BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide
binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62]
         (249 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040737|gb|ACT57533.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 249

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 249/249 (100%), Positives = 249/249 (100%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG
Sbjct: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP
Sbjct: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI
Sbjct: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE
Sbjct: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240

Query: 241 NGYAELIKE 249
           NGYAELIKE
Sbjct: 241 NGYAELIKE 249


>gi|315122395|ref|YP_004062884.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495797|gb|ADR52396.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 258

 Score =  441 bits (1133), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 209/249 (83%), Positives = 235/249 (94%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M EI NL AKI++TDTEIIRGLNLKV+P EVVAIMGPNGSGKSTL+Y++SGHK YE+TAG
Sbjct: 1   MFEIINLHAKIIETDTEIIRGLNLKVDPGEVVAIMGPNGSGKSTLAYVVSGHKSYEVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILYKGESILDWSI ERASKGIFLAFQYPVEIPGI+ MQFLK ALNEQRKARNE+++L+P
Sbjct: 61  DILYKGESILDWSISERASKGIFLAFQYPVEIPGIVTMQFLKSALNEQRKARNEEDILVP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF RKVRKI  +LGINMDMLKRPLNLGFSGGEKKI+EILQM LLEPSLCILDETDSGLDI
Sbjct: 121 DFIRKVRKIAGDLGINMDMLKRPLNLGFSGGEKKISEILQMHLLEPSLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+AAQGVN+LRSQ+RSFLIITHYQRLL+YIKPDT+HVL++G+I+KTGD+SI LDLE 
Sbjct: 181 DALKVAAQGVNSLRSQNRSFLIITHYQRLLDYIKPDTVHVLYDGRIVKTGDFSIVLDLEM 240

Query: 241 NGYAELIKE 249
           NGYA+LI+E
Sbjct: 241 NGYAKLIEE 249


>gi|325293225|ref|YP_004279089.1| FeS assembly ATPase SufC [Agrobacterium sp. H13-3]
 gi|325061078|gb|ADY64769.1| FeS assembly ATPase SufC [Agrobacterium sp. H13-3]
          Length = 251

 Score =  377 bits (969), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/249 (71%), Positives = 213/249 (85%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI +L AKI DT+TEII+GLNLKV   EV AIMGPNGSGKSTLSY+LSG +DYE+T+G
Sbjct: 1   MLEIIDLHAKIADTETEIIKGLNLKVAAGEVAAIMGPNGSGKSTLSYILSGREDYEVTSG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDAAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEAELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V++   +L I+MDMLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFIRRVKEAAGDLKIDMDMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNAL+S DR+ ++ITHYQRLL+YI PD++HVL+ GKII++GD ++AL+LE 
Sbjct: 181 DALKIVADGVNALKSPDRATVVITHYQRLLDYIVPDSVHVLYKGKIIRSGDKALALELEN 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADIIGE 249


>gi|15889126|ref|NP_354807.1| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium
           tumefaciens str. C58]
 gi|15156934|gb|AAK87592.1| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium
           tumefaciens str. C58]
          Length = 251

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 213/249 (85%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI +L AKI DT+TEII+GLNLKV   EV AIMGPNGSGKSTLSY+LSG +DYE+T+G
Sbjct: 1   MLEIIDLHAKIADTETEIIKGLNLKVAAGEVAAIMGPNGSGKSTLSYILSGREDYEVTSG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDAAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGESELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V++   +L I+M+MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFIRRVKEAAGDLKIDMEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNAL+S DR+ ++ITHYQRLL+YI PD++HVL+ GKII++GD ++AL+LE 
Sbjct: 181 DALKIVADGVNALKSPDRATVVITHYQRLLDYIVPDSVHVLYKGKIIRSGDKALALELEN 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADIIGE 249


>gi|254704236|ref|ZP_05166064.1| FeS assembly ATPase SufC [Brucella suis bv. 3 str. 686]
 gi|261754902|ref|ZP_05998611.1| FeS assembly ATPase SufC [Brucella suis bv. 3 str. 686]
 gi|261744655|gb|EEY32581.1| FeS assembly ATPase SufC [Brucella suis bv. 3 str. 686]
          Length = 251

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 212/249 (85%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+GH DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGHDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|222148790|ref|YP_002549747.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium
           vitis S4]
 gi|221735776|gb|ACM36739.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium
           vitis S4]
          Length = 251

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/249 (72%), Positives = 208/249 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 1   MLEIRNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILSGRSDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  EILYNGESILELDPAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEAELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V++   EL IN DMLKRPLN+GFSGGEKK AEILQM LL P LCILDETDSGLDI
Sbjct: 121 DFIRRVKEAAGELKINPDMLKRPLNVGFSGGEKKRAEILQMALLAPQLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNAL+S DR+ ++ITHYQRLL+YI PDT+HVL+ G+IIKTGD S+ALDLE 
Sbjct: 181 DALKIVADGVNALKSPDRATIVITHYQRLLDYIVPDTVHVLYKGQIIKTGDKSLALDLEA 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADIIGE 249


>gi|153009584|ref|YP_001370799.1| FeS assembly ATPase SufC [Ochrobactrum anthropi ATCC 49188]
 gi|151561472|gb|ABS14970.1| FeS assembly ATPase SufC [Ochrobactrum anthropi ATCC 49188]
          Length = 251

 Score =  374 bits (959), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 213/249 (85%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+    +L I+MDMLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGKLSIDMDMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD ++AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKNLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|239831806|ref|ZP_04680135.1| FeS assembly ATPase SufC [Ochrobactrum intermedium LMG 3301]
 gi|239824073|gb|EEQ95641.1| FeS assembly ATPase SufC [Ochrobactrum intermedium LMG 3301]
          Length = 251

