysozyme Mutant M6l Length = 164 Back     alignment and structure
>gi|48425202|pdb|1P5C|A Chain A, Circular Permutation Of Helix A In T4 Lysozyme Length = 167 Back     alignment and structure
>gi|157831741|pdb|1L86|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834512|pdb|254L|A Chain A, Lysozyme Length = 164 Back     alignment and structure
>gi|5822357|pdb|1QT7|A Chain A, E11n Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|14488744|pdb|1G06|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149s Length = 164 Back     alignment and structure
>gi|157831750|pdb|1L95|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157829558|pdb|130L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|14488748|pdb|1G0J|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152s Length = 164 Back     alignment and structure
>gi|157829559|pdb|131L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|5822358|pdb|1QT8|A Chain A, T26h Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157879603|pdb|1P56|A Chain A, Duplication-Extension Of Helix A Of T4 Lysozyme Length = 176 Back     alignment and structure
>gi|37927589|pdb|1PQM|A Chain A, T4 Lysozyme Core Repacking Mutant V149iT152VTA Length = 164 Back     alignment and structure
>gi|5107702|pdb|261L|A Chain A, Structural Characterisation Of An Engineered Tandem Repeat Contrasts The Importance Of Context And Sequence In Protein Folding Length = 173 Back     alignment and structure
>gi|21466123|pdb|1LLH|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|14488753|pdb|1G0Q|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149i Length = 164 Back     alignment and structure
>gi|157834502|pdb|245L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157830900|pdb|1DYB|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|10835387|pdb|1C6P|A Chain A, T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 ATM ARGON Length = 164 Back     alignment and structure
>gi|157829553|pdb|126L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829602|pdb|171L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|56553847|pdb|1T8G|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant L32aL33AT34AC54TC97AE108V Length = 164 Back     alignment and structure
>gi|157829531|pdb|107L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834514|pdb|255L|A Chain A, Hydrolase Length = 164 Back     alignment and structure
>gi|157831695|pdb|1L39|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|157835299|pdb|2L78|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834479|pdb|224L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|223674040|pdb|3FAD|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 164 Back     alignment and structure
>gi|157829533|pdb|108L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|5822379|pdb|1QTZ|A Chain A, D20c Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829544|pdb|114L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829545|pdb|115L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831679|pdb|1L23|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|5822353|pdb|1QT3|A Chain A, T26d Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831742|pdb|1L87|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157831722|pdb|1L66|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|9257162|pdb|1CU2|A Chain A, T4 Lysozyme Mutant L84m Length = 164 Back     alignment and structure
>gi|37927385|pdb|1P36|A Chain A, T4 Lyoszyme Core Repacking Mutant I100vTA Length = 164 Back     alignment and structure
>gi|229597880|pdb|3G3W|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (T151r1) At 291 K Length = 164 Back     alignment and structure
>gi|1065176|pdb|176L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|575962|pdb|137L|A Chain A, Structural Basis Of Amino Acid Alpha Helix Propensity Length = 164 Back     alignment and structure
>gi|157829524|pdb|102L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 165 Back     alignment and structure
>gi|157831691|pdb|1L35|A Chain A, Structure Of A Thermostable Disulfide-Bridge Mutant Of Phage T4 Lysozyme Shows That An Engineered Crosslink In A Flexible Region Does Not Increase The Rigidity Of The Folded Protein Length = 164 Back     alignment and structure
>gi|157831723|pdb|1L67|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|14488745|pdb|1G07|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149c Length = 164 Back     alignment and structure
>gi|14488749|pdb|1G0K|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152c Length = 164 Back     alignment and structure
>gi|223673907|pdb|3C80|A Chain A, T4 Lysozyme Mutant R96y At Room Temperature Length = 164 Back     alignment and structure
>gi|223673909|pdb|3C82|A Chain A, Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H Length = 164 Back     alignment and structure
>gi|157829539|pdb|111L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834511|pdb|253L|A Chain A, Lysozyme Length = 164 Back     alignment and structure
>gi|157831721|pdb|1L65|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157831717|pdb|1L61|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|5822355|pdb|1QT5|A Chain A, D20e Mutant Structure Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|118137975|pdb|2HUL|A Chain A, Crystal Structure Of T4 Lysozyme S44c Synthetic Dimer Length = 164 Back     alignment and structure
>gi|56553846|pdb|1T8F|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant R14aK16AI17AK19AT21AE22AC54TC97A Length = 164 Back     alignment and structure
>gi|5822354|pdb|1QT4|A Chain A, T26q Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|10835363|pdb|1C60|A Chain A, T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 8 ATM Argon Length = 164 Back     alignment and structure
>gi|157831743|pdb|1L88|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157829537|pdb|110L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829535|pdb|109L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|442543|pdb|104L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 Back     alignment and structure
>gi|157831703|pdb|1L47|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|157834467|pdb|213L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back     alignment and structure
>gi|6729794|pdb|1D2W|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157834470|pdb|217L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729791|pdb|1CV6|A Chain A, T4 Lysozyme Mutant V149m Length = 164 Back     alignment and structure
>gi|157834499|pdb|242L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|14488747|pdb|1G0G|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152a Length = 164 Back     alignment and structure
>gi|515062|pdb|148L|E Chain E, A Covalent Enzyme-Substrate Intermediate With Saccharide Distortion In A Mutant T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834498|pdb|241L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729795|pdb|1D2Y|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157829550|pdb|122L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834496|pdb|239L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831736|pdb|1L81|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834497|pdb|240L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831724|pdb|1L68|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157830904|pdb|1DYF|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831735|pdb|1L80|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|14277939|pdb|1I6S|A Chain A, T4 Lysozyme Mutant C54tC97AN101A Length = 164 Back     alignment and structure
>gi|6729782|pdb|1CU5|A Chain A, T4 Lysozyme Mutant L91m Length = 164 Back     alignment and structure
>gi|151567977|pdb|2Q9E|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 Length = 164 Back     alignment and structure
>gi|33357813|pdb|1OYU|A Chain A, Long-Distance Conformational Changes In A Protein Engineered By Modulated Sequence Duplication Length = 175 Back     alignment and structure
>gi|157834451|pdb|205L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 167 Back     alignment and structure
>gi|31615480|pdb|1KW7|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|157831737|pdb|1L82|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829598|pdb|165L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157829592|pdb|159L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157831749|pdb|1L94|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834501|pdb|244L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729797|pdb|1D3J|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|223674038|pdb|3F9L|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 164 Back     alignment and structure
>gi|157831748|pdb|1L93|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834466|pdb|212L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 168 Back     alignment and structure
>gi|157831697|pdb|1L41|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|576360|pdb|216L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831680|pdb|1L24|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|157829594|pdb|161L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157831701|pdb|1L45|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|1065158|pdb|174L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|223673908|pdb|3C81|A Chain A, Mutant K85a Of T4 Lysozyme In Wildtype Background At Room Temperature Length = 164 Back     alignment and structure
>gi|157829543|pdb|113L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831746|pdb|1L91|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157830901|pdb|1DYC|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834505|pdb|248L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|223673921|pdb|3CDR|A Chain A, R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K Length = 164 Back     alignment and structure
>gi|515066|pdb|150L|A Chain A, Conservation Of Solvent-Binding Sites In 10 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831747|pdb|1L92|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157831690|pdb|1L34|A Chain A, High-Resolution Structure Of The Temperature-Sensitive Mutant Of Phage Lysozyme, Arg 96 (Right Arrow) His Length = 164 Back     alignment and structure
>gi|37927591|pdb|1PQO|A Chain A, T4 Lysozyme Core Repacking Mutant L118iTA Length = 164 Back     alignment and structure
>gi|37927436|pdb|1P7S|A Chain A, T4 Lysozyme Core Repacking Mutant V103iTA Length = 164 Back     alignment and structure
>gi|223673906|pdb|3C7Z|A Chain A, T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Length = 164 Back     alignment and structure
>gi|157831734|pdb|1L79|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729807|pdb|1QSQ|A Chain A, Cavity Creating Mutation Length = 164 Back     alignment and structure
>gi|157834465|pdb|211L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back     alignment and structure
>gi|443083|pdb|1L97|A Chain A, Structure Of A Hinge-Bending Bacteriophage T4 Lysozyme Mutant, Ile3-> Pro Length = 164 Back     alignment and structure
>gi|157831677|pdb|1L21|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|31615479|pdb|1KW5|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|6729789|pdb|1CV4|A Chain A, T4 Lysozyme Mutant L118m Length = 164 Back     alignment and structure
>gi|157831670|pdb|1L14|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831708|pdb|1L52|A Chain A, Structural And Thermodynamic Analysis Of The Packing Of Two Alpha-Helices In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|56553736|pdb|1SSW|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY25AT26AI27AC54TC97A Length = 164 Back     alignment and structure
>gi|157831664|pdb|1L08|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831665|pdb|1L09|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834485|pdb|229L|A Chain A, Generating Ligand Binding Sites In T4 Lysozyme Using Deficiency-Creating Substitutions Length = 164 Back     alignment and structure
>gi|157831666|pdb|1L10|A Chain A, Structural Studies Of Mutants Of The Lysozyme Of Bacteriophage T4. The Temperature-Sensitive Mutant Protein Thr157 (Right Arrow) Ile Length = 164 Back     alignment and structure
>gi|149242489|pdb|2NTH|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 Length = 164 Back     alignment and structure
>gi|56553737|pdb|1SSY|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant G28aI29AG30AC54TC97A Length = 164 Back     alignment and structure
>gi|157831671|pdb|1L15|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
gi|157831899|pdb|1LYD|A Chain A, Crystal Structure Of T4-Lysozyme Generated From Synthetic Coding Dna Expressed In Escherichia Coli Length = 164 Back     alignment and structure
>gi|6729792|pdb|1CVK|A Chain A, T4 Lysozyme Mutant L118a Length = 164 Back     alignment and structure
>gi|157831732|pdb|1L76|A Chain A, Tolerance Of T4 Lysozyme To Proline Substitutions Within The Long Interdomain Alpha-Helix Illustrates The Adaptability Of Proteins To Potentially Destabilizing Lesions Length = 164 Back     alignment and structure
>gi|223674039|pdb|3FA0|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 162 Back     alignment and structure
>gi|157831702|pdb|1L46|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|157831673|pdb|1L17|A Chain A, Hydrophobic Stabilization In T4 Lysozyme Determined Directly By Multipl