254781058

254781058

phage-related lysozyme

GeneID in NCBI database:8210081Locus tag:CLIBASIA_04800
Protein GI in NCBI database:254781058Protein Accession:YP_003065471.1
Gene range:+(1062025, 1062333)Protein Length:102aa
Gene description:phage-related lysozyme
COG prediction:[R] Phage-related lysozyme (muraminidase)
KEGG prediction:phage-related lysozyme
SEED prediction:prophage LambdaMc01, lysozyme
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
ccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHEEEEEEEEccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcc
MTITAKEAEDLLLSDLRSHLDLLLdasptlksaseNRLVAVADFVFNlgignynkstfkQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPtlksasenRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKkwtkaggqslrgienrraegatmllng
MTITAKEAEdlllsdlrshldllldASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG
MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
254781056171 phage-related lysozyme [Candidatus Liberibacter as 4e-40
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Back     alignment 
 Score =  154 bits (388), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%)

Query: 1   MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60
           MTIT KEAED LL D    L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ
Sbjct: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129

Query: 61  RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100
           RVDAQDWEKAAEECKKWTKAGG+ L G+  RR     +LL
Sbjct: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
254781056171 phage-related lysozyme [Candidatus Liberibacter asiatic 1 5e-36
315122346102 phage-related lysozyme [Candidatus Liberibacter solanac 1 6e-21
315122498146 phage-related lysozyme [Candidatus Liberibacter solanac 1 9e-21
315121922149 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-18
315122678102 phage-related lysozyme [Candidatus Liberibacter solanac 1 1e-16
315122565133 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-16
152982881174 phage-related lysozyme [Janthinobacterium sp. Marseille 1 5e-16
78358460148 prophage LambdaMc01, lysozyme [Desulfovibrio desulfuric 1 3e-15
161525479154 glycoside hydrolase family protein [Burkholderia multiv 1 6e-15
152983117171 phage-related lysozyme [Janthinobacterium sp. Marseille 1 2e-14
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Back     alignment and organism information
 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%)

Query: 1   MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60
           MTIT KEAED LL D    L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ
Sbjct: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129

Query: 61  RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100
           RVDAQDWEKAAEECKKWTKAGG+ L G+  RR     +LL
Sbjct: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169



Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122346|ref|YP_004062835.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Back     alignment and organism information
>gi|315122498|ref|YP_004062987.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 146 Back     alignment and organism information
>gi|315121922|ref|YP_004062411.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 149 Back     alignment and organism information
>gi|315122678|ref|YP_004063167.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Back     alignment and organism information
>gi|315122565|ref|YP_004063054.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 133 Back     alignment and organism information
>gi|152982881|ref|YP_001354478.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 174 Back     alignment and organism information
>gi|78358460|ref|YP_389909.1| prophage LambdaMc01, lysozyme [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 148 Back     alignment and organism information
>gi|161525479|ref|YP_001580491.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC 17616] Length = 154 Back     alignment and organism information
>gi|152983117|ref|YP_001354418.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 171 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
COG3772152 COG3772, COG3772, Phage-related lysozyme (muraminidase) 8e-11
pfam00959108 pfam00959, Phage_lysozyme, Phage lysozyme 3e-09
cd00737133 cd00737, endolysin_autolysin, Endolysins and autolysins 5e-15
>gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|144526 pfam00959, Phage_lysozyme, Phage lysozyme Back     alignment and domain information
>gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 102 phage-related lysozyme [Candidatus Liberibacter asiatic
cd00737133 endolysin_autolysin Endolysins and autolysins are found 99.97
pfam00959108 Phage_lysozyme Phage lysozyme. This family includes lam 99.96
COG3772152 Phage-related lysozyme (muraminidase) [General function 99.96
cd00735164 bacteriophage_T4-like_lysozyme Bacteriophage T4-like ly 99.17
>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information
>pfam00959 Phage_lysozyme Phage lysozyme Back     alignment and domain information
>COG3772 Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>cd00735 bacteriophage_T4-like_lysozyme Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target102 phage-related lysozyme [Candidatus Liberibacter asiatic
3hde_A165 Crystal Structure Of Full-Length Endolysin R21 From 2e-25
3hdf_A140 Crystal Structure Of Truncated Endolysin R21 From P 4e-25
2anv_A146 Crystal Structure Of P22 Lysozyme Mutant L86m Lengt 2e-19
1xju_A163 Crystal Structure Of Secreted Inactive Form Of P1 P 3e-11
1xjt_A191 Crystal Structure Of Active Form Of P1 Phage Endoly 2e-10
3oe6_A 508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 1e-05
3oe0_A499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 1e-05
3odu_A502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 1e-05
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-05
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 2e-05
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 2e-05
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 2e-05
1pqk_A164 Repacking Of The Core Of T4 Lysozyme By Automated D 3e-05
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 3e-05
1p3n_A164 Core Redesign Back-Revertant I103vCORE10 Length = 1 3e-05
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-05
1l70_A164 Multiple Stabilizing Alanine Replacements Within Al 3e-05
1pqd_A164 T4 Lysozyme Core Repacking Mutant Core10TA Length = 4e-05
1p37_A164 T4 Lysozyme Core Repacking Back-Revertant L102mCORE 5e-05
1g0p_A164 Crystal Structure Of T4 Lysozyme Mutant V149g Lengt 6e-05
232l_A164 T4 Lysozyme Mutant M120k Length = 164 6e-05
1dya_A164 Determination Of Alpha-Helix Propensity Within The 6e-05
235l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 6e-05
1epy_A164 T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 7e-05
1dyg_A164 Determination Of Alpha-Helix Propensity Within The 8e-05
1l22_A164 Contributions Of Left-Handed Helical Residues To Th 8e-05
1l55_A164 Analysis Of The Interaction Between Charged Side Ch 8e-05
2a4t_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (V131 1e-04
1p6y_A164 T4 Lysozyme Core Repacking Mutant M120yTA Length = 1e-04
1l71_A164 Multiple Stabilizing Alanine Replacements Within Al 1e-04
1p64_A164 T4 Lysozyme Core Repacking Mutant L133fTA Length = 1e-04
1l33_A164 Contributions Of Left-Handed Helical Residues To Th 1e-04
160l_A164 Control Of Enzyme Activity By An Engineered Disulfi 1e-04
189l_A164 Enhancement Of Protein Stability By The Combination 1e-04
1jtm_A178 Alternative Structures Of A Sequence Extended T4 Ly 1e-04
233l_A164 T4 Lysozyme Mutant M120l Length = 164 1e-04
1g0m_A164 Crystal Structure Of T4 Lysozyme Mutant T152i Lengt 1e-04
1p46_A164 T4 Lysozyme Core Repacking Mutant M106iTA Length = 1e-04
1p2r_A164 T4 Lysozyme Core Repacking Mutant I78vTA Length = 1 1e-04
170l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 1e-04
1pqj_A164 T4 Lysozyme Core Repacking Mutant A111vCORE10TA Len 1e-04
163l_A164 Control Of Enzyme Activity By An Engineered Disulfi 1e-04
2o79_A170 T4 Lysozyme With C-Terminal Extension Length = 170 1e-04
1dye_A164 Determination Of Alpha-Helix Propensity Within The 1e-04
1pqi_A164 T4 Lysozyme Core Repacking Mutant I118lCORE7TA Leng 1e-04
3jr6_A170 Sequential Reorganization Of Beta-Sheet Topology By 1e-04
2o4w_A171 T4 Lysozyme Circular Permutant Length = 171 1e-04
201l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 1e-04
119l_A164 The Energetic Cost And The Structural Consequences 2e-04
1cv5_A164 T4 Lysozyme Mutant L133m Length = 164 2e-04
247l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
259l_A164 An Adaptable Metal-Binding Site Engineered Into T4 2e-04
129l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-04
1l77_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
123l_A164 The Energetic Cost And The Structural Consequences 2e-04
1jqu_A164 Are Carboxy Terminii Of Helices Coded By The Local 2e-04
120l_A164 The Energetic Cost And The Structural Consequences 2e-04
206l_A164 Phage T4 Lysozyme Length = 164 2e-04
221l_A164 The Energetic Cost And The Structural Consequences 2e-04
1l64_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1qt6_A164 E11h Mutant Of T4 Lysozyme Length = 164 2e-04
1t8a_A175 Use Of Sequence Duplication To Engineer A Ligand-Tr 2e-04
1g0l_A164 Crystal Structure Of T4 Lysozyme Mutant T152v Lengt 2e-04
238l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
237l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1qtb_A162 The Introduction Of Strain And Its Effects On The S 2e-04
2huk_A164 Crystal Structure Of T4 Lysozyme V131c Synthetic Di 2e-04
1tla_A164 Hydrophobic Core Repacking And Aromatic-Aromatic In 2e-04
103l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1cv1_A164 T4 Lysozyme Mutant V111m Length = 164 2e-04
1cup_A164 Methionine Core Mutant Of T4 Lysozyme Length = 164 2e-04
234l_A164 T4 Lysozyme Mutant M106l Length = 164 2e-04
1qug_A162 E108v Mutant Of T4 Lysozyme Length = 162 2e-04
2q9d_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 2e-04
1zyt_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (A82r 2e-04
112l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
230l_A164 T4 Lysozyme Mutant M6l Length = 164 2e-04
1p5c_A167 Circular Permutation Of Helix A In T4 Lysozyme Leng 2e-04
1l86_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
254l_A164 Lysozyme Length = 164 2e-04
1qt7_A164 E11n Mutant Of T4 Lysozyme Length = 164 2e-04
1g06_A164 Crystal Structure Of T4 Lysozyme Mutant V149s Lengt 2e-04
1l95_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
130l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-04
1g0j_A164 Crystal Structure Of T4 Lysozyme Mutant T152s Lengt 2e-04
131l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-04
1qt8_A164 T26h Mutant Of T4 Lysozyme Length = 164 2e-04
1p56_A176 Duplication-Extension Of Helix A Of T4 Lysozyme Len 2e-04
1pqm_A164 T4 Lysozyme Core Repacking Mutant V149iT152VTA Leng 2e-04
261l_A173 Structural Characterisation Of An Engineered Tandem 2e-04
1llh_A164 Are Carboxy Terminii Of Helices Coded By The Local 2e-04
1g0q_A164 Crystal Structure Of T4 Lysozyme Mutant V149i Lengt 2e-04
245l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1dyb_A164 Determination Of Alpha-Helix Propensity Within The 2e-04
1c6p_A164 T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 AT 2e-04
126l_A164 The Energetic Cost And The Structural Consequences 2e-04
171l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-04
1t8g_A164 Crystal Structure Of Phage T4 Lysozyme Mutant L32aL 2e-04
107l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
255l_A164 Hydrolase Length = 164 2e-04
1l39_A164 Contributions Of Engineered Surface Salt Bridges To 2e-04
2l78_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
224l_A164 The Energetic Cost And The Structural Consequences 2e-04
3fad_A164 Evaulaution At Atomic Resolution Of The Role Of Str 2e-04
108l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
1qtz_A164 D20c Mutant Of T4 Lysozyme Length = 164 2e-04
114l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
115l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
1l23_A164 Enhanced Protein Thermostability From Site-Directed 2e-04
1qt3_A164 T26d Mutant Of T4 Lysozyme Length = 164 2e-04
1l87_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
1l66_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1cu2_A164 T4 Lysozyme Mutant L84m Length = 164 2e-04
1p36_A164 T4 Lyoszyme Core Repacking Mutant I100vTA Length = 2e-04
3g3w_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (T151 2e-04
176l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-04
137l_A164 Structural Basis Of Amino Acid Alpha Helix Propensi 2e-04
102l_A165 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1l35_A164 Structure Of A Thermostable Disulfide-Bridge Mutant 2e-04
1l67_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1g07_A164 Crystal Structure Of T4 Lysozyme Mutant V149c Lengt 2e-04
1g0k_A164 Crystal Structure Of T4 Lysozyme Mutant T152c Lengt 2e-04
3c80_A164 T4 Lysozyme Mutant R96y At Room Temperature Length 2e-04
3c82_A164 Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H 2e-04
111l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
253l_A164 Lysozyme Length = 164 2e-04
1l65_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1l61_A164 Analysis Of The Interaction Between Charged Side Ch 2e-04
1qt5_A164 D20e Mutant Structure Of T4 Lysozyme Length = 164 2e-04
2hul_A164 Crystal Structure Of T4 Lysozyme S44c Synthetic Dim 2e-04
1t8f_A164 Crystal Structure Of Phage T4 Lysozyme Mutant R14aK 2e-04
1qt4_A164 T26q Mutant Of T4 Lysozyme Length = 164 2e-04
1c60_A164 T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 2e-04
1l88_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-04
110l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
109l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
104l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1l47_A164 Cumulative Site-Directed Charge-Change Replacements 2e-04
213l_A165 Protein Structure Plasticity Exemplified By Inserti 2e-04
1d2w_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-04
217l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-04
1cv6_A164 T4 Lysozyme Mutant V149m Length = 164 2e-04
242l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1g0g_A164 Crystal Structure Of T4 Lysozyme Mutant T152a Lengt 2e-04
148l_E164 A Covalent Enzyme-Substrate Intermediate With Sacch 2e-04
241l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1d2y_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-04
122l_A164 The Energetic Cost And The Structural Consequences 2e-04
239l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1l81_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
240l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-04
1l68_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-04
1dyf_A164 Determination Of Alpha-Helix Propensity Within The 2e-04
1l80_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
1i6s_A164 T4 Lysozyme Mutant C54tC97AN101A Length = 164 2e-04
1cu5_A164 T4 Lysozyme Mutant L91m Length = 164 2e-04
2q9e_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 2e-04
1oyu_A175 Long-Distance Conformational Changes In A Protein E 2e-04
205l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 2e-04
1kw7_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 2e-04
1l82_A164 Design And Structural Analysis Of Alternative Hydro 2e-04
165l_A164 Control Of Enzyme Activity By An Engineered Disulfi 2e-04
159l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-04
1l94_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
244l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-04
1d3j_A164 N-Terminal Domain Core Methionine Mutation Length = 3e-04
3f9l_A164 Evaulaution At Atomic Resolution Of The Role Of Str 3e-04
1l93_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
212l_A168 Protein Structure Plasticity Exemplified By Inserti 3e-04
1l41_A164 Contributions Of Engineered Surface Salt Bridges To 3e-04
216l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-04
1l24_A164 Enhanced Protein Thermostability From Site-Directed 3e-04
161l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-04
1l45_A164 Cumulative Site-Directed Charge-Change Replacements 3e-04
174l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-04
3c81_A164 Mutant K85a Of T4 Lysozyme In Wildtype Background A 3e-04
113l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-04
1l91_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
1dyc_A164 Determination Of Alpha-Helix Propensity Within The 3e-04
248l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-04
3cdr_A164 R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K 3e-04
150l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 3e-04
1l92_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-04
1l34_A164 High-Resolution Structure Of The Temperature-Sensit 3e-04
1pqo_A164 T4 Lysozyme Core Repacking Mutant L118iTA Length = 3e-04
1p7s_A164 T4 Lysozyme Core Repacking Mutant V103iTA Length = 3e-04
3c7z_A164 T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Len 3e-04
1l79_A164 Design And Structural Analysis Of Alternative Hydro 3e-04
1qsq_A164 Cavity Creating Mutation Length = 164 3e-04
211l_A165 Protein Structure Plasticity Exemplified By Inserti 3e-04
1l97_A164 Structure Of A Hinge-Bending Bacteriophage T4 Lysoz 3e-04
1l21_A164 Contributions Of Left-Handed Helical Residues To Th 3e-04
1kw5_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 3e-04
1cv4_A164 T4 Lysozyme Mutant L118m Length = 164 3e-04
1l14_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
1l52_A164 Structural And Thermodynamic Analysis Of The Packin 3e-04
1ssw_A164 Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY 3e-04
1l08_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
1l09_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
229l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 3e-04
1l10_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 3e-04
2nth_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 3e-04
1ssy_A164 Crystal Structure Of Phage T4 Lysozyme Mutant G28aI 3e-04
1l15_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 3e-04
1lyd_A164 Crystal Structure Of T4-Lysozyme Generated From Syn 3e-04
1cvk_A164 T4 Lysozyme Mutant L118a Length = 164 3e-04
1l76_A164 Tolerance Of T4 Lysozyme To Proline Substitutions W 3e-04
3fa0_A162 Evaulaution At Atomic Resolution Of The Role Of Str 3e-04
1l46_A164 Cumulative Site-Directed Charge-Change Replacements 3e-04
1l17_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 3e-04
1t6h_A164 Crystal Structure T4 Lysozyme Incorporating An Unna 4e-04
1ky0_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 4e-04
1l42_A164 Cumulative Site-Directed Charge-Change Replacements 4e-04
1l57_A164 Analysis Of The Interaction Between Charged Side Ch 4e-04
1l07_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
1l04_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
3c83_A164 Bacteriophage T4 Lysozyme Mutant D89a In Wildtype B 4e-04
3hwl_A164 Crystal Structure Of T4 Lysozyme With The Unnatural 4e-04
2igc_A164 Structure Of Spin Labeled T4 Lysozyme Mutant T115r1 4e-04
1l16_A164 Structural Analysis Of The Temperature-Sensitive Mu 4e-04
1l53_A164 Structural And Thermodynamic Analysis Of The Packin 4e-04
1l19_A164 Enhanced Protein Thermostability From Designed Muta 4e-04
1l12_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
1l03_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
1l11_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
172l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 4e-04
1l18_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 4e-04
3dke_X164 Polar And Non-Polar Cavities In Phage T4 Lysozyme L 4e-04
162l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-04
167l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 4e-04
166l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-04
149l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 4e-04
1c69_A164 T4 Lysozyme Mutant C54tC97AL133A IN THE PRESENCE OF 4e-04
1l01_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 4e-04
2b7w_B170 Sequential Reorganization Of Beta-Sheet Topology By 4e-04
1l06_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
164l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-04
1l02_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
177l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 4e-04
1l98_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 4e-04
231l_A164 T4 Lysozyme Mutant M106k Length = 164 4e-04
3c7w_A164 Contributions Of All 20 Amino Acids At Site 96 To T 4e-04
1cv3_A164 T4 Lysozyme Mutant L121m Length = 164 4e-04
1swy_A164 Use Of A Halide Binding Site To Bypass The 1000-Ato 4e-04
1cuq_A164 T4 Lysozyme Mutant V103m Length = 164 4e-04
1l56_A164 Analysis Of The Interaction Between Charged Side Ch 4e-04
1g1w_A164 T4 Lysozyme Mutant C54tC97AQ105M Length = 164 4e-04
220l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 4e-04
1lyf_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 4e-04
1l13_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-04
3fi5_A164 Crystal Structure Of T4 Lysozyme Mutant R96w Length 4e-04
1quh_A162 L99gE108V MUTANT OF T4 LYSOZYME Length = 162 4e-04
1l60_A164 Analysis Of The Interaction Between Charged Side Ch 4e-04
1quo_A162 L99aE108V MUTANT OF T4 LYSOZYME Length = 162 5e-04
155l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-04
1l72_A164 Multiple Stabilizing Alanine Replacements Within Al 5e-04
128l_A164 The Energetic Cost And The Structural Consequences 5e-04
196l_A164 Thermodynamic And Structural Compensation In "size- 5e-04
151l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 5e-04
1l58_A164 Analysis Of The Interaction Between Charged Side Ch 5e-04
1c63_A164 T4 Lysozyme Mutant C54tC97AL121A IN THE PRESENCE OF 5e-04
1l00_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 5e-04
125l_A164 The Energetic Cost And The Structural Consequences 5e-04
175l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 5e-04
3cdv_A164 Contributions Of All 20 Amino Acids At Site 96 To T 5e-04
2b6t_A162 T4 Lysozyme Mutant L99a At 200 Mpa Length = 162 5e-04
158l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-04
1c6c_A164 T4 Lysozyme Mutant C54tC97AL99A IN THE PRESENCE OF 5e-04
1qud_A162 L99g Mutant Of T4 Lysozyme Length = 162 5e-04
1qsb_A162 The Introduction Of Strain And Its Effects On The S 5e-04
197l_A164 Thermodynamic And Structural Compensation In "size- 5e-04
143l_A164 Role Of Backbone Flexibility In The Accommodation O 5e-04
173l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 5e-04
2qb0_B241 Structure Of The 2tel Crystallization Module Fused 5e-04
1c66_A164 T4 Lysozyme Mutant C54tC97AL121AL133A IN THE PRESEN 5e-04
1l38_A164 Contributions Of Engineered Surface Salt Bridges To 5e-04
3c8s_A164 Contributions Of All 20 Amino Acids At Site 96 To T 5e-04
1c6l_A164 T4 Lysozyme Mutant C54tC97AL99AF153A IN THE PRESENC 5e-04
1cu0_A164 T4 Lysozyme Mutant I78m Length = 164 6e-04
1b6i_A164 T4 Lysozyme Mutant With Cys 54 Replaced By Thr, Cys 6e-04
1l59_A164 Analysis Of The Interaction Between Charged Side Ch 6e-04
1l37_A164 Contributions Of Engineered Surface Salt Bridges To 6e-04
1ctw_A164 T4 Lysozyme Mutant I78a Length = 164 6e-04
2hum_A164 Crystal Structure Of T4 Lysozyme D72c Synthetic Dim 6e-04
3cdo_A164 Bacteriophage T4 Lysozyme Mutant R96v In Wildtype B 6e-04
252l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 6e-04
1qth_A164 The Introduction Of Strain And Its Effects On The S 6e-04
1qs9_A162 The Introduction Of Strain And Its Effects On The S 6e-04
1ks3_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 6e-04
3k2r_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 6e-04
1p2l_A164 T4 Lysozyme Core Repacking Mutant V87iTA Length = 1 6e-04
1l62_A164 Analysis Of The Interaction Between Charged Side Ch 7e-04
3c8q_A164 Contribution Of All 20 Amino Acids At Site 96 To Th 7e-04
1l99_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 7e-04
1l0k_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 7e-04
1cu6_A164 T4 Lysozyme Mutant L91a Length = 164 7e-04
2ou9_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant T115r1 7e-04
236l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 7e-04
139l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 7e-04
142l_A164 Role Of Backbone Flexibility In The Accommodation O 7e-04
156l_A164 Control Of Enzyme Activity By An Engineered Disulfi 7e-04
1ky1_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 8e-04
1d9w_A164 Bacteriophage T4 Lysozyme Mutant Length = 164 8e-04
1d3f_A164 N-Terminal Domain Core Methionine Mutation Length = 8e-04
1l54_A164 The Structural And Thermodynamic Consequences Of Bu 8e-04
1l32_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
3cdq_A164 Contributions Of All 20 Amino Acids At Site 96 To T 8e-04
1l28_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
1l29_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
3c7y_A164 Mutant R96a Of T4 Lysozyme In Wildtype Background A 8e-04
2qar_C163 Structure Of The 2tel Crystallization Module Fused 8e-04
1l27_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
1qs5_A162 The Introduction Of Strain And Its Effects On The S 8e-04
1cx7_A164 T4 Lysozyme Methionine Core Mutant Length = 164 8e-04
1l26_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-04
190l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 8e-04
1l30_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 9e-04
127l_A164 The Energetic Cost And The Structural Consequences 9e-04
1cu3_A164 T4 Lysozyme Mutant V87m Length = 164 9e-04
3cdt_A164 Contributions Of All 20 Amino Acids At Site 96 To T 0.001
1l25_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 0.001
138l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 0.001
1l44_A164 Cumulative Site-Directed Charge-Change Replacements 0.001
246l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.001
1d3m_A164 Methionine Core Mutation Length = 164 0.001
3dn8_A164 Iodopentafluorobenzene Binding In The Hydrophobic C 0.001
1l51_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
1l49_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
1l48_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
195l_A164 Thermodynamic And Structural Compensation In "size- 0.001
1l31_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 0.001
141l_A164 Role Of Backbone Flexibility In The Accommodation O 0.001
1qtc_A162 The Introduction Of Strain And Its Effects On The S 0.001
3c8r_A164 Contributions Of All 20 Amino Acids At Site 96 To S 0.001
199l_A164 Thermodynamic And Structural Compensation In "size- 0.001
144l_A164 Role Of Backbone Flexibility In The Accommodation O 0.001
1l0j_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 0.001
1l50_A164 Structural And Thermodynamic Analysis Of The Packin 0.001
140l_A164 Role Of Backbone Flexibility In The Accommodation O 0.001
1cv0_A164 T4 Lysozyme Mutant F104m Length = 164 0.001
2z6b_A 584 Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugate 0.002
1wth_A 584 Crystal Structure Of Gp5-S351l Mutant And Gp27 Comp 0.002
1pdl_A 575 Fitting Of Gp5 In The Cryoem Reconstruction Of The 0.002
1k28_A 584 The Structure Of The Bacteriophage T4 Cell-Puncturi 0.002
1lgu_A164 T4 Lysozyme Mutant L99aM102Q Length = 164 0.002
2rbn_A162 N-Phenylglycinonitrile In Complex With T4 Lysozyme 0.002
3l2x_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 0.002
146l_A164 Role Of Backbone Flexibility In The Accommodation O 0.002
215l_A165 Protein Structure Plasticity Exemplified By Inserti 0.002
227l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 0.002
1lyg_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 0.002
1lyi_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 0.002
210l_A163 Protein Structure Plasticity Exemplified By Inserti 0.002
1g1v_A164 T4 Lysozyme Mutant C54tC97AI58T Length = 164 0.002
198l_A164 Thermodynamic And Structural Compensation In "size- 0.002
243l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.003
214l_A165 Protein Structure Plasticity Exemplified By Inserti 0.003
1lwg_A164 Multiple Methionine Substitutions Are Tolerated In 0.003
249l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.003
250l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.003
218l_A165 Protein Structure Plasticity Exemplified By Inserti 2e-04
1kni_A164 Stabilizing Disulfide Bridge Mutant Of T4 Lysozyme 3e-04
223l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 4e-04
1l20_A164 Enhanced Protein Thermostability From Designed Muta 4e-04
1dyd_A164 Determination Of Alpha-Helix Propensity Within The 4e-04
147l_A164 Role Of Backbone Flexibility In The Accommodation O 4e-04
118l_A164 The Energetic Cost And The Structural Consequences 5e-04
152l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 5e-04
3huq_A162 Thieno[3,2-B]thiophene In Complex With T4 Lysozyme 0.002
3ht6_A164 2-Methylphenol In Complex With T4 Lysozyme L99aM102 0.002
1qtd_A162 The Introduction Of Strain And Its Effects On The S 0.002
145l_A164 Role Of Backbone Flexibility In The Accommodation O 0.002
169l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 0.003
3guj_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 0.004
3gui_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 0.004
192l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 0.004
168l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 0.004
1l74_A164 Multiple Stabilizing Alanine Replacements Within Al 0.004
1l36_A164 Toward A Simplification Of The Protein Folding Prob 0.004
gi|262367957|pdb|3HDE|A Chain A, Crystal Structure Of Full-Length Endolysin R21 From Phage 21 Length = 165 Back     alignment and structure 
 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 2/101 (1%)

Query: 2   TITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQR 61
           T T  E + LL  DL +    +           E    A+  FV+N+G GN+  ST  ++
Sbjct: 65  TYTKAECKALLNKDLATVARQINPYIKV--DIPETMRGALYSFVYNVGAGNFRTSTLLRK 122

Query: 62  VDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG 102
           ++  D + A ++ ++WT AGG+  +G+  RR     + L G
Sbjct: 123 INQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWG 163
>gi|262367961|pdb|3HDF|A Chain A, Crystal Structure Of Truncated Endolysin R21 From Phage 21 Length = 140 Back     alignment and structure
>gi|90108744|pdb|2ANV|A Chain A, Crystal Structure Of P22 Lysozyme Mutant L86m Length = 146 Back     alignment and structure
>gi|60594001|pdb|1XJU|A Chain A, Crystal Structure Of Secreted Inactive Form Of P1 Phage Endolysin Lyz Length = 163 Back     alignment and structure
>gi|60594000|pdb|1XJT|A Chain A, Crystal Structure Of Active Form Of P1 Phage Endolysin Lyz Length = 191 Back     alignment and structure
>gi|310689932|pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>gi|310689930|pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>gi|310689928|pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>gi|310943018|pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>gi|319443693|pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>gi|209447557|pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>gi|159795485|pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein-Coupled Receptor Length = 500 Back     alignment and structure
>gi|37927585|pdb|1PQK|A Chain A, Repacking Of The Core Of T4 Lysozyme By Automated Design Length = 164 Back     alignment and structure
>gi|190613726|pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>gi|37927389|pdb|1P3N|A Chain A, Core Redesign Back-Revertant I103vCORE10 Length = 164 Back     alignment and structure
>gi|317455410|pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>gi|157831726|pdb|1L70|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|37927571|pdb|1PQD|A Chain A, T4 Lysozyme Core Repacking Mutant Core10TA Length = 164 Back     alignment and structure
>gi|37927387|pdb|1P37|A Chain A, T4 Lysozyme Core Repacking Back-Revertant L102mCORE10 Length = 164 Back     alignment and structure
>gi|14488752|pdb|1G0P|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149g Length = 164 Back     alignment and structure
>gi|157834489|pdb|232L|A Chain A, T4 Lysozyme Mutant M120k Length = 164 Back     alignment and structure
>gi|157830899|pdb|1DYA|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834492|pdb|235L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|7767116|pdb|1EPY|A Chain A, T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 164 Back     alignment and structure
>gi|157830905|pdb|1DYG|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831678|pdb|1L22|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831711|pdb|1L55|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|110590780|pdb|2A4T|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (V131r7) Length = 164 Back     alignment and structure
>gi|37927425|pdb|1P6Y|A Chain A, T4 Lysozyme Core Repacking Mutant M120yTA Length = 164 Back     alignment and structure
>gi|157831727|pdb|1L71|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|37927410|pdb|1P64|A Chain A, T4 Lysozyme Core Repacking Mutant L133fTA Length = 164 Back     alignment and structure
>gi|157831689|pdb|1L33|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829593|pdb|160L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157829619|pdb|189L|A Chain A, Enhancement Of Protein Stability By The Combination Of Point Mutations In T4 Lysozyme Is Additive Length = 164 Back     alignment and structure
>gi|20150541|pdb|1JTM|A Chain A, Alternative Structures Of A Sequence Extended T4 Lysozyme Show That The Highly Conserved Beta-Sheet Has Weak Intrinsic Folding Propensity Length = 178 Back     alignment and structure
>gi|157834490|pdb|233L|A Chain A, T4 Lysozyme Mutant M120l Length = 164 Back     alignment and structure
>gi|14488751|pdb|1G0M|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152i Length = 164 Back     alignment and structure
>gi|37927406|pdb|1P46|A Chain A, T4 Lysozyme Core Repacking Mutant M106iTA Length = 164 Back     alignment and structure
>gi|37927383|pdb|1P2R|A Chain A, T4 Lysozyme Core Repacking Mutant I78vTA Length = 164 Back     alignment and structure
>gi|157829601|pdb|170L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|37927583|pdb|1PQJ|A Chain A, T4 Lysozyme Core Repacking Mutant A111vCORE10TA Length = 164 Back     alignment and structure
>gi|157829596|pdb|163L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|146387591|pdb|2O79|A Chain A, T4 Lysozyme With C-Terminal Extension Length = 170 Back     alignment and structure
>gi|157830903|pdb|1DYE|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|37927581|pdb|1PQI|A Chain A, T4 Lysozyme Core Repacking Mutant I118lCORE7TA Length = 164 Back     alignment and structure
>gi|261825045|pdb|3JR6|A Chain A, Sequential Reorganization Of Beta-Sheet Topology By Insertion Of A Single Strand Length = 170 Back     alignment and structure
>gi|146387572|pdb|2O4W|A Chain A, T4 Lysozyme Circular Permutant Length = 171 Back     alignment and structure
>gi|494717|pdb|201L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 Back     alignment and structure
>gi|157829547|pdb|119L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729790|pdb|1CV5|A Chain A, T4 Lysozyme Mutant L133m Length = 164 Back     alignment and structure
>gi|157834504|pdb|247L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|4930159|pdb|259L|A Chain A, An Adaptable Metal-Binding Site Engineered Into T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829556|pdb|129L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|157831733|pdb|1L77|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829551|pdb|123L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|20150496|pdb|1JQU|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|157829548|pdb|120L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834454|pdb|206L|A Chain A, Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834475|pdb|221L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831720|pdb|1L64|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|5822356|pdb|1QT6|A Chain A, E11h Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|52695672|pdb|1T8A|A Chain A, Use Of Sequence Duplication To Engineer A Ligand-Triggered Long-Distance Molecular Switch In T4 Lysosyme Length = 175 Back     alignment and structure
>gi|14488750|pdb|1G0L|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152v Length = 164 Back     alignment and structure
>gi|157834495|pdb|238L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157834494|pdb|237L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|5542484|pdb|1QTB|A Chain A, The Introduction Of Strain And Its Effects On The Structure And Stability Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|118137974|pdb|2HUK|A Chain A, Crystal Structure Of T4 Lysozyme V131c Synthetic Dimer Length = 164 Back     alignment and structure
>gi|157833964|pdb|1TLA|A Chain A, Hydrophobic Core Repacking And Aromatic-Aromatic Interaction In The Thermostable Mutant Of T4 Lysozyme Ser 117 (Right Arrow) Phe Length = 164 Back     alignment and structure
>gi|157829526|pdb|103L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 167 Back     alignment and structure
>gi|9257165|pdb|1CV1|A Chain A, T4 Lysozyme Mutant V111m Length = 164 Back     alignment and structure
>gi|6729784|pdb|1CUP|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834491|pdb|234L|A Chain A, T4 Lysozyme Mutant M106l Length = 164 Back     alignment and structure
>gi|5822381|pdb|1QUG|A Chain A, E108v Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|151567976|pdb|2Q9D|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 Length = 164 Back     alignment and structure
>gi|114793376|pdb|1ZYT|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (A82r1) Length = 164 Back     alignment and structure
>gi|157829541|pdb|112L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834487|pdb|230L|A Chain A, T4 Lysozyme Mutant M6l Length = 164 Back     alignment and structure
>gi|48425202|pdb|1P5C|A Chain A, Circular Permutation Of Helix A In T4 Lysozyme Length = 167 Back     alignment and structure
>gi|157831741|pdb|1L86|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834512|pdb|254L|A Chain A, Lysozyme Length = 164 Back     alignment and structure
>gi|5822357|pdb|1QT7|A Chain A, E11n Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|14488744|pdb|1G06|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149s Length = 164 Back     alignment and structure
>gi|157831750|pdb|1L95|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157829558|pdb|130L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|14488748|pdb|1G0J|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152s Length = 164 Back     alignment and structure
>gi|157829559|pdb|131L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|5822358|pdb|1QT8|A Chain A, T26h Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157879603|pdb|1P56|A Chain A, Duplication-Extension Of Helix A Of T4 Lysozyme Length = 176 Back     alignment and structure
>gi|37927589|pdb|1PQM|A Chain A, T4 Lysozyme Core Repacking Mutant V149iT152VTA Length = 164 Back     alignment and structure
>gi|5107702|pdb|261L|A Chain A, Structural Characterisation Of An Engineered Tandem Repeat Contrasts The Importance Of Context And Sequence In Protein Folding Length = 173 Back     alignment and structure
>gi|21466123|pdb|1LLH|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|14488753|pdb|1G0Q|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149i Length = 164 Back     alignment and structure
>gi|157834502|pdb|245L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157830900|pdb|1DYB|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|10835387|pdb|1C6P|A Chain A, T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 ATM ARGON Length = 164 Back     alignment and structure
>gi|157829553|pdb|126L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829602|pdb|171L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|56553847|pdb|1T8G|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant L32aL33AT34AC54TC97AE108V Length = 164 Back     alignment and structure
>gi|157829531|pdb|107L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834514|pdb|255L|A Chain A, Hydrolase Length = 164 Back     alignment and structure
>gi|157831695|pdb|1L39|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|157835299|pdb|2L78|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834479|pdb|224L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|223674040|pdb|3FAD|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 164 Back     alignment and structure
>gi|157829533|pdb|108L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|5822379|pdb|1QTZ|A Chain A, D20c Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829544|pdb|114L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829545|pdb|115L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831679|pdb|1L23|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|5822353|pdb|1QT3|A Chain A, T26d Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831742|pdb|1L87|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157831722|pdb|1L66|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|9257162|pdb|1CU2|A Chain A, T4 Lysozyme Mutant L84m Length = 164 Back     alignment and structure
>gi|37927385|pdb|1P36|A Chain A, T4 Lyoszyme Core Repacking Mutant I100vTA Length = 164 Back     alignment and structure
>gi|229597880|pdb|3G3W|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (T151r1) At 291 K Length = 164 Back     alignment and structure
>gi|1065176|pdb|176L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|575962|pdb|137L|A Chain A, Structural Basis Of Amino Acid Alpha Helix Propensity Length = 164 Back     alignment and structure
>gi|157829524|pdb|102L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 165 Back     alignment and structure
>gi|157831691|pdb|1L35|A Chain A, Structure Of A Thermostable Disulfide-Bridge Mutant Of Phage T4 Lysozyme Shows That An Engineered Crosslink In A Flexible Region Does Not Increase The Rigidity Of The Folded Protein Length = 164 Back     alignment and structure
>gi|157831723|pdb|1L67|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|14488745|pdb|1G07|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149c Length = 164 Back     alignment and structure
>gi|14488749|pdb|1G0K|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152c Length = 164 Back     alignment and structure
>gi|223673907|pdb|3C80|A Chain A, T4 Lysozyme Mutant R96y At Room Temperature Length = 164 Back     alignment and structure
>gi|223673909|pdb|3C82|A Chain A, Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H Length = 164 Back     alignment and structure
>gi|157829539|pdb|111L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834511|pdb|253L|A Chain A, Lysozyme Length = 164 Back     alignment and structure
>gi|157831721|pdb|1L65|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157831717|pdb|1L61|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|5822355|pdb|1QT5|A Chain A, D20e Mutant Structure Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|118137975|pdb|2HUL|A Chain A, Crystal Structure Of T4 Lysozyme S44c Synthetic Dimer Length = 164 Back     alignment and structure
>gi|56553846|pdb|1T8F|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant R14aK16AI17AK19AT21AE22AC54TC97A Length = 164 Back     alignment and structure
>gi|5822354|pdb|1QT4|A Chain A, T26q Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|10835363|pdb|1C60|A Chain A, T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 8 ATM Argon Length = 164 Back     alignment and structure
>gi|157831743|pdb|1L88|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157829537|pdb|110L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829535|pdb|109L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|442543|pdb|104L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 Back     alignment and structure
>gi|157831703|pdb|1L47|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|157834467|pdb|213L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back     alignment and structure
>gi|6729794|pdb|1D2W|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157834470|pdb|217L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729791|pdb|1CV6|A Chain A, T4 Lysozyme Mutant V149m Length = 164 Back     alignment and structure
>gi|157834499|pdb|242L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|14488747|pdb|1G0G|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152a Length = 164 Back     alignment and structure
>gi|515062|pdb|148L|E Chain E, A Covalent Enzyme-Substrate Intermediate With Saccharide Distortion In A Mutant T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834498|pdb|241L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729795|pdb|1D2Y|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157829550|pdb|122L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834496|pdb|239L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831736|pdb|1L81|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834497|pdb|240L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831724|pdb|1L68|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157830904|pdb|1DYF|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831735|pdb|1L80|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|14277939|pdb|1I6S|A Chain A, T4 Lysozyme Mutant C54tC97AN101A Length = 164 Back     alignment and structure
>gi|6729782|pdb|1CU5|A Chain A, T4 Lysozyme Mutant L91m Length = 164 Back     alignment and structure
>gi|151567977|pdb|2Q9E|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 Length = 164 Back     alignment and structure
>gi|33357813|pdb|1OYU|A Chain A, Long-Distance Conformational Changes In A Protein Engineered By Modulated Sequence Duplication Length = 175 Back     alignment and structure
>gi|157834451|pdb|205L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 167 Back     alignment and structure
>gi|31615480|pdb|1KW7|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|157831737|pdb|1L82|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829598|pdb|165L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157829592|pdb|159L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157831749|pdb|1L94|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834501|pdb|244L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729797|pdb|1D3J|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|223674038|pdb|3F9L|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 164 Back     alignment and structure
>gi|157831748|pdb|1L93|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834466|pdb|212L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 168 Back     alignment and structure
>gi|157831697|pdb|1L41|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|576360|pdb|216L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831680|pdb|1L24|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|157829594|pdb|161L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157831701|pdb|1L45|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|1065158|pdb|174L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|223673908|pdb|3C81|A Chain A, Mutant K85a Of T4 Lysozyme In Wildtype Background At Room Temperature Length = 164 Back     alignment and structure
>gi|157829543|pdb|113L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831746|pdb|1L91|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157830901|pdb|1DYC|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834505|pdb|248L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|223673921|pdb|3CDR|A Chain A, R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K Length = 164 Back     alignment and structure
>gi|515066|pdb|150L|A Chain A, Conservation Of Solvent-Binding Sites In 10 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831747|pdb|1L92|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157831690|pdb|1L34|A Chain A, High-Resolution Structure Of The Temperature-Sensitive Mutant Of Phage Lysozyme, Arg 96 (Right Arrow) His Length = 164 Back     alignment and structure
>gi|37927591|pdb|1PQO|A Chain A, T4 Lysozyme Core Repacking Mutant L118iTA Length = 164 Back     alignment and structure
>gi|37927436|pdb|1P7S|A Chain A, T4 Lysozyme Core Repacking Mutant V103iTA Length = 164 Back     alignment and structure
>gi|223673906|pdb|3C7Z|A Chain A, T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Length = 164 Back     alignment and structure
>gi|157831734|pdb|1L79|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729807|pdb|1QSQ|A Chain A, Cavity Creating Mutation Length = 164 Back     alignment and structure
>gi|157834465|pdb|211L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back     alignment and structure
>gi|443083|pdb|1L97|A Chain A, Structure Of A Hinge-Bending Bacteriophage T4 Lysozyme Mutant, Ile3-> Pro Length = 164 Back     alignment and structure
>gi|157831677|pdb|1L21|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|31615479|pdb|1KW5|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|6729789|pdb|1CV4|A Chain A, T4 Lysozyme Mutant L118m Length = 164 Back     alignment and structure
>gi|157831670|pdb|1L14|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831708|pdb|1L52|A Chain A, Structural And Thermodynamic Analysis Of The Packing Of Two Alpha-Helices In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|56553736|pdb|1SSW|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY25AT26AI27AC54TC97A Length = 164 Back     alignment and structure
>gi|157831664|pdb|1L08|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831665|pdb|1L09|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834485|pdb|229L|A Chain A, Generating Ligand Binding Sites In T4 Lysozyme Using Deficiency-Creating Substitutions Length = 164 Back     alignment and structure
>gi|157831666|pdb|1L10|A Chain A, Structural Studies Of Mutants Of The Lysozyme Of Bacteriophage T4. The Temperature-Sensitive Mutant Protein Thr157 (Right Arrow) Ile Length = 164 Back     alignment and structure
>gi|149242489|pdb|2NTH|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 Length = 164 Back     alignment and structure
>gi|56553737|pdb|1SSY|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant G28aI29AG30AC54TC97A Length = 164 Back     alignment and structure
>gi|157831671|pdb|1L15|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
gi|157831899|pdb|1LYD|A Chain A, Crystal Structure Of T4-Lysozyme Generated From Synthetic Coding Dna Expressed In Escherichia Coli Length = 164 Back     alignment and structure
>gi|6729792|pdb|1CVK|A Chain A, T4 Lysozyme Mutant L118a Length = 164 Back     alignment and structure
>gi|157831732|pdb|1L76|A Chain A, Tolerance Of T4 Lysozyme To Proline Substitutions Within The Long Interdomain Alpha-Helix Illustrates The Adaptability Of Proteins To Potentially Destabilizing Lesions Length = 164 Back     alignment and structure
>gi|223674039|pdb|3FA0|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 162 Back     alignment and structure
>gi|157831702|pdb|1L46|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|157831673|pdb|1L17|A Chain A, Hydrophobic Stabilization In T4 Lysozyme Determined Directly By Multiple