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 212/249 (85%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVVVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|23501816|ref|NP_697943.1| ABC transporter ATP-binding protein [Brucella suis 1330]
 gi|161618888|ref|YP_001592775.1| FeS assembly ATPase SufC [Brucella canis ATCC 23365]
 gi|163843201|ref|YP_001627605.1| FeS assembly ATPase SufC [Brucella suis ATCC 23445]
 gi|254701692|ref|ZP_05163520.1| FeS assembly ATPase SufC [Brucella suis bv. 5 str. 513]
 gi|254706862|ref|ZP_05168690.1| FeS assembly ATPase SufC [Brucella pinnipedialis M163/99/10]
 gi|254710029|ref|ZP_05171840.1| FeS assembly ATPase SufC [Brucella pinnipedialis B2/94]
 gi|256031524|ref|ZP_05445138.1| FeS assembly ATPase SufC [Brucella pinnipedialis M292/94/1]
 gi|256061033|ref|ZP_05451189.1| FeS assembly ATPase SufC [Brucella neotomae 5K33]
 gi|256159659|ref|ZP_05457412.1| FeS assembly ATPase SufC [Brucella ceti M490/95/1]
 gi|256254928|ref|ZP_05460464.1| FeS assembly ATPase SufC [Brucella ceti B1/94]
 gi|256369358|ref|YP_003106866.1| FeS assembly ATPase SufC [Brucella microti CCM 4915]
 gi|260168656|ref|ZP_05755467.1| FeS assembly ATPase SufC [Brucella sp. F5/99]
 gi|260566517|ref|ZP_05836987.1| ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261222110|ref|ZP_05936391.1| FeS assembly ATPase SufC [Brucella ceti B1/94]
 gi|261314328|ref|ZP_05953525.1| FeS assembly ATPase SufC [Brucella pinnipedialis M163/99/10]
 gi|261317576|ref|ZP_05956773.1| Fe-S assembly ATPase SufC [Brucella pinnipedialis B2/94]
 gi|261325032|ref|ZP_05964229.1| FeS assembly ATPase SufC [Brucella neotomae 5K33]
 gi|261752243|ref|ZP_05995952.1| FeS assembly ATPase SufC [Brucella suis bv. 5 str. 513]
 gi|261758130|ref|ZP_06001839.1| ABC transporter [Brucella sp. F5/99]
 gi|265988610|ref|ZP_06101167.1| FeS assembly ATPase SufC [Brucella pinnipedialis M292/94/1]
 gi|265998075|ref|ZP_06110632.1| FeS assembly ATPase SufC [Brucella ceti M490/95/1]
 gi|294852286|ref|ZP_06792959.1| FeS assembly ATPase SufC [Brucella sp. NVSL 07-0026]
 gi|23347750|gb|AAN29858.1| ABC transporter, ATP-binding protein [Brucella suis 1330]
 gi|161335699|gb|ABX62004.1| FeS assembly ATPase SufC [Brucella canis ATCC 23365]
 gi|163673924|gb|ABY38035.1| FeS assembly ATPase SufC [Brucella suis ATCC 23445]
 gi|255999518|gb|ACU47917.1| FeS assembly ATPase SufC [Brucella microti CCM 4915]
 gi|260156035|gb|EEW91115.1| ABC transporter [Brucella suis bv. 4 str. 40]
 gi|260920694|gb|EEX87347.1| FeS assembly ATPase SufC [Brucella ceti B1/94]
 gi|261296799|gb|EEY00296.1| Fe-S assembly ATPase SufC [Brucella pinnipedialis B2/94]
 gi|261301012|gb|EEY04509.1| FeS assembly ATPase SufC [Brucella neotomae 5K33]
 gi|261303354|gb|EEY06851.1| FeS assembly ATPase SufC [Brucella pinnipedialis M163/99/10]
 gi|261738114|gb|EEY26110.1| ABC transporter [Brucella sp. F5/99]
 gi|261741996|gb|EEY29922.1| FeS assembly ATPase SufC [Brucella suis bv. 5 str. 513]
 gi|262552543|gb|EEZ08533.1| FeS assembly ATPase SufC [Brucella ceti M490/95/1]
 gi|264660807|gb|EEZ31068.1| FeS assembly ATPase SufC [Brucella pinnipedialis M292/94/1]
 gi|294820875|gb|EFG37874.1| FeS assembly ATPase SufC [Brucella sp. NVSL 07-0026]
          Length = 251

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|148559564|ref|YP_001258905.1| FeS assembly ATPase SufC [Brucella ovis ATCC 25840]
 gi|225627418|ref|ZP_03785455.1| FeS assembly ATPase SufC [Brucella ceti str. Cudo]
 gi|148370821|gb|ABQ60800.1| FeS assembly ATPase SufC [Brucella ovis ATCC 25840]
 gi|225617423|gb|EEH14468.1| FeS assembly ATPase SufC [Brucella ceti str. Cudo]
          Length = 280

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 30  MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 89

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 90  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELKIP 149

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 150 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 209

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 210 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 269

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 270 NGYADVIGE 278


>gi|62289873|ref|YP_221666.1| ABC transporter ATP-binding protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699800|ref|YP_414374.1| ABC transporter ATPase [Brucella melitensis biovar Abortus 2308]
 gi|189024115|ref|YP_001934883.1| ABC transporter [Brucella abortus S19]
 gi|225852443|ref|YP_002732676.1| FeS assembly ATPase SufC [Brucella melitensis ATCC 23457]
 gi|254689176|ref|ZP_05152430.1| ABC transporter ATP-binding protein [Brucella abortus bv. 6 str.
           870]
 gi|254693659|ref|ZP_05155487.1| ABC transporter ATP-binding protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697312|ref|ZP_05159140.1| ABC transporter ATP-binding protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730210|ref|ZP_05188788.1| ABC transporter ATP-binding protein [Brucella abortus bv. 4 str.
           292]
 gi|256044600|ref|ZP_05447504.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256257426|ref|ZP_05462962.1| ABC transporter ATP-binding protein [Brucella abortus bv. 9 str.
           C68]
 gi|256264063|ref|ZP_05466595.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|260545383|ref|ZP_05821124.1| ABC transporter [Brucella abortus NCTC 8038]
 gi|260563952|ref|ZP_05834438.1| ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260754675|ref|ZP_05867023.1| FeS assembly ATPase SufC [Brucella abortus bv. 6 str. 870]
 gi|260757899|ref|ZP_05870247.1| FeS assembly ATPase SufC [Brucella abortus bv. 4 str. 292]
 gi|260761721|ref|ZP_05874064.1| FeS assembly ATPase SufC [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883701|ref|ZP_05895315.1| FeS assembly ATPase SufC [Brucella abortus bv. 9 str. C68]
 gi|261213926|ref|ZP_05928207.1| FeS assembly ATPase SufC [Brucella abortus bv. 3 str. Tulya]
 gi|265991024|ref|ZP_06103581.1| FeS assembly ATPase SufC [Brucella melitensis bv. 1 str. Rev.1]
 gi|297248275|ref|ZP_06931993.1| FeS assembly ATPase SufC [Brucella abortus bv. 5 str. B3196]
 gi|62196005|gb|AAX74305.1| ABC transporter, ATP-binding protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82615901|emb|CAJ10905.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase
           [Brucella melitensis biovar Abortus 2308]
 gi|189019687|gb|ACD72409.1| ABC transporter [Brucella abortus S19]
 gi|225640808|gb|ACO00722.1| FeS assembly ATPase SufC [Brucella melitensis ATCC 23457]
 gi|260096790|gb|EEW80665.1| ABC transporter [Brucella abortus NCTC 8038]
 gi|260153968|gb|EEW89060.1| ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260668217|gb|EEX55157.1| FeS assembly ATPase SufC [Brucella abortus bv. 4 str. 292]
 gi|260672153|gb|EEX58974.1| FeS assembly ATPase SufC [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674783|gb|EEX61604.1| FeS assembly ATPase SufC [Brucella abortus bv. 6 str. 870]
 gi|260873229|gb|EEX80298.1| FeS assembly ATPase SufC [Brucella abortus bv. 9 str. C68]
 gi|260915533|gb|EEX82394.1| FeS assembly ATPase SufC [Brucella abortus bv. 3 str. Tulya]
 gi|263001808|gb|EEZ14383.1| FeS assembly ATPase SufC [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094258|gb|EEZ18128.1| ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|297175444|gb|EFH34791.1| FeS assembly ATPase SufC [Brucella abortus bv. 5 str. B3196]
 gi|326408957|gb|ADZ66022.1| ABC transporter [Brucella melitensis M28]
 gi|326538671|gb|ADZ86886.1| FeS assembly ATPase SufC [Brucella melitensis M5-90]
          Length = 251

 Score =  371 bits (952), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELNIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|17987324|ref|NP_539958.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           16M]
 gi|237815367|ref|ZP_04594365.1| FeS assembly ATPase SufC [Brucella abortus str. 2308 A]
 gi|17983005|gb|AAL52222.1| abc transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           16M]
 gi|237790204|gb|EEP64414.1| FeS assembly ATPase SufC [Brucella abortus str. 2308 A]
          Length = 280

 Score =  371 bits (952), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 30  MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 89

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 90  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELNIP 149

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 150 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 209

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 210 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 269

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 270 NGYADVIGE 278


>gi|190891950|ref|YP_001978492.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Rhizobium etli CIAT 652]
 gi|190697229|gb|ACE91314.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Rhizobium etli CIAT 652]
          Length = 251

 Score =  370 bits (951), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 208/247 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG +DYE+T G
Sbjct: 1   MLEIRNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+   A+L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMRRVKDAAAKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|256113480|ref|ZP_05454314.1| FeS assembly ATPase SufC [Brucella melitensis bv. 3 str. Ether]
 gi|265994861|ref|ZP_06107418.1| FeS assembly ATPase SufC [Brucella melitensis bv. 3 str. Ether]
 gi|262765974|gb|EEZ11763.1| FeS assembly ATPase SufC [Brucella melitensis bv. 3 str. Ether]
          Length = 251

 Score =  370 bits (951), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 210/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELNIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMELLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|86357866|ref|YP_469758.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Rhizobium etli CFN 42]
 gi|86281968|gb|ABC91031.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Rhizobium etli CFN 42]
          Length = 251

 Score =  370 bits (951), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 208/247 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG +DYE+T G
Sbjct: 1   MLEIRNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+   A+L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMRRVKDAAAKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|222086102|ref|YP_002544634.1| FeS assembly ATPase SufC [Agrobacterium radiobacter K84]
 gi|221723550|gb|ACM26706.1| FeS assembly ATPase SufC [Agrobacterium radiobacter K84]
          Length = 251

 Score =  370 bits (951), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/247 (70%), Positives = 208/247 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  EILYNGESILELDAAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEAELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V++  A+L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMRRVKEAAAKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPQLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVIVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|163868341|ref|YP_001609550.1| ABC transporter ATP-binding protein [Bartonella tribocorum CIP
           105476]
 gi|161017997|emb|CAK01555.1| ABC transporter ATP-binding protein [Bartonella tribocorum CIP
           105476]
          Length = 251

 Score =  370 bits (950), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 212/249 (85%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNLRA+I  TDTE+IRGLNL V+  EV AIMG NG+GKSTLSYLL+G  DYEIT G
Sbjct: 1   MLEIKNLRARIAGTDTEVIRGLNLTVQDGEVAAIMGQNGAGKSTLSYLLAGRDDYEITEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+S+L+    ERA+ GIFLAFQYP+EIPG+  M+FLK+A+N QRKAR ++EL IP
Sbjct: 61  DILYNGQSLLEMDPAERAAYGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGDEELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++++A+L I+MDMLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 EFIKHVKEVSAKLEIDMDMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LR   RSFL+ITHYQRLLNYI PDT+HVL+ G+IIK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNKLRDSKRSFLVITHYQRLLNYIIPDTVHVLYKGRIIKSGDKSLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGYA+LI+E
Sbjct: 241 NGYADLIRE 249


>gi|254714031|ref|ZP_05175842.1| FeS assembly ATPase SufC [Brucella ceti M644/93/1]
 gi|254716911|ref|ZP_05178722.1| FeS assembly ATPase SufC [Brucella ceti M13/05/1]
 gi|261218718|ref|ZP_05932999.1| Fe-S assembly ATPase SufC [Brucella ceti M13/05/1]
 gi|261321784|ref|ZP_05960981.1| Fe-S assembly ATPase SufC [Brucella ceti M644/93/1]
 gi|260923807|gb|EEX90375.1| Fe-S assembly ATPase SufC [Brucella ceti M13/05/1]
 gi|261294474|gb|EEX97970.1| Fe-S assembly ATPase SufC [Brucella ceti M644/93/1]
          Length = 251

 Score =  370 bits (950), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL +   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTMNKGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|327191056|gb|EGE58109.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Rhizobium etli CNPAF512]
          Length = 251

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/247 (70%), Positives = 208/247 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG +DYE+T G
Sbjct: 1   MLEIRNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KG+FLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDPAERAAKGVFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+   A+L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMRRVKDAAAKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|241204825|ref|YP_002975921.1| FeS assembly ATPase SufC [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858715|gb|ACS56382.1| FeS assembly ATPase SufC [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 251

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 207/247 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGRSDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+    +L IN +MLKRPLN+GFSGGEKK AEILQM LLEP+LC+LDETDSGLDI
Sbjct: 121 DFMRRVKDAAGKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPNLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|254719030|ref|ZP_05180841.1| FeS assembly ATPase SufC [Brucella sp. 83/13]
 gi|265984020|ref|ZP_06096755.1| Fe-S assembly ATPase SufC [Brucella sp. 83/13]
 gi|306840082|ref|ZP_07472868.1| FeS assembly ATPase SufC [Brucella sp. NF 2653]
 gi|264662612|gb|EEZ32873.1| Fe-S assembly ATPase SufC [Brucella sp. 83/13]
 gi|306404810|gb|EFM61103.1| FeS assembly ATPase SufC [Brucella sp. NF 2653]
          Length = 251

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G  +YE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNKGEVAAIMGPNGSGKSTLSYILAGRDNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QRKAR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGEPELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|116252326|ref|YP_768164.1| ATP-binding component of ABC transporter [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115256974|emb|CAK08068.1| putative ATP-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 251

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 206/247 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGRSDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+    +L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMRRVKDAAGKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|218671672|ref|ZP_03521341.1| FeS assembly ATPase SufC [Rhizobium etli GR56]
          Length = 251

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/247 (70%), Positives = 207/247 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 1   MLEIRNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGRSDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KG+FLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  DILYNGESILELDPSERAAKGVFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+   A+L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMRRVKDAAAKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|306840445|ref|ZP_07473205.1| FeS assembly ATPase SufC [Brucella sp. BO2]
 gi|306843827|ref|ZP_07476425.1| FeS assembly ATPase SufC [Brucella sp. BO1]
 gi|306275905|gb|EFM57621.1| FeS assembly ATPase SufC [Brucella sp. BO1]
 gi|306289579|gb|EFM60794.1| FeS assembly ATPase SufC [Brucella sp. BO2]
          Length = 251

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 210/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI DTDTEIIRGLNL V   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHAKIADTDTEIIRGLNLTVNRGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYP+EIPG+  M+FLK+A+N QR AR E EL IP
Sbjct: 61  DILYNGESILELDPAERAAKGIFLAFQYPMEIPGVATMEFLKVAMNSQRTARGEPELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+     L I+M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 EFIKRVKDAAGGLNIDMNMLKRPLNVGFSGGEKKRAEILQMQLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS DR+ ++ITHYQRLL +I PD++HVL+ G++IK+GD S+AL LEE
Sbjct: 181 DALKIVSEGVNALRSPDRAVIVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALHLEE 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADVIGE 249


>gi|150396680|ref|YP_001327147.1| FeS assembly ATPase SufC [Sinorhizobium medicae WSM419]
 gi|150028195|gb|ABR60312.1| FeS assembly ATPase SufC [Sinorhizobium medicae WSM419]
          Length = 251

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/248 (70%), Positives = 208/248 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG +DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILSGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRK R E EL  P
Sbjct: 61  DILYNGESILELDASERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKYRGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R+V++  AEL I  +ML+RPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 EFMRRVKEAAAELKIAPEMLRRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLLNYI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLNYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELIK 248
           NGYAE+I+
Sbjct: 241 NGYAEIIE 248


>gi|209549492|ref|YP_002281409.1| FeS assembly ATPase SufC [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535248|gb|ACI55183.1| FeS assembly ATPase SufC [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 262

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 206/247 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 12  MLEIRNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGRSDYEVTEG 71

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KG+FLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 72  DILYNGESILELDPAERAAKGVFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTP 131

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+    +L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 132 DFMRRVKDAAGKLQINTEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 191

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 192 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEA 251

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 252 NGYADII 258


>gi|240850614|ref|YP_002972014.1| FeS assembly ATPase SufC [Bartonella grahamii as4aup]
 gi|240267737|gb|ACS51325.1| FeS assembly ATPase SufC [Bartonella grahamii as4aup]
          Length = 251

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I  TDTE+IRGLNL V+  EV AIMG NG+GKSTLSYLL+G  DYEIT G
Sbjct: 1   MLEIKNLHARIAGTDTEVIRGLNLTVQDGEVAAIMGQNGAGKSTLSYLLAGRDDYEITEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+S+L+    ERA+ G+FLAFQYP+EIPG+  M+FLK+A+N QRKAR +KEL IP
Sbjct: 61  DILYNGKSLLEMDPAERATYGVFLAFQYPMEIPGVATMEFLKVAMNSQRKARGDKELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++++A+L I+MDMLKRPLN+GFSGGEKK AEILQM LLEP LCILDETDSGLDI
Sbjct: 121 EFIKCVKEVSAKLEIDMDMLKRPLNVGFSGGEKKRAEILQMALLEPRLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LR   RSFL+ITHYQRLLNYI PDT+HVL+ G+IIK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNKLRDSKRSFLVITHYQRLLNYIIPDTVHVLYKGQIIKSGDKSLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGYA+LI+E
Sbjct: 241 NGYADLIRE 249


>gi|15965487|ref|NP_385840.1| putative ABC transporter ATP-binding protein [Sinorhizobium
           meliloti 1021]
 gi|307302608|ref|ZP_07582364.1| FeS assembly ATPase SufC [Sinorhizobium meliloti BL225C]
 gi|307318455|ref|ZP_07597889.1| FeS assembly ATPase SufC [Sinorhizobium meliloti AK83]
 gi|15074668|emb|CAC46313.1| Putative ABC transporter ATP-binding protein [Sinorhizobium
           meliloti 1021]
 gi|306895795|gb|EFN26547.1| FeS assembly ATPase SufC [Sinorhizobium meliloti AK83]
 gi|306902972|gb|EFN33563.1| FeS assembly ATPase SufC [Sinorhizobium meliloti BL225C]
          Length = 251

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/248 (70%), Positives = 209/248 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG +DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILSGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRK R E+EL  P
Sbjct: 61  DILYNGESILELDASERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKYRGEEELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R+V++  AEL I  +ML+RPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 EFMRRVKEAAAELKIAPEMLRRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLLNYI PDT+HVL+ G++IK+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLNYIVPDTVHVLYKGQVIKSGDKTLAHELEA 240

Query: 241 NGYAELIK 248
           NGYA++I+
Sbjct: 241 NGYADIIE 248


>gi|319784072|ref|YP_004143548.1| FeS assembly ATPase SufC [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169960|gb|ADV13498.1| FeS assembly ATPase SufC [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 251

 Score =  367 bits (941), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 210/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+IVD  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIRNLHARIVDDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL+    ERA+ GIFLAFQYP+EIPG+  M+FLK+A+NEQRKAR E+ L IP
Sbjct: 61  DILYNGQSILEMDPAERATSGIFLAFQYPMEIPGVATMEFLKVAMNEQRKARGEEPLKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V++  A L + M MLKRPLN+GFSGGEKK AEILQM+LLEP LC+LDETDSGLDI
Sbjct: 121 EFLKRVKEAAASLSMEMAMLKRPLNVGFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNALR+ DR+FL+ITHYQRLL +I PDT+HVL+ G++IK+GD S+ALDLE 
Sbjct: 181 DALKIVSDGVNALRAPDRAFLVITHYQRLLEHIVPDTVHVLYKGQVIKSGDKSLALDLEA 240

Query: 241 NGYAELIKE 249
           NGYA +I E
Sbjct: 241 NGYAGVIGE 249


>gi|13470344|ref|NP_101910.1| ABC transporter ATP-binding protein [Mesorhizobium loti MAFF303099]
 gi|14021083|dbj|BAB47696.1| ABC transporter ATP-binding protein [Mesorhizobium loti MAFF303099]
          Length = 251

 Score =  365 bits (937), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+IVD  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIRNLHARIVDDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL+    ERA+ GIFLAFQYP+EIPG+  M+FLK+A+NEQRKAR E+ L IP
Sbjct: 61  DILYNGQSILEMDPAERATSGIFLAFQYPMEIPGVATMEFLKVAMNEQRKARGEEPLKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V++  A L ++M MLKRPLN+GFSGGEKK AEILQM+LLEP LC+LDETDSGLDI
Sbjct: 121 EFLKRVKEAAASLNMDMAMLKRPLNVGFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNALR+ DR+FL+ITHYQRLL +I PD++HVL+ G++IK+GD S+ALDLE 
Sbjct: 181 DALKIVSDGVNALRAPDRAFLVITHYQRLLEHIVPDSVHVLYRGQVIKSGDKSLALDLEA 240

Query: 241 NGYAELIKE 249
           NGYA +I E
Sbjct: 241 NGYAGVIGE 249


>gi|260460857|ref|ZP_05809107.1| FeS assembly ATPase SufC [Mesorhizobium opportunistum WSM2075]
 gi|259033434|gb|EEW34695.1| FeS assembly ATPase SufC [Mesorhizobium opportunistum WSM2075]
          Length = 251

 Score =  365 bits (936), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 171/249 (68%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+IVD  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIRNLHARIVDDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL+    ERA+ GIFLAFQYP+EIPG+  M+FLK+A+NEQRKAR E+ L IP
Sbjct: 61  DILYNGQSILEMDPAERATSGIFLAFQYPMEIPGVATMEFLKVAMNEQRKARGEEPLKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V++  A L ++M MLKRPLN+GFSGGEKK AEILQM+LLEP LC+LDETDSGLDI
Sbjct: 121 EFLKRVKEAAASLSMDMAMLKRPLNVGFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNALR+ DR+FL+ITHYQRLL +I PD++HVL+ G++IK+GD S+ALDLE 
Sbjct: 181 DALKIVSDGVNALRAPDRAFLVITHYQRLLEHIVPDSVHVLYKGQVIKSGDKSLALDLEA 240

Query: 241 NGYAELIKE 249
           NGYA +I +
Sbjct: 241 NGYAGVIGQ 249


>gi|90417691|ref|ZP_01225603.1| ABC transporter, ATP-binding protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337363|gb|EAS51014.1| ABC transporter, ATP-binding protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 251

 Score =  364 bits (934), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 203/249 (81%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A++ D +TEI+RG+NL V+  EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHARVADDETEILRGVNLTVQDGEVAAIMGPNGSGKSTLSYILAGRTDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+ G+FLAFQYP+EIPG+  M FLK ALN QRKAR E EL  P
Sbjct: 61  DILYNGESILEMDPAERAASGVFLAFQYPLEIPGVATMTFLKTALNSQRKARGEGELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V+   A+L I+  MLKRPLN+GFSGGEKK AEILQM LLEP LC++DETDSGLDI
Sbjct: 121 DFMRRVKAAAADLKIDAAMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVMDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS +RSFL+ITHYQRLL+YI PDT+HVL+ G+IIKTGD ++AL LE 
Sbjct: 181 DALKIVADGVNALRSPERSFLVITHYQRLLDYIVPDTVHVLYKGRIIKTGDKNLALQLEN 240

Query: 241 NGYAELIKE 249
            GY +LI E
Sbjct: 241 EGYGQLIDE 249


>gi|49475626|ref|YP_033667.1| ATP-dependent transporter [Bartonella henselae str. Houston-1]
 gi|49238433|emb|CAF27661.1| ATP-dependent transporter [Bartonella henselae str. Houston-1]
          Length = 251

 Score =  363 bits (932), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 210/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK LRA+IV T+TE+IRGLNL V   EV AIMG NG+GKSTLSYLL+G  DYE+  G
Sbjct: 1   MLEIKGLRARIVGTNTEVIRGLNLTVADGEVAAIMGQNGAGKSTLSYLLAGRDDYEVIDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+S+L+    ERA+ G+FLAFQYP+EIPG+  M+FLK+A+N QRKAR ++EL IP
Sbjct: 61  DILYNGQSLLEMDPAERAAYGVFLAFQYPMEIPGVATMEFLKVAMNSQRKARGDQELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++I+++L INMDMLKRPLN+GFSGGEKK AEILQM LLEP LCILDETDSGLDI
Sbjct: 121 EFIKCVKEISSKLEINMDMLKRPLNVGFSGGEKKRAEILQMALLEPKLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LR   RSFL+ITHYQRLLNYI PDT+HVL+ G+IIK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNKLRDPKRSFLVITHYQRLLNYIIPDTVHVLYKGRIIKSGDKSLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGYA+LI+E
Sbjct: 241 NGYADLIRE 249


>gi|319405706|emb|CBI79329.1| ABC transporter ATP-binding protein [Bartonella sp. AR 15-3]
          Length = 251

 Score =  362 bits (930), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 209/249 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +T+TEII GLNL +   EV AIMG NG+GKSTLSYLLSG  DYE+T G
Sbjct: 1   MLEIKNLHARISETNTEIICGLNLTIRDGEVAAIMGQNGAGKSTLSYLLSGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL  S  ERA +GIFLAFQYP+EIPG+  M+FLK+A+N QRKAR +KEL I 
Sbjct: 61  DILYNGQSILKMSPTERAVRGIFLAFQYPMEIPGVATMEFLKVAMNSQRKARGDKELKIS 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++++ I++EL I+M MLKR LN+GFSGGEKK AEILQM LLEP LCILDETDSGLDI
Sbjct: 121 EFIQRIKDISSELEIDMAMLKRSLNVGFSGGEKKRAEILQMALLEPKLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LRSQ+RSFL+ITHYQRLL+YI PDT+HVLH G+IIK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNKLRSQERSFLVITHYQRLLDYITPDTVHVLHKGRIIKSGDKSLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGYA++I +
Sbjct: 241 NGYADIINK 249


>gi|227822092|ref|YP_002826063.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Sinorhizobium fredii NGR234]
 gi|227341092|gb|ACP25310.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Sinorhizobium fredii NGR234]
          Length = 251

 Score =  362 bits (929), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 207/248 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEIIRGL+L V+  EV AIMGPNGSGKSTLSY+LSG +DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEIIRGLDLTVKAGEVAAIMGPNGSGKSTLSYILSGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRK R E EL  P
Sbjct: 61  DILYNGESILELDASERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKYRGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V++  AEL I  +ML+RPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMRRVKEAAAELKIAPEMLRRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS DR+ ++ITHYQRLL+YI PDT+HVL+ G+++K+GD ++A +LE 
Sbjct: 181 DALKIVADGVNALRSPDRAVVVITHYQRLLDYIVPDTVHVLYKGQVVKSGDKTLAHELEA 240

Query: 241 NGYAELIK 248
            GYA++I+
Sbjct: 241 KGYADIIE 248


>gi|121602478|ref|YP_989101.1| FeS assembly ATPase SufC [Bartonella bacilliformis KC583]
 gi|120614655|gb|ABM45256.1| FeS assembly ATPase SufC [Bartonella bacilliformis KC583]
          Length = 251

 Score =  362 bits (929), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +T+TEII  LNL V+  EV AIMG NG+GKSTLSYLL+GH DY+IT G
Sbjct: 1   MLEIKNLHARIAETNTEIICDLNLTVQDGEVAAIMGQNGAGKSTLSYLLAGHDDYKITKG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL+    ERA+ GIFLAFQYP+EIPGI  M+FLK+A+N QRKARN++EL IP
Sbjct: 61  DILYNGQSILEMDPAERAAFGIFLAFQYPMEIPGIATMEFLKVAMNSQRKARNDEELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++V++I ++L I+M MLKRPLN+GFSGGEKK AEILQM LLEP+LCILDETDSGLDI
Sbjct: 121 QFIKRVKEIASKLEIDMGMLKRPLNVGFSGGEKKRAEILQMALLEPTLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LRS  RSFLIITHYQRLL+YI PDT+H+LH G+IIK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNRLRSLKRSFLIITHYQRLLDYIVPDTVHILHKGRIIKSGDKSLALYLEK 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADIIGE 249


>gi|163759514|ref|ZP_02166599.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Hoeflea phototrophica DFL-43]
 gi|162283111|gb|EDQ33397.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Hoeflea phototrophica DFL-43]
          Length = 251

 Score =  362 bits (928), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 173/248 (69%), Positives = 206/248 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR ++EL  P
Sbjct: 61  DILYNGESILELDPSERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGQEELKTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + V++  A L IN DMLKRPLN+GFSGGEKK AEILQM+LL P LC+LDETDSGLDI
Sbjct: 121 DFIKLVKEAAASLQINPDMLKRPLNVGFSGGEKKRAEILQMKLLAPQLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNALRS DR+ ++ITHYQRLL +I PDT+HVL+ G++IK+G   +ALDLE 
Sbjct: 181 DALKIVSDGVNALRSPDRAVIVITHYQRLLEHIVPDTVHVLYKGQVIKSGTKDLALDLEA 240

Query: 241 NGYAELIK 248
           NGYA++I+
Sbjct: 241 NGYADIIE 248


>gi|49474208|ref|YP_032250.1| ATP-dependent transporter [Bartonella quintana str. Toulouse]
 gi|49239712|emb|CAF26088.1| ATP-dependent transporter [Bartonella quintana str. Toulouse]
          Length = 251

 Score =  360 bits (923), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 171/249 (68%), Positives = 210/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNLRA+IV TDTE+IRGLNL V+  EV AIMG NG+GKSTLSYLL+G  DYE+  G
Sbjct: 1   MLEIKNLRARIVGTDTEVIRGLNLTVQDGEVAAIMGQNGAGKSTLSYLLAGRDDYEVIEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+S+L+    ERA  G+FLAFQYP+EIPG+ MM+FLK+A+N QRKAR ++EL IP
Sbjct: 61  DILYNGKSLLEIDPAERAVYGVFLAFQYPMEIPGVSMMEFLKVAMNSQRKARGDEELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++ +++L I+M+MLKRPLN+GFSGGEKK AEILQM LLEP LCILDETDSGLD+
Sbjct: 121 EFIKCVKETSSKLKIDMNMLKRPLNVGFSGGEKKRAEILQMALLEPKLCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LR   RSFL+ITHYQRLLNYI PDT+HVL+ G++IK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNKLRDSKRSFLVITHYQRLLNYIIPDTVHVLYKGRVIKSGDKSLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGY+++I E
Sbjct: 241 NGYSDIINE 249


>gi|110634131|ref|YP_674339.1| FeS assembly ATPase SufC [Mesorhizobium sp. BNC1]
 gi|110285115|gb|ABG63174.1| FeS assembly ATPase SufC [Chelativorans sp. BNC1]
          Length = 251

 Score =  360 bits (923), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +  TEI+RG+NL V+P EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHARIAEDGTEILRGVNLAVKPGEVAAIMGPNGSGKSTLSYVLAGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+KG+SIL+    ERA+ GIFLAFQYP+EIPG+  M+FLK+A+N QR+AR E+EL IP
Sbjct: 61  DILFKGQSILEMDPAERAATGIFLAFQYPMEIPGVATMEFLKVAMNAQRRARGEEELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  ++VR    EL ++M+MLKRPLN+GFSGGEKK AEILQM+LLEPSLC+LDETDSGLDI
Sbjct: 121 ELLKRVRTAAQELDMDMNMLKRPLNVGFSGGEKKRAEILQMKLLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALRS DR+ ++ITHYQRLL+YI PD++HVL+ G+++K+G+  +A +LE+
Sbjct: 181 DALKIVAEGVNALRSPDRTIVVITHYQRLLDYIVPDSVHVLYKGQVVKSGEKELAQELEK 240

Query: 241 NGYAELIKE 249
           NGYA LI E
Sbjct: 241 NGYAGLIGE 249


>gi|319408611|emb|CBI82266.1| ABC transporter ATP-binding protein [Bartonella schoenbuchensis R1]
          Length = 251

 Score =  359 bits (922), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/249 (68%), Positives = 211/249 (84%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+IV  +TEIIRGLNL V+  EV AIMG NG+GKSTLSY+L+GH DYE+T G
Sbjct: 1   MLEIKNLHARIVGANTEIIRGLNLTVQNGEVAAIMGQNGAGKSTLSYVLAGHNDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL+    ERA  GIFLAFQYP+EIPG+  M+FLK+A+N QRKAR  +EL IP
Sbjct: 61  DILYNGQSILEMDPAERAVYGIFLAFQYPMEIPGVATMEFLKVAINSQRKARGNEELKIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +++++I ++L I+M MLKRPLN+GFSGGEKK AEILQM LLEP+LCILDETDSGLDI
Sbjct: 121 EFIKRIKEIASKLEIDMAMLKRPLNVGFSGGEKKRAEILQMALLEPTLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LR+ +RSFL+ITHYQRLL+YI PDT+HVL+ G+IIK+GD ++AL LE+
Sbjct: 181 DALKIVANGVNKLRNLERSFLVITHYQRLLDYIVPDTVHVLYQGRIIKSGDKTLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGYA++I +
Sbjct: 241 NGYADIISK 249


>gi|114704649|ref|ZP_01437557.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Fulvimarina pelagi HTCC2506]
 gi|114539434|gb|EAU42554.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Fulvimarina pelagi HTCC2506]
          Length = 251

 Score =  358 bits (918), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 169/249 (67%), Positives = 204/249 (81%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A++ D  TEI+RG++L V   E+ AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIKNLHARVADEGTEILRGVDLTVNDGEIAAIMGPNGSGKSTLSYILAGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY GESIL+    ERA+ G+FLAFQYP+EIPG+  M FLK ALN QRKAR+E EL  P
Sbjct: 61  DILYNGESILEMEPDERAASGLFLAFQYPLEIPGVATMTFLKTALNAQRKARDEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R+V+    +L IN +MLKRPLN+GFSGGEKK AEILQM LLEP LC++DETDSGLDI
Sbjct: 121 EFMRRVKAAAGDLKINPEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVMDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS +RSFL+ITHYQRLL+YI PDT+HVL NG+I+KTGD  +AL LE 
Sbjct: 181 DALKIVADGVNALRSPERSFLVITHYQRLLDYIVPDTVHVLSNGRIVKTGDKDLALQLER 240

Query: 241 NGYAELIKE 249
            GY+++I+E
Sbjct: 241 EGYSQIIEE 249


>gi|218679122|ref|ZP_03527019.1| ABC transporter involved in Fe-S cluster assembly, ATP-binding
           protein [Rhizobium etli CIAT 894]
          Length = 240

 Score =  356 bits (913), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 198/232 (85%)

Query: 16  TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIV 75
           TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG +DYE+T GDILY GESIL+    
Sbjct: 5   TEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYVLSGREDYEVTEGDILYNGESILELDPA 64

Query: 76  ERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGI 135
           ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  PDF R+V++  A+L I
Sbjct: 65  ERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEDELTTPDFMRRVKEAAAKLQI 124

Query: 136 NMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRS 195
           N +MLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDIDALKI A GVNALRS
Sbjct: 125 NTEMLKRPLNVGFSGGEKKRAEILQMALLEPKLCVLDETDSGLDIDALKIVADGVNALRS 184

Query: 196 QDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELI 247
            DR+ ++ITHYQRLL+YI PDT+HVL+ G++IK+GD ++A +LE NGYA++I
Sbjct: 185 PDRAVVVITHYQRLLDYIVPDTVHVLYKGQVIKSGDKTLAHELEANGYADII 236


>gi|319404265|emb|CBI77858.1| ABC transporter ATP-binding protein [Bartonella rochalimae ATCC
           BAA-1498]
 gi|319407271|emb|CBI80910.1| ABC transporter ATP-binding protein [Bartonella sp. 1-1C]
          Length = 251

 Score =  355 bits (912), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 206/249 (82%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I +T+TEII GLNL ++  EV AIMG NG+GKSTLSYLLSG  DYE+T G
Sbjct: 1   MLEIKNLHARISETNTEIICGLNLTIQDGEVAAIMGQNGAGKSTLSYLLSGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL  S  ERA  GIFLAFQYP+EIPG+  M+FLK+A+N QRKAR +KEL I 
Sbjct: 61  DILYNGQSILGMSPTERAVSGIFLAFQYPMEIPGVATMEFLKVAINSQRKARGDKELKIS 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V+K  +EL I+M MLKR LN+GFSGGEKK  EILQM LLEP LCILDETDSGLDI
Sbjct: 121 EFIQYVKKTASELEIDMAMLKRSLNVGFSGGEKKRTEILQMALLEPKLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LR+Q+RSFL+ITHYQRLL+YI PDT+HVL+ G+IIK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNKLRNQERSFLVITHYQRLLDYITPDTVHVLYKGRIIKSGDKSLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGYA++I +
Sbjct: 241 NGYADIISK 249


>gi|319898938|ref|YP_004159031.1| ABC transporter ATP-binding protein [Bartonella clarridgeiae 73]
 gi|319402902|emb|CBI76453.1| ABC transporter ATP-binding protein [Bartonella clarridgeiae 73]
          Length = 251

 Score =  351 bits (901), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 207/249 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A+I  T+TE+I GLNL ++  EV AIMG NG+GKSTLSYLLSG  DYE+T G
Sbjct: 1   MLEIKSLHARIAGTNTEVISGLNLTIQDGEVAAIMGQNGAGKSTLSYLLSGRDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILY G+SIL+ S  ERA  GIFLAFQYP+EIPG+  M+FLK+A+N QRKAR +KEL I 
Sbjct: 61  DILYNGQSILEMSPTERAVYGIFLAFQYPMEIPGVATMEFLKVAINSQRKARGDKELKIS 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++I ++L I+M MLKR LN+GFSGGEKK  EILQM LLEP LCILDETDSGLDI
Sbjct: 121 EFIQYVKEIASDLEIDMAMLKRSLNVGFSGGEKKRTEILQMILLEPKLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LR+Q+RSFL+ITHYQRLL+YI PDT+HVL+ G+IIK+GD S+AL LE+
Sbjct: 181 DALKIVADGVNKLRNQERSFLVITHYQRLLDYITPDTVHVLYKGRIIKSGDKSLALYLEQ 240

Query: 241 NGYAELIKE 249
           NGYA++I +
Sbjct: 241 NGYADIISK 249


>gi|254502809|ref|ZP_05114960.1| FeS assembly ATPase SufC [Labrenzia alexandrii DFL-11]
 gi|222438880|gb|EEE45559.1| FeS assembly ATPase SufC [Labrenzia alexandrii DFL-11]
          Length = 251

 Score =  347 bits (889), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 204/247 (82%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I + +TEI+RG++L V   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHARIAEDETEILRGIDLTVNAGEVHAIMGPNGSGKSTLSYILAGKDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE++LD    ERA+ G+FLAFQYP+EIPG+  M+FLK A+N QRKAR E  L IP
Sbjct: 61  EILFNGENMLDMEPDERAAAGMFLAFQYPIEIPGVATMEFLKTAMNAQRKARGEDTLSIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++V++  A L ++MDMLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMKRVKEAAAHLNVSMDMLKRPLNVGFSGGEKKRAEILQMSLLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVN LR  DR+ ++ITHYQRLL++I PD +HVL  GKI+KTGD ++AL+LE+
Sbjct: 181 DALRIVSEGVNKLRGPDRAMVVITHYQRLLDHIVPDVVHVLSKGKIVKTGDKNLALELEK 240

Query: 241 NGYAELI 247
           NGYA++I
Sbjct: 241 NGYADII 247


>gi|307946849|ref|ZP_07662184.1| FeS assembly ATPase SufC [Roseibium sp. TrichSKD4]
 gi|307770513|gb|EFO29739.1| FeS assembly ATPase SufC [Roseibium sp. TrichSKD4]
          Length = 250

 Score =  344 bits (882), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 158/247 (63%), Positives = 203/247 (82%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I + +TEI+RG++L ++  EV AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIKNLHARIAEDETEILRGIDLTIKAGEVHAIMