254781058
phage-related lysozyme
GeneID in NCBI database: | 8210081 | Locus tag: | CLIBASIA_04800 |
Protein GI in NCBI database: | 254781058 | Protein Accession: | YP_003065471.1 |
Gene range: | +(1062025, 1062333) | Protein Length: | 102aa |
Gene description: | phage-related lysozyme | ||
COG prediction: | [R] Phage-related lysozyme (muraminidase) | ||
KEGG prediction: | phage-related lysozyme | ||
SEED prediction: | prophage LambdaMc01, lysozyme | ||
Pathway involved in KEGG: | not defined | ||
Subsystem involved in SEED: | - none - | ||
sequence | sequence profile |
Prediction of Local Sequence Properties
Source | Summary | Result |
---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
Identity | Alignment graph | Length | Definition | E-value | |
Target | 102 | phage-related lysozyme [Candidatus Liberibacter asiatic | |||
254781056 | 171 | phage-related lysozyme [Candidatus Liberibacter as | 4e-40 |
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 | Back alignment |
---|
Score = 154 bits (388), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/100 (76%), Positives = 82/100 (82%) Query: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 MTIT KEAED LL D L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ Sbjct: 70 MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129 Query: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100 RVDAQDWEKAAEECKKWTKAGG+ L G+ RR +LL Sbjct: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169 |
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
Identity | Alignment graph | Length | Definition | Round | E-value |
Target | 102 | phage-related lysozyme [Candidatus Liberibacter asiatic | |||
254781056 | 171 | phage-related lysozyme [Candidatus Liberibacter asiatic | 1 | 5e-36 | |
315122346 | 102 | phage-related lysozyme [Candidatus Liberibacter solanac | 1 | 6e-21 | |
315122498 | 146 | phage-related lysozyme [Candidatus Liberibacter solanac | 1 | 9e-21 | |
315121922 | 149 | phage-related lysozyme [Candidatus Liberibacter solanac | 1 | 2e-18 | |
315122678 | 102 | phage-related lysozyme [Candidatus Liberibacter solanac | 1 | 1e-16 | |
315122565 | 133 | phage-related lysozyme [Candidatus Liberibacter solanac | 1 | 2e-16 | |
152982881 | 174 | phage-related lysozyme [Janthinobacterium sp. Marseille | 1 | 5e-16 | |
78358460 | 148 | prophage LambdaMc01, lysozyme [Desulfovibrio desulfuric | 1 | 3e-15 | |
161525479 | 154 | glycoside hydrolase family protein [Burkholderia multiv | 1 | 6e-15 | |
152983117 | 171 | phage-related lysozyme [Janthinobacterium sp. Marseille | 1 | 2e-14 |
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 | Back alignment and organism information |
---|
Score = 154 bits (388), Expect = 5e-36, Method: Compositional matrix adjust. Identities = 76/100 (76%), Positives = 82/100 (82%) Query: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 MTIT KEAED LL D L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ Sbjct: 70 MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129 Query: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100 RVDAQDWEKAAEECKKWTKAGG+ L G+ RR +LL Sbjct: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169 |
Species: Candidatus Liberibacter asiaticus Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
>gi|315122346|ref|YP_004062835.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 | Back alignment and organism information |
---|
>gi|315122498|ref|YP_004062987.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 146 | Back alignment and organism information |
---|
>gi|315121922|ref|YP_004062411.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 149 | Back alignment and organism information |
---|
>gi|315122678|ref|YP_004063167.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 | Back alignment and organism information |
---|
>gi|315122565|ref|YP_004063054.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 133 | Back alignment and organism information |
---|
>gi|152982881|ref|YP_001354478.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 174 | Back alignment and organism information |
---|
>gi|78358460|ref|YP_389909.1| prophage LambdaMc01, lysozyme [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 148 | Back alignment and organism information |
---|
>gi|161525479|ref|YP_001580491.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC 17616] Length = 154 | Back alignment and organism information |
---|
>gi|152983117|ref|YP_001354418.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 171 | Back alignment and organism information |
---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLASTagainst CDD database part II
Identity | Alignment graph | Length | Definition | E-value |
Target | 102 | phage-related lysozyme [Candidatus Liberibacter asiatic | ||
COG3772 | 152 | COG3772, COG3772, Phage-related lysozyme (muraminidase) | 8e-11 | |
pfam00959 | 108 | pfam00959, Phage_lysozyme, Phage lysozyme | 3e-09 | |
cd00737 | 133 | cd00737, endolysin_autolysin, Endolysins and autolysins | 5e-15 |
>gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only] | Back alignment and domain information |
---|
>gnl|CDD|144526 pfam00959, Phage_lysozyme, Phage lysozyme | Back alignment and domain information |
---|
>gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively | Back alignment and domain information |
---|
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
Identity | Alignment graph | Length | Definition | Probability |
Target | 102 | phage-related lysozyme [Candidatus Liberibacter asiatic | ||
cd00737 | 133 | endolysin_autolysin Endolysins and autolysins are found | 99.97 | |
pfam00959 | 108 | Phage_lysozyme Phage lysozyme. This family includes lam | 99.96 | |
COG3772 | 152 | Phage-related lysozyme (muraminidase) [General function | 99.96 | |
cd00735 | 164 | bacteriophage_T4-like_lysozyme Bacteriophage T4-like ly | 99.17 |
>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively | Back alignment and domain information |
---|
>pfam00959 Phage_lysozyme Phage lysozyme | Back alignment and domain information |
---|
>COG3772 Phage-related lysozyme (muraminidase) [General function prediction only] | Back alignment and domain information |
---|
>cd00735 bacteriophage_T4-like_lysozyme Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls | Back alignment and domain information |
---|
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
Identity | Alignment graph | Length | Definition | E-value |
Target | 102 | phage-related lysozyme [Candidatus Liberibacter asiatic | ||
3hde_A | 165 | Crystal Structure Of Full-Length Endolysin R21 From | 2e-25 | |
3hdf_A | 140 | Crystal Structure Of Truncated Endolysin R21 From P | 4e-25 | |
2anv_A | 146 | Crystal Structure Of P22 Lysozyme Mutant L86m Lengt | 2e-19 | |
1xju_A | 163 | Crystal Structure Of Secreted Inactive Form Of P1 P | 3e-11 | |
1xjt_A | 191 | Crystal Structure Of Active Form Of P1 Phage Endoly | 2e-10 | |
3oe6_A | 508 | Crystal Structure Of The Cxcr4 Chemokine Receptor I | 1e-05 | |
3oe0_A | 499 | Crystal Structure Of The Cxcr4 Chemokine Receptor I | 1e-05 | |
3odu_A | 502 | The 2.5 A Structure Of The Cxcr4 Chemokine Receptor | 1e-05 | |
3pbl_A | 481 | Structure Of The Human Dopamine D3 Receptor In Comp | 1e-05 | |
3p0g_A | 501 | Structure Of A Nanobody-Stabilized Active State Of | 2e-05 | |
3eml_A | 488 | The 2.6 A Crystal Structure Of A Human A2a Adenosin | 2e-05 | |
2rh1_A | 500 | High Resolution Crystal Structure Of Human B2-Adren | 2e-05 | |
1pqk_A | 164 | Repacking Of The Core Of T4 Lysozyme By Automated D | 3e-05 | |
3d4s_A | 490 | Cholesterol Bound Form Of Human Beta2 Adrenergic Re | 3e-05 | |
1p3n_A | 164 | Core Redesign Back-Revertant I103vCORE10 Length = 1 | 3e-05 | |
3pds_A | 458 | Irreversible Agonist-Beta2 Adrenoceptor Complex Len | 3e-05 | |
1l70_A | 164 | Multiple Stabilizing Alanine Replacements Within Al | 3e-05 | |
1pqd_A | 164 | T4 Lysozyme Core Repacking Mutant Core10TA Length = | 4e-05 | |
1p37_A | 164 | T4 Lysozyme Core Repacking Back-Revertant L102mCORE | 5e-05 | |
1g0p_A | 164 | Crystal Structure Of T4 Lysozyme Mutant V149g Lengt | 6e-05 | |
232l_A | 164 | T4 Lysozyme Mutant M120k Length = 164 | 6e-05 | |
1dya_A | 164 | Determination Of Alpha-Helix Propensity Within The | 6e-05 | |
235l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 6e-05 | |
1epy_A | 164 | T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = | 7e-05 | |
1dyg_A | 164 | Determination Of Alpha-Helix Propensity Within The | 8e-05 | |
1l22_A | 164 | Contributions Of Left-Handed Helical Residues To Th | 8e-05 | |
1l55_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 8e-05 | |
2a4t_A | 164 | Crystal Structure Of Spin Labeled T4 Lysozyme (V131 | 1e-04 | |
1p6y_A | 164 | T4 Lysozyme Core Repacking Mutant M120yTA Length = | 1e-04 | |
1l71_A | 164 | Multiple Stabilizing Alanine Replacements Within Al | 1e-04 | |
1p64_A | 164 | T4 Lysozyme Core Repacking Mutant L133fTA Length = | 1e-04 | |
1l33_A | 164 | Contributions Of Left-Handed Helical Residues To Th | 1e-04 | |
160l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 1e-04 | |
189l_A | 164 | Enhancement Of Protein Stability By The Combination | 1e-04 | |
1jtm_A | 178 | Alternative Structures Of A Sequence Extended T4 Ly | 1e-04 | |
233l_A | 164 | T4 Lysozyme Mutant M120l Length = 164 | 1e-04 | |
1g0m_A | 164 | Crystal Structure Of T4 Lysozyme Mutant T152i Lengt | 1e-04 | |
1p46_A | 164 | T4 Lysozyme Core Repacking Mutant M106iTA Length = | 1e-04 | |
1p2r_A | 164 | T4 Lysozyme Core Repacking Mutant I78vTA Length = 1 | 1e-04 | |
170l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 1e-04 | |
1pqj_A | 164 | T4 Lysozyme Core Repacking Mutant A111vCORE10TA Len | 1e-04 | |
163l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 1e-04 | |
2o79_A | 170 | T4 Lysozyme With C-Terminal Extension Length = 170 | 1e-04 | |
1dye_A | 164 | Determination Of Alpha-Helix Propensity Within The | 1e-04 | |
1pqi_A | 164 | T4 Lysozyme Core Repacking Mutant I118lCORE7TA Leng | 1e-04 | |
3jr6_A | 170 | Sequential Reorganization Of Beta-Sheet Topology By | 1e-04 | |
2o4w_A | 171 | T4 Lysozyme Circular Permutant Length = 171 | 1e-04 | |
201l_A | 166 | How Amino-Acid Insertions Are Allowed In An Alpha-H | 1e-04 | |
119l_A | 164 | The Energetic Cost And The Structural Consequences | 2e-04 | |
1cv5_A | 164 | T4 Lysozyme Mutant L133m Length = 164 | 2e-04 | |
247l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
259l_A | 164 | An Adaptable Metal-Binding Site Engineered Into T4 | 2e-04 | |
129l_A | 164 | Structures Of Randomly Generated Mutants Of T4 Lyso | 2e-04 | |
1l77_A | 164 | Design And Structural Analysis Of Alternative Hydro | 2e-04 | |
123l_A | 164 | The Energetic Cost And The Structural Consequences | 2e-04 | |
1jqu_A | 164 | Are Carboxy Terminii Of Helices Coded By The Local | 2e-04 | |
120l_A | 164 | The Energetic Cost And The Structural Consequences | 2e-04 | |
206l_A | 164 | Phage T4 Lysozyme Length = 164 | 2e-04 | |
221l_A | 164 | The Energetic Cost And The Structural Consequences | 2e-04 | |
1l64_A | 164 | Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr | 2e-04 | |
1qt6_A | 164 | E11h Mutant Of T4 Lysozyme Length = 164 | 2e-04 | |
1t8a_A | 175 | Use Of Sequence Duplication To Engineer A Ligand-Tr | 2e-04 | |
1g0l_A | 164 | Crystal Structure Of T4 Lysozyme Mutant T152v Lengt | 2e-04 | |
238l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
237l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
1qtb_A | 162 | The Introduction Of Strain And Its Effects On The S | 2e-04 | |
2huk_A | 164 | Crystal Structure Of T4 Lysozyme V131c Synthetic Di | 2e-04 | |
1tla_A | 164 | Hydrophobic Core Repacking And Aromatic-Aromatic In | 2e-04 | |
103l_A | 167 | How Amino-Acid Insertions Are Allowed In An Alpha-H | 2e-04 | |
1cv1_A | 164 | T4 Lysozyme Mutant V111m Length = 164 | 2e-04 | |
1cup_A | 164 | Methionine Core Mutant Of T4 Lysozyme Length = 164 | 2e-04 | |
234l_A | 164 | T4 Lysozyme Mutant M106l Length = 164 | 2e-04 | |
1qug_A | 162 | E108v Mutant Of T4 Lysozyme Length = 162 | 2e-04 | |
2q9d_A | 164 | Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 | 2e-04 | |
1zyt_A | 164 | Crystal Structure Of Spin Labeled T4 Lysozyme (A82r | 2e-04 | |
112l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
230l_A | 164 | T4 Lysozyme Mutant M6l Length = 164 | 2e-04 | |
1p5c_A | 167 | Circular Permutation Of Helix A In T4 Lysozyme Leng | 2e-04 | |
1l86_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 2e-04 | |
254l_A | 164 | Lysozyme Length = 164 | 2e-04 | |
1qt7_A | 164 | E11n Mutant Of T4 Lysozyme Length = 164 | 2e-04 | |
1g06_A | 164 | Crystal Structure Of T4 Lysozyme Mutant V149s Lengt | 2e-04 | |
1l95_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 2e-04 | |
130l_A | 164 | Structures Of Randomly Generated Mutants Of T4 Lyso | 2e-04 | |
1g0j_A | 164 | Crystal Structure Of T4 Lysozyme Mutant T152s Lengt | 2e-04 | |
131l_A | 164 | Structures Of Randomly Generated Mutants Of T4 Lyso | 2e-04 | |
1qt8_A | 164 | T26h Mutant Of T4 Lysozyme Length = 164 | 2e-04 | |
1p56_A | 176 | Duplication-Extension Of Helix A Of T4 Lysozyme Len | 2e-04 | |
1pqm_A | 164 | T4 Lysozyme Core Repacking Mutant V149iT152VTA Leng | 2e-04 | |
261l_A | 173 | Structural Characterisation Of An Engineered Tandem | 2e-04 | |
1llh_A | 164 | Are Carboxy Terminii Of Helices Coded By The Local | 2e-04 | |
1g0q_A | 164 | Crystal Structure Of T4 Lysozyme Mutant V149i Lengt | 2e-04 | |
245l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
1dyb_A | 164 | Determination Of Alpha-Helix Propensity Within The | 2e-04 | |
1c6p_A | 164 | T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 AT | 2e-04 | |
126l_A | 164 | The Energetic Cost And The Structural Consequences | 2e-04 | |
171l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 2e-04 | |
1t8g_A | 164 | Crystal Structure Of Phage T4 Lysozyme Mutant L32aL | 2e-04 | |
107l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
255l_A | 164 | Hydrolase Length = 164 | 2e-04 | |
1l39_A | 164 | Contributions Of Engineered Surface Salt Bridges To | 2e-04 | |
2l78_A | 164 | Design And Structural Analysis Of Alternative Hydro | 2e-04 | |
224l_A | 164 | The Energetic Cost And The Structural Consequences | 2e-04 | |
3fad_A | 164 | Evaulaution At Atomic Resolution Of The Role Of Str | 2e-04 | |
108l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
1qtz_A | 164 | D20c Mutant Of T4 Lysozyme Length = 164 | 2e-04 | |
114l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
115l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
1l23_A | 164 | Enhanced Protein Thermostability From Site-Directed | 2e-04 | |
1qt3_A | 164 | T26d Mutant Of T4 Lysozyme Length = 164 | 2e-04 | |
1l87_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 2e-04 | |
1l66_A | 164 | Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr | 2e-04 | |
1cu2_A | 164 | T4 Lysozyme Mutant L84m Length = 164 | 2e-04 | |
1p36_A | 164 | T4 Lyoszyme Core Repacking Mutant I100vTA Length = | 2e-04 | |
3g3w_A | 164 | Crystal Structure Of Spin Labeled T4 Lysozyme (T151 | 2e-04 | |
176l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 2e-04 | |
137l_A | 164 | Structural Basis Of Amino Acid Alpha Helix Propensi | 2e-04 | |
102l_A | 165 | How Amino-Acid Insertions Are Allowed In An Alpha-H | 2e-04 | |
1l35_A | 164 | Structure Of A Thermostable Disulfide-Bridge Mutant | 2e-04 | |
1l67_A | 164 | Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr | 2e-04 | |
1g07_A | 164 | Crystal Structure Of T4 Lysozyme Mutant V149c Lengt | 2e-04 | |
1g0k_A | 164 | Crystal Structure Of T4 Lysozyme Mutant T152c Lengt | 2e-04 | |
3c80_A | 164 | T4 Lysozyme Mutant R96y At Room Temperature Length | 2e-04 | |
3c82_A | 164 | Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H | 2e-04 | |
111l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
253l_A | 164 | Lysozyme Length = 164 | 2e-04 | |
1l65_A | 164 | Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr | 2e-04 | |
1l61_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 2e-04 | |
1qt5_A | 164 | D20e Mutant Structure Of T4 Lysozyme Length = 164 | 2e-04 | |
2hul_A | 164 | Crystal Structure Of T4 Lysozyme S44c Synthetic Dim | 2e-04 | |
1t8f_A | 164 | Crystal Structure Of Phage T4 Lysozyme Mutant R14aK | 2e-04 | |
1qt4_A | 164 | T26q Mutant Of T4 Lysozyme Length = 164 | 2e-04 | |
1c60_A | 164 | T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF | 2e-04 | |
1l88_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 2e-04 | |
110l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
109l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
104l_A | 166 | How Amino-Acid Insertions Are Allowed In An Alpha-H | 2e-04 | |
1l47_A | 164 | Cumulative Site-Directed Charge-Change Replacements | 2e-04 | |
213l_A | 165 | Protein Structure Plasticity Exemplified By Inserti | 2e-04 | |
1d2w_A | 164 | N-Terminal Domain Core Methionine Mutation Length = | 2e-04 | |
217l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 2e-04 | |
1cv6_A | 164 | T4 Lysozyme Mutant V149m Length = 164 | 2e-04 | |
242l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
1g0g_A | 164 | Crystal Structure Of T4 Lysozyme Mutant T152a Lengt | 2e-04 | |
148l_E | 164 | A Covalent Enzyme-Substrate Intermediate With Sacch | 2e-04 | |
241l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
1d2y_A | 164 | N-Terminal Domain Core Methionine Mutation Length = | 2e-04 | |
122l_A | 164 | The Energetic Cost And The Structural Consequences | 2e-04 | |
239l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
1l81_A | 164 | Design And Structural Analysis Of Alternative Hydro | 2e-04 | |
240l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 2e-04 | |
1l68_A | 164 | Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr | 2e-04 | |
1dyf_A | 164 | Determination Of Alpha-Helix Propensity Within The | 2e-04 | |
1l80_A | 164 | Design And Structural Analysis Of Alternative Hydro | 2e-04 | |
1i6s_A | 164 | T4 Lysozyme Mutant C54tC97AN101A Length = 164 | 2e-04 | |
1cu5_A | 164 | T4 Lysozyme Mutant L91m Length = 164 | 2e-04 | |
2q9e_A | 164 | Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 | 2e-04 | |
1oyu_A | 175 | Long-Distance Conformational Changes In A Protein E | 2e-04 | |
205l_A | 167 | How Amino-Acid Insertions Are Allowed In An Alpha-H | 2e-04 | |
1kw7_A | 162 | Methionine Core Mutant Of T4 Lysozyme Length = 162 | 2e-04 | |
1l82_A | 164 | Design And Structural Analysis Of Alternative Hydro | 2e-04 | |
165l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 2e-04 | |
159l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 3e-04 | |
1l94_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 3e-04 | |
244l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 3e-04 | |
1d3j_A | 164 | N-Terminal Domain Core Methionine Mutation Length = | 3e-04 | |
3f9l_A | 164 | Evaulaution At Atomic Resolution Of The Role Of Str | 3e-04 | |
1l93_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 3e-04 | |
212l_A | 168 | Protein Structure Plasticity Exemplified By Inserti | 3e-04 | |
1l41_A | 164 | Contributions Of Engineered Surface Salt Bridges To | 3e-04 | |
216l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 3e-04 | |
1l24_A | 164 | Enhanced Protein Thermostability From Site-Directed | 3e-04 | |
161l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 3e-04 | |
1l45_A | 164 | Cumulative Site-Directed Charge-Change Replacements | 3e-04 | |
174l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 3e-04 | |
3c81_A | 164 | Mutant K85a Of T4 Lysozyme In Wildtype Background A | 3e-04 | |
113l_A | 164 | Structural Basis Of Alpha-Helix Propensity At Two S | 3e-04 | |
1l91_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 3e-04 | |
1dyc_A | 164 | Determination Of Alpha-Helix Propensity Within The | 3e-04 | |
248l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 3e-04 | |
3cdr_A | 164 | R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K | 3e-04 | |
150l_A | 164 | Conservation Of Solvent-Binding Sites In 10 Crystal | 3e-04 | |
1l92_A | 164 | Similar Hydrophobic Replacements Of Leu 99 And Phe | 3e-04 | |
1l34_A | 164 | High-Resolution Structure Of The Temperature-Sensit | 3e-04 | |
1pqo_A | 164 | T4 Lysozyme Core Repacking Mutant L118iTA Length = | 3e-04 | |
1p7s_A | 164 | T4 Lysozyme Core Repacking Mutant V103iTA Length = | 3e-04 | |
3c7z_A | 164 | T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Len | 3e-04 | |
1l79_A | 164 | Design And Structural Analysis Of Alternative Hydro | 3e-04 | |
1qsq_A | 164 | Cavity Creating Mutation Length = 164 | 3e-04 | |
211l_A | 165 | Protein Structure Plasticity Exemplified By Inserti | 3e-04 | |
1l97_A | 164 | Structure Of A Hinge-Bending Bacteriophage T4 Lysoz | 3e-04 | |
1l21_A | 164 | Contributions Of Left-Handed Helical Residues To Th | 3e-04 | |
1kw5_A | 162 | Methionine Core Mutant Of T4 Lysozyme Length = 162 | 3e-04 | |
1cv4_A | 164 | T4 Lysozyme Mutant L118m Length = 164 | 3e-04 | |
1l14_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 3e-04 | |
1l52_A | 164 | Structural And Thermodynamic Analysis Of The Packin | 3e-04 | |
1ssw_A | 164 | Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY | 3e-04 | |
1l08_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 3e-04 | |
1l09_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 3e-04 | |
229l_A | 164 | Generating Ligand Binding Sites In T4 Lysozyme Usin | 3e-04 | |
1l10_A | 164 | Structural Studies Of Mutants Of The Lysozyme Of Ba | 3e-04 | |
2nth_A | 164 | Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 | 3e-04 | |
1ssy_A | 164 | Crystal Structure Of Phage T4 Lysozyme Mutant G28aI | 3e-04 | |
1l15_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 3e-04 | |
1lyd_A | 164 | Crystal Structure Of T4-Lysozyme Generated From Syn | 3e-04 | |
1cvk_A | 164 | T4 Lysozyme Mutant L118a Length = 164 | 3e-04 | |
1l76_A | 164 | Tolerance Of T4 Lysozyme To Proline Substitutions W | 3e-04 | |
3fa0_A | 162 | Evaulaution At Atomic Resolution Of The Role Of Str | 3e-04 | |
1l46_A | 164 | Cumulative Site-Directed Charge-Change Replacements | 3e-04 | |
1l17_A | 164 | Hydrophobic Stabilization In T4 Lysozyme Determined | 3e-04 | |
1t6h_A | 164 | Crystal Structure T4 Lysozyme Incorporating An Unna | 4e-04 | |
1ky0_A | 162 | Methionine Core Mutant Of T4 Lysozyme Length = 162 | 4e-04 | |
1l42_A | 164 | Cumulative Site-Directed Charge-Change Replacements | 4e-04 | |
1l57_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 4e-04 | |
1l07_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
1l04_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
3c83_A | 164 | Bacteriophage T4 Lysozyme Mutant D89a In Wildtype B | 4e-04 | |
3hwl_A | 164 | Crystal Structure Of T4 Lysozyme With The Unnatural | 4e-04 | |
2igc_A | 164 | Structure Of Spin Labeled T4 Lysozyme Mutant T115r1 | 4e-04 | |
1l16_A | 164 | Structural Analysis Of The Temperature-Sensitive Mu | 4e-04 | |
1l53_A | 164 | Structural And Thermodynamic Analysis Of The Packin | 4e-04 | |
1l19_A | 164 | Enhanced Protein Thermostability From Designed Muta | 4e-04 | |
1l12_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
1l03_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
1l11_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
172l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 4e-04 | |
1l18_A | 164 | Hydrophobic Stabilization In T4 Lysozyme Determined | 4e-04 | |
3dke_X | 164 | Polar And Non-Polar Cavities In Phage T4 Lysozyme L | 4e-04 | |
162l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 4e-04 | |
167l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 4e-04 | |
166l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 4e-04 | |
149l_A | 164 | Conservation Of Solvent-Binding Sites In 10 Crystal | 4e-04 | |
1c69_A | 164 | T4 Lysozyme Mutant C54tC97AL133A IN THE PRESENCE OF | 4e-04 | |
1l01_A | 164 | Structural Studies Of Mutants Of The Lysozyme Of Ba | 4e-04 | |
2b7w_B | 170 | Sequential Reorganization Of Beta-Sheet Topology By | 4e-04 | |
1l06_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
164l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 4e-04 | |
1l02_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
177l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 4e-04 | |
1l98_A | 164 | Perturbation Of Trp 138 In T4 Lysozyme By Mutations | 4e-04 | |
231l_A | 164 | T4 Lysozyme Mutant M106k Length = 164 | 4e-04 | |
3c7w_A | 164 | Contributions Of All 20 Amino Acids At Site 96 To T | 4e-04 | |
1cv3_A | 164 | T4 Lysozyme Mutant L121m Length = 164 | 4e-04 | |
1swy_A | 164 | Use Of A Halide Binding Site To Bypass The 1000-Ato | 4e-04 | |
1cuq_A | 164 | T4 Lysozyme Mutant V103m Length = 164 | 4e-04 | |
1l56_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 4e-04 | |
1g1w_A | 164 | T4 Lysozyme Mutant C54tC97AQ105M Length = 164 | 4e-04 | |
220l_A | 164 | Generating Ligand Binding Sites In T4 Lysozyme Usin | 4e-04 | |
1lyf_A | 164 | Dissection Of Helix Capping In T4 Lysozyme By Struc | 4e-04 | |
1l13_A | 164 | Contributions Of Hydrogen Bonds Of Thr 157 To The T | 4e-04 | |
3fi5_A | 164 | Crystal Structure Of T4 Lysozyme Mutant R96w Length | 4e-04 | |
1quh_A | 162 | L99gE108V MUTANT OF T4 LYSOZYME Length = 162 | 4e-04 | |
1l60_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 4e-04 | |
1quo_A | 162 | L99aE108V MUTANT OF T4 LYSOZYME Length = 162 | 5e-04 | |
155l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 5e-04 | |
1l72_A | 164 | Multiple Stabilizing Alanine Replacements Within Al | 5e-04 | |
128l_A | 164 | The Energetic Cost And The Structural Consequences | 5e-04 | |
196l_A | 164 | Thermodynamic And Structural Compensation In "size- | 5e-04 | |
151l_A | 164 | Conservation Of Solvent-Binding Sites In 10 Crystal | 5e-04 | |
1l58_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 5e-04 | |
1c63_A | 164 | T4 Lysozyme Mutant C54tC97AL121A IN THE PRESENCE OF | 5e-04 | |
1l00_A | 164 | Perturbation Of Trp 138 In T4 Lysozyme By Mutations | 5e-04 | |
125l_A | 164 | The Energetic Cost And The Structural Consequences | 5e-04 | |
175l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 5e-04 | |
3cdv_A | 164 | Contributions Of All 20 Amino Acids At Site 96 To T | 5e-04 | |
2b6t_A | 162 | T4 Lysozyme Mutant L99a At 200 Mpa Length = 162 | 5e-04 | |
158l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 5e-04 | |
1c6c_A | 164 | T4 Lysozyme Mutant C54tC97AL99A IN THE PRESENCE OF | 5e-04 | |
1qud_A | 162 | L99g Mutant Of T4 Lysozyme Length = 162 | 5e-04 | |
1qsb_A | 162 | The Introduction Of Strain And Its Effects On The S | 5e-04 | |
197l_A | 164 | Thermodynamic And Structural Compensation In "size- | 5e-04 | |
143l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 5e-04 | |
173l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 5e-04 | |
2qb0_B | 241 | Structure Of The 2tel Crystallization Module Fused | 5e-04 | |
1c66_A | 164 | T4 Lysozyme Mutant C54tC97AL121AL133A IN THE PRESEN | 5e-04 | |
1l38_A | 164 | Contributions Of Engineered Surface Salt Bridges To | 5e-04 | |
3c8s_A | 164 | Contributions Of All 20 Amino Acids At Site 96 To T | 5e-04 | |
1c6l_A | 164 | T4 Lysozyme Mutant C54tC97AL99AF153A IN THE PRESENC | 5e-04 | |
1cu0_A | 164 | T4 Lysozyme Mutant I78m Length = 164 | 6e-04 | |
1b6i_A | 164 | T4 Lysozyme Mutant With Cys 54 Replaced By Thr, Cys | 6e-04 | |
1l59_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 6e-04 | |
1l37_A | 164 | Contributions Of Engineered Surface Salt Bridges To | 6e-04 | |
1ctw_A | 164 | T4 Lysozyme Mutant I78a Length = 164 | 6e-04 | |
2hum_A | 164 | Crystal Structure Of T4 Lysozyme D72c Synthetic Dim | 6e-04 | |
3cdo_A | 164 | Bacteriophage T4 Lysozyme Mutant R96v In Wildtype B | 6e-04 | |
252l_A | 164 | Generating Ligand Binding Sites In T4 Lysozyme Usin | 6e-04 | |
1qth_A | 164 | The Introduction Of Strain And Its Effects On The S | 6e-04 | |
1qs9_A | 162 | The Introduction Of Strain And Its Effects On The S | 6e-04 | |
1ks3_A | 162 | Methionine Core Mutant Of T4 Lysozyme Length = 162 | 6e-04 | |
3k2r_A | 164 | Crystal Structure Of Spin Labeled T4 Lysozyme Mutan | 6e-04 | |
1p2l_A | 164 | T4 Lysozyme Core Repacking Mutant V87iTA Length = 1 | 6e-04 | |
1l62_A | 164 | Analysis Of The Interaction Between Charged Side Ch | 7e-04 | |
3c8q_A | 164 | Contribution Of All 20 Amino Acids At Site 96 To Th | 7e-04 | |
1l99_A | 164 | Perturbation Of Trp 138 In T4 Lysozyme By Mutations | 7e-04 | |
1l0k_A | 162 | Methionine Core Mutant Of T4 Lysozyme Length = 162 | 7e-04 | |
1cu6_A | 164 | T4 Lysozyme Mutant L91a Length = 164 | 7e-04 | |
2ou9_A | 164 | Structure Of Spin-Labeled T4 Lysozyme Mutant T115r1 | 7e-04 | |
236l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 7e-04 | |
139l_A | 164 | Rapid Crystallization Of T4 Lysozyme By Intermolecu | 7e-04 | |
142l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 7e-04 | |
156l_A | 164 | Control Of Enzyme Activity By An Engineered Disulfi | 7e-04 | |
1ky1_A | 162 | Methionine Core Mutant Of T4 Lysozyme Length = 162 | 8e-04 | |
1d9w_A | 164 | Bacteriophage T4 Lysozyme Mutant Length = 164 | 8e-04 | |
1d3f_A | 164 | N-Terminal Domain Core Methionine Mutation Length = | 8e-04 | |
1l54_A | 164 | The Structural And Thermodynamic Consequences Of Bu | 8e-04 | |
1l32_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 8e-04 | |
3cdq_A | 164 | Contributions Of All 20 Amino Acids At Site 96 To T | 8e-04 | |
1l28_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 8e-04 | |
1l29_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 8e-04 | |
3c7y_A | 164 | Mutant R96a Of T4 Lysozyme In Wildtype Background A | 8e-04 | |
2qar_C | 163 | Structure Of The 2tel Crystallization Module Fused | 8e-04 | |
1l27_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 8e-04 | |
1qs5_A | 162 | The Introduction Of Strain And Its Effects On The S | 8e-04 | |
1cx7_A | 164 | T4 Lysozyme Methionine Core Mutant Length = 164 | 8e-04 | |
1l26_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 8e-04 | |
190l_A | 164 | A Helix Initiation Signal In T4 Lysozyme Identified | 8e-04 | |
1l30_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 9e-04 | |
127l_A | 164 | The Energetic Cost And The Structural Consequences | 9e-04 | |
1cu3_A | 164 | T4 Lysozyme Mutant V87m Length = 164 | 9e-04 | |
3cdt_A | 164 | Contributions Of All 20 Amino Acids At Site 96 To T | 0.001 | |
1l25_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 0.001 | |
138l_A | 164 | Rapid Crystallization Of T4 Lysozyme By Intermolecu | 0.001 | |
1l44_A | 164 | Cumulative Site-Directed Charge-Change Replacements | 0.001 | |
246l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 0.001 | |
1d3m_A | 164 | Methionine Core Mutation Length = 164 | 0.001 | |
3dn8_A | 164 | Iodopentafluorobenzene Binding In The Hydrophobic C | 0.001 | |
1l51_A | 164 | Structural And Thermodynamic Analysis Of The Packin | 0.001 | |
1l49_A | 164 | Structural And Thermodynamic Analysis Of The Packin | 0.001 | |
1l48_A | 164 | Structural And Thermodynamic Analysis Of The Packin | 0.001 | |
195l_A | 164 | Thermodynamic And Structural Compensation In "size- | 0.001 | |
1l31_A | 164 | Replacements Of Pro86 In Phage T4 Lysozyme Extend A | 0.001 | |
141l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 0.001 | |
1qtc_A | 162 | The Introduction Of Strain And Its Effects On The S | 0.001 | |
3c8r_A | 164 | Contributions Of All 20 Amino Acids At Site 96 To S | 0.001 | |
199l_A | 164 | Thermodynamic And Structural Compensation In "size- | 0.001 | |
144l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 0.001 | |
1l0j_A | 162 | Methionine Core Mutant Of T4 Lysozyme Length = 162 | 0.001 | |
1l50_A | 164 | Structural And Thermodynamic Analysis Of The Packin | 0.001 | |
140l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 0.001 | |
1cv0_A | 164 | T4 Lysozyme Mutant F104m Length = 164 | 0.001 | |
2z6b_A | 584 | Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugate | 0.002 | |
1wth_A | 584 | Crystal Structure Of Gp5-S351l Mutant And Gp27 Comp | 0.002 | |
1pdl_A | 575 | Fitting Of Gp5 In The Cryoem Reconstruction Of The | 0.002 | |
1k28_A | 584 | The Structure Of The Bacteriophage T4 Cell-Puncturi | 0.002 | |
1lgu_A | 164 | T4 Lysozyme Mutant L99aM102Q Length = 164 | 0.002 | |
2rbn_A | 162 | N-Phenylglycinonitrile In Complex With T4 Lysozyme | 0.002 | |
3l2x_A | 164 | Crystal Structure Of Spin Labeled T4 Lysozyme Mutan | 0.002 | |
146l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 0.002 | |
215l_A | 165 | Protein Structure Plasticity Exemplified By Inserti | 0.002 | |
227l_A | 164 | Generating Ligand Binding Sites In T4 Lysozyme Usin | 0.002 | |
1lyg_A | 164 | Dissection Of Helix Capping In T4 Lysozyme By Struc | 0.002 | |
1lyi_A | 164 | Dissection Of Helix Capping In T4 Lysozyme By Struc | 0.002 | |
210l_A | 163 | Protein Structure Plasticity Exemplified By Inserti | 0.002 | |
1g1v_A | 164 | T4 Lysozyme Mutant C54tC97AI58T Length = 164 | 0.002 | |
198l_A | 164 | Thermodynamic And Structural Compensation In "size- | 0.002 | |
243l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 0.003 | |
214l_A | 165 | Protein Structure Plasticity Exemplified By Inserti | 0.003 | |
1lwg_A | 164 | Multiple Methionine Substitutions Are Tolerated In | 0.003 | |
249l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 0.003 | |
250l_A | 164 | The Response Of T4 Lysozyme To Large-To-Small Subst | 0.003 | |
218l_A | 165 | Protein Structure Plasticity Exemplified By Inserti | 2e-04 | |
1kni_A | 164 | Stabilizing Disulfide Bridge Mutant Of T4 Lysozyme | 3e-04 | |
223l_A | 164 | Generating Ligand Binding Sites In T4 Lysozyme Usin | 4e-04 | |
1l20_A | 164 | Enhanced Protein Thermostability From Designed Muta | 4e-04 | |
1dyd_A | 164 | Determination Of Alpha-Helix Propensity Within The | 4e-04 | |
147l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 4e-04 | |
118l_A | 164 | The Energetic Cost And The Structural Consequences | 5e-04 | |
152l_A | 164 | Conservation Of Solvent-Binding Sites In 10 Crystal | 5e-04 | |
3huq_A | 162 | Thieno[3,2-B]thiophene In Complex With T4 Lysozyme | 0.002 | |
3ht6_A | 164 | 2-Methylphenol In Complex With T4 Lysozyme L99aM102 | 0.002 | |
1qtd_A | 162 | The Introduction Of Strain And Its Effects On The S | 0.002 | |
145l_A | 164 | Role Of Backbone Flexibility In The Accommodation O | 0.002 | |
169l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 0.003 | |
3guj_A | 164 | T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN | 0.004 | |
3gui_A | 164 | T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN | 0.004 | |
192l_A | 164 | A Helix Initiation Signal In T4 Lysozyme Identified | 0.004 | |
168l_A | 164 | Protein Flexibility And Adaptability Seen In 25 Cry | 0.004 | |
1l74_A | 164 | Multiple Stabilizing Alanine Replacements Within Al | 0.004 | |
1l36_A | 164 | Toward A Simplification Of The Protein Folding Prob | 0.004 |
gi|262367957|pdb|3HDE|A Chain A, Crystal Structure Of Full-Length Endolysin R21 From Phage 21 Length = 165 | Back alignment and structure |
Score = 119 bits (298), Expect = 2e-25, Method: Composition-based stats. Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 2/101 (1%) Query: 2 TITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQR 61 T T E + LL DL + + E A+ FV+N+G GN+ ST ++ Sbjct: 65 TYTKAECKALLNKDLATVARQINPYIKV--DIPETMRGALYSFVYNVGAGNFRTSTLLRK 122 Query: 62 VDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG 102 ++ D + A ++ ++WT AGG+ +G+ RR + L G Sbjct: 123 INQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWG 163 |
>gi|262367961|pdb|3HDF|A Chain A, Crystal Structure Of Truncated Endolysin R21 From Phage 21 Length = 140 | Back alignment and structure |
>gi|90108744|pdb|2ANV|A Chain A, Crystal Structure Of P22 Lysozyme Mutant L86m Length = 146 | Back alignment and structure |
>gi|60594001|pdb|1XJU|A Chain A, Crystal Structure Of Secreted Inactive Form Of P1 Phage Endolysin Lyz Length = 163 | Back alignment and structure |
>gi|60594000|pdb|1XJT|A Chain A, Crystal Structure Of Active Form Of P1 Phage Endolysin Lyz Length = 191 | Back alignment and structure |
>gi|310689932|pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 | Back alignment and structure |
>gi|310689930|pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 | Back alignment and structure |
>gi|310689928|pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 | Back alignment and structure |
>gi|310943018|pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 | Back alignment and structure |
>gi|319443693|pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 | Back alignment and structure |
>gi|209447557|pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 | Back alignment and structure |
>gi|159795485|pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein-Coupled Receptor Length = 500 | Back alignment and structure |
>gi|37927585|pdb|1PQK|A Chain A, Repacking Of The Core Of T4 Lysozyme By Automated Design Length = 164 | Back alignment and structure |
>gi|190613726|pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 | Back alignment and structure |
>gi|37927389|pdb|1P3N|A Chain A, Core Redesign Back-Revertant I103vCORE10 Length = 164 | Back alignment and structure |
>gi|317455410|pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 | Back alignment and structure |
>gi|157831726|pdb|1L70|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 | Back alignment and structure |
>gi|37927571|pdb|1PQD|A Chain A, T4 Lysozyme Core Repacking Mutant Core10TA Length = 164 | Back alignment and structure |
>gi|37927387|pdb|1P37|A Chain A, T4 Lysozyme Core Repacking Back-Revertant L102mCORE10 Length = 164 | Back alignment and structure |
>gi|14488752|pdb|1G0P|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149g Length = 164 | Back alignment and structure |
>gi|157834489|pdb|232L|A Chain A, T4 Lysozyme Mutant M120k Length = 164 | Back alignment and structure |
>gi|157830899|pdb|1DYA|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834492|pdb|235L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|7767116|pdb|1EPY|A Chain A, T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 164 | Back alignment and structure |
>gi|157830905|pdb|1DYG|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831678|pdb|1L22|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831711|pdb|1L55|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|110590780|pdb|2A4T|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (V131r7) Length = 164 | Back alignment and structure |
>gi|37927425|pdb|1P6Y|A Chain A, T4 Lysozyme Core Repacking Mutant M120yTA Length = 164 | Back alignment and structure |
>gi|157831727|pdb|1L71|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 | Back alignment and structure |
>gi|37927410|pdb|1P64|A Chain A, T4 Lysozyme Core Repacking Mutant L133fTA Length = 164 | Back alignment and structure |
>gi|157831689|pdb|1L33|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829593|pdb|160L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 | Back alignment and structure |
>gi|157829619|pdb|189L|A Chain A, Enhancement Of Protein Stability By The Combination Of Point Mutations In T4 Lysozyme Is Additive Length = 164 | Back alignment and structure |
>gi|20150541|pdb|1JTM|A Chain A, Alternative Structures Of A Sequence Extended T4 Lysozyme Show That The Highly Conserved Beta-Sheet Has Weak Intrinsic Folding Propensity Length = 178 | Back alignment and structure |
>gi|157834490|pdb|233L|A Chain A, T4 Lysozyme Mutant M120l Length = 164 | Back alignment and structure |
>gi|14488751|pdb|1G0M|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152i Length = 164 | Back alignment and structure |
>gi|37927406|pdb|1P46|A Chain A, T4 Lysozyme Core Repacking Mutant M106iTA Length = 164 | Back alignment and structure |
>gi|37927383|pdb|1P2R|A Chain A, T4 Lysozyme Core Repacking Mutant I78vTA Length = 164 | Back alignment and structure |
>gi|157829601|pdb|170L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|37927583|pdb|1PQJ|A Chain A, T4 Lysozyme Core Repacking Mutant A111vCORE10TA Length = 164 | Back alignment and structure |
>gi|157829596|pdb|163L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 | Back alignment and structure |
>gi|146387591|pdb|2O79|A Chain A, T4 Lysozyme With C-Terminal Extension Length = 170 | Back alignment and structure |
>gi|157830903|pdb|1DYE|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|37927581|pdb|1PQI|A Chain A, T4 Lysozyme Core Repacking Mutant I118lCORE7TA Length = 164 | Back alignment and structure |
>gi|261825045|pdb|3JR6|A Chain A, Sequential Reorganization Of Beta-Sheet Topology By Insertion Of A Single Strand Length = 170 | Back alignment and structure |
>gi|146387572|pdb|2O4W|A Chain A, T4 Lysozyme Circular Permutant Length = 171 | Back alignment and structure |
>gi|494717|pdb|201L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 | Back alignment and structure |
>gi|157829547|pdb|119L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|6729790|pdb|1CV5|A Chain A, T4 Lysozyme Mutant L133m Length = 164 | Back alignment and structure |
>gi|157834504|pdb|247L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|4930159|pdb|259L|A Chain A, An Adaptable Metal-Binding Site Engineered Into T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829556|pdb|129L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 | Back alignment and structure |
>gi|157831733|pdb|1L77|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829551|pdb|123L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|20150496|pdb|1JQU|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 | Back alignment and structure |
>gi|157829548|pdb|120L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834454|pdb|206L|A Chain A, Phage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834475|pdb|221L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831720|pdb|1L64|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 | Back alignment and structure |
>gi|5822356|pdb|1QT6|A Chain A, E11h Mutant Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|52695672|pdb|1T8A|A Chain A, Use Of Sequence Duplication To Engineer A Ligand-Triggered Long-Distance Molecular Switch In T4 Lysosyme Length = 175 | Back alignment and structure |
>gi|14488750|pdb|1G0L|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152v Length = 164 | Back alignment and structure |
>gi|157834495|pdb|238L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|157834494|pdb|237L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|5542484|pdb|1QTB|A Chain A, The Introduction Of Strain And Its Effects On The Structure And Stability Of T4 Lysozyme Length = 162 | Back alignment and structure |
>gi|118137974|pdb|2HUK|A Chain A, Crystal Structure Of T4 Lysozyme V131c Synthetic Dimer Length = 164 | Back alignment and structure |
>gi|157833964|pdb|1TLA|A Chain A, Hydrophobic Core Repacking And Aromatic-Aromatic Interaction In The Thermostable Mutant Of T4 Lysozyme Ser 117 (Right Arrow) Phe Length = 164 | Back alignment and structure |
>gi|157829526|pdb|103L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 167 | Back alignment and structure |
>gi|9257165|pdb|1CV1|A Chain A, T4 Lysozyme Mutant V111m Length = 164 | Back alignment and structure |
>gi|6729784|pdb|1CUP|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834491|pdb|234L|A Chain A, T4 Lysozyme Mutant M106l Length = 164 | Back alignment and structure |
>gi|5822381|pdb|1QUG|A Chain A, E108v Mutant Of T4 Lysozyme Length = 162 | Back alignment and structure |
>gi|151567976|pdb|2Q9D|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 Length = 164 | Back alignment and structure |
>gi|114793376|pdb|1ZYT|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (A82r1) Length = 164 | Back alignment and structure |
>gi|157829541|pdb|112L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834487|pdb|230L|A Chain A, T4 Lysozyme Mutant M6l Length = 164 | Back alignment and structure |
>gi|48425202|pdb|1P5C|A Chain A, Circular Permutation Of Helix A In T4 Lysozyme Length = 167 | Back alignment and structure |
>gi|157831741|pdb|1L86|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157834512|pdb|254L|A Chain A, Lysozyme Length = 164 | Back alignment and structure |
>gi|5822357|pdb|1QT7|A Chain A, E11n Mutant Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|14488744|pdb|1G06|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149s Length = 164 | Back alignment and structure |
>gi|157831750|pdb|1L95|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157829558|pdb|130L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 | Back alignment and structure |
>gi|14488748|pdb|1G0J|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152s Length = 164 | Back alignment and structure |
>gi|157829559|pdb|131L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 | Back alignment and structure |
>gi|5822358|pdb|1QT8|A Chain A, T26h Mutant Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157879603|pdb|1P56|A Chain A, Duplication-Extension Of Helix A Of T4 Lysozyme Length = 176 | Back alignment and structure |
>gi|37927589|pdb|1PQM|A Chain A, T4 Lysozyme Core Repacking Mutant V149iT152VTA Length = 164 | Back alignment and structure |
>gi|5107702|pdb|261L|A Chain A, Structural Characterisation Of An Engineered Tandem Repeat Contrasts The Importance Of Context And Sequence In Protein Folding Length = 173 | Back alignment and structure |
>gi|21466123|pdb|1LLH|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 | Back alignment and structure |
>gi|14488753|pdb|1G0Q|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149i Length = 164 | Back alignment and structure |
>gi|157834502|pdb|245L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|157830900|pdb|1DYB|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|10835387|pdb|1C6P|A Chain A, T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 ATM ARGON Length = 164 | Back alignment and structure |
>gi|157829553|pdb|126L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829602|pdb|171L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|56553847|pdb|1T8G|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant L32aL33AT34AC54TC97AE108V Length = 164 | Back alignment and structure |
>gi|157829531|pdb|107L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834514|pdb|255L|A Chain A, Hydrolase Length = 164 | Back alignment and structure |
>gi|157831695|pdb|1L39|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 | Back alignment and structure |
>gi|157835299|pdb|2L78|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834479|pdb|224L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|223674040|pdb|3FAD|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 164 | Back alignment and structure |
>gi|157829533|pdb|108L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|5822379|pdb|1QTZ|A Chain A, D20c Mutant Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829544|pdb|114L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829545|pdb|115L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831679|pdb|1L23|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 | Back alignment and structure |
>gi|5822353|pdb|1QT3|A Chain A, T26d Mutant Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831742|pdb|1L87|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157831722|pdb|1L66|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 | Back alignment and structure |
>gi|9257162|pdb|1CU2|A Chain A, T4 Lysozyme Mutant L84m Length = 164 | Back alignment and structure |
>gi|37927385|pdb|1P36|A Chain A, T4 Lyoszyme Core Repacking Mutant I100vTA Length = 164 | Back alignment and structure |
>gi|229597880|pdb|3G3W|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (T151r1) At 291 K Length = 164 | Back alignment and structure |
>gi|1065176|pdb|176L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|575962|pdb|137L|A Chain A, Structural Basis Of Amino Acid Alpha Helix Propensity Length = 164 | Back alignment and structure |
>gi|157829524|pdb|102L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 165 | Back alignment and structure |
>gi|157831691|pdb|1L35|A Chain A, Structure Of A Thermostable Disulfide-Bridge Mutant Of Phage T4 Lysozyme Shows That An Engineered Crosslink In A Flexible Region Does Not Increase The Rigidity Of The Folded Protein Length = 164 | Back alignment and structure |
>gi|157831723|pdb|1L67|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 | Back alignment and structure |
>gi|14488745|pdb|1G07|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149c Length = 164 | Back alignment and structure |
>gi|14488749|pdb|1G0K|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152c Length = 164 | Back alignment and structure |
>gi|223673907|pdb|3C80|A Chain A, T4 Lysozyme Mutant R96y At Room Temperature Length = 164 | Back alignment and structure |
>gi|223673909|pdb|3C82|A Chain A, Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H Length = 164 | Back alignment and structure |
>gi|157829539|pdb|111L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834511|pdb|253L|A Chain A, Lysozyme Length = 164 | Back alignment and structure |
>gi|157831721|pdb|1L65|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 | Back alignment and structure |
>gi|157831717|pdb|1L61|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|5822355|pdb|1QT5|A Chain A, D20e Mutant Structure Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|118137975|pdb|2HUL|A Chain A, Crystal Structure Of T4 Lysozyme S44c Synthetic Dimer Length = 164 | Back alignment and structure |
>gi|56553846|pdb|1T8F|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant R14aK16AI17AK19AT21AE22AC54TC97A Length = 164 | Back alignment and structure |
>gi|5822354|pdb|1QT4|A Chain A, T26q Mutant Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|10835363|pdb|1C60|A Chain A, T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 8 ATM Argon Length = 164 | Back alignment and structure |
>gi|157831743|pdb|1L88|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157829537|pdb|110L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829535|pdb|109L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|442543|pdb|104L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 | Back alignment and structure |
>gi|157831703|pdb|1L47|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 | Back alignment and structure |
>gi|157834467|pdb|213L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 | Back alignment and structure |
>gi|6729794|pdb|1D2W|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 | Back alignment and structure |
>gi|157834470|pdb|217L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|6729791|pdb|1CV6|A Chain A, T4 Lysozyme Mutant V149m Length = 164 | Back alignment and structure |
>gi|157834499|pdb|242L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|14488747|pdb|1G0G|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152a Length = 164 | Back alignment and structure |
>gi|515062|pdb|148L|E Chain E, A Covalent Enzyme-Substrate Intermediate With Saccharide Distortion In A Mutant T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834498|pdb|241L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|6729795|pdb|1D2Y|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 | Back alignment and structure |
>gi|157829550|pdb|122L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834496|pdb|239L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|157831736|pdb|1L81|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834497|pdb|240L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|157831724|pdb|1L68|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 | Back alignment and structure |
>gi|157830904|pdb|1DYF|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831735|pdb|1L80|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|14277939|pdb|1I6S|A Chain A, T4 Lysozyme Mutant C54tC97AN101A Length = 164 | Back alignment and structure |
>gi|6729782|pdb|1CU5|A Chain A, T4 Lysozyme Mutant L91m Length = 164 | Back alignment and structure |
>gi|151567977|pdb|2Q9E|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 Length = 164 | Back alignment and structure |
>gi|33357813|pdb|1OYU|A Chain A, Long-Distance Conformational Changes In A Protein Engineered By Modulated Sequence Duplication Length = 175 | Back alignment and structure |
>gi|157834451|pdb|205L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 167 | Back alignment and structure |
>gi|31615480|pdb|1KW7|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 | Back alignment and structure |
>gi|157831737|pdb|1L82|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157829598|pdb|165L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 | Back alignment and structure |
>gi|157829592|pdb|159L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 | Back alignment and structure |
>gi|157831749|pdb|1L94|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157834501|pdb|244L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|6729797|pdb|1D3J|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 | Back alignment and structure |
>gi|223674038|pdb|3F9L|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 164 | Back alignment and structure |
>gi|157831748|pdb|1L93|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157834466|pdb|212L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 168 | Back alignment and structure |
>gi|157831697|pdb|1L41|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 | Back alignment and structure |
>gi|576360|pdb|216L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831680|pdb|1L24|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 | Back alignment and structure |
>gi|157829594|pdb|161L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 | Back alignment and structure |
>gi|157831701|pdb|1L45|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 | Back alignment and structure |
>gi|1065158|pdb|174L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|223673908|pdb|3C81|A Chain A, Mutant K85a Of T4 Lysozyme In Wildtype Background At Room Temperature Length = 164 | Back alignment and structure |
>gi|157829543|pdb|113L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831746|pdb|1L91|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157830901|pdb|1DYC|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834505|pdb|248L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 | Back alignment and structure |
>gi|223673921|pdb|3CDR|A Chain A, R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K Length = 164 | Back alignment and structure |
>gi|515066|pdb|150L|A Chain A, Conservation Of Solvent-Binding Sites In 10 Crystal Forms Of T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831747|pdb|1L92|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 | Back alignment and structure |
>gi|157831690|pdb|1L34|A Chain A, High-Resolution Structure Of The Temperature-Sensitive Mutant Of Phage Lysozyme, Arg 96 (Right Arrow) His Length = 164 | Back alignment and structure |
>gi|37927591|pdb|1PQO|A Chain A, T4 Lysozyme Core Repacking Mutant L118iTA Length = 164 | Back alignment and structure |
>gi|37927436|pdb|1P7S|A Chain A, T4 Lysozyme Core Repacking Mutant V103iTA Length = 164 | Back alignment and structure |
>gi|223673906|pdb|3C7Z|A Chain A, T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Length = 164 | Back alignment and structure |
>gi|157831734|pdb|1L79|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|6729807|pdb|1QSQ|A Chain A, Cavity Creating Mutation Length = 164 | Back alignment and structure |
>gi|157834465|pdb|211L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 | Back alignment and structure |
>gi|443083|pdb|1L97|A Chain A, Structure Of A Hinge-Bending Bacteriophage T4 Lysozyme Mutant, Ile3-> Pro Length = 164 | Back alignment and structure |
>gi|157831677|pdb|1L21|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|31615479|pdb|1KW5|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 | Back alignment and structure |
>gi|6729789|pdb|1CV4|A Chain A, T4 Lysozyme Mutant L118m Length = 164 | Back alignment and structure |
>gi|157831670|pdb|1L14|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831708|pdb|1L52|A Chain A, Structural And Thermodynamic Analysis Of The Packing Of Two Alpha-Helices In Bacteriophage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|56553736|pdb|1SSW|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY25AT26AI27AC54TC97A Length = 164 | Back alignment and structure |
>gi|157831664|pdb|1L08|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157831665|pdb|1L09|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 | Back alignment and structure |
>gi|157834485|pdb|229L|A Chain A, Generating Ligand Binding Sites In T4 Lysozyme Using Deficiency-Creating Substitutions Length = 164 | Back alignment and structure |
>gi|157831666|pdb|1L10|A Chain A, Structural Studies Of Mutants Of The Lysozyme Of Bacteriophage T4. The Temperature-Sensitive Mutant Protein Thr157 (Right Arrow) Ile Length = 164 | Back alignment and structure |
>gi|149242489|pdb|2NTH|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 Length = 164 | Back alignment and structure |
>gi|56553737|pdb|1SSY|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant G28aI29AG30AC54TC97A Length = 164 | Back alignment and structure |
>gi|157831671|pdb|1L15|A Chain A, Contributions Of Hydrogen Bonds Of Thr 157 To The Thermodynamic Stability Of Phage T4 Lysozyme Length = 164 | Back alignment and structure |
gi|157831899|pdb|1LYD|A Chain A, Crystal Structure Of T4-Lysozyme Generated From Synthetic Coding Dna Expressed In Escherichia Coli Length = 164 | Back alignment and structure |
>gi|6729792|pdb|1CVK|A Chain A, T4 Lysozyme Mutant L118a Length = 164 | Back alignment and structure |
>gi|157831732|pdb|1L76|A Chain A, Tolerance Of T4 Lysozyme To Proline Substitutions Within The Long Interdomain Alpha-Helix Illustrates The Adaptability Of Proteins To Potentially Destabilizing Lesions Length = 164 | Back alignment and structure |
>gi|223674039|pdb|3FA0|A Chain A, Evaulaution At Atomic Resolution Of The Role Of Strain In Destabilizing The Temperature Sensitive T4 Lysozyme Mutant Arg96-->his Length = 162 | Back alignment and structure |
>gi|157831702|pdb|1L46|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 | Back alignment and structure |
>gi|157831673|pdb|1L17|A Chain A, Hydrophobic Stabilization In T4 Lysozyme Determined Directly By Multiple S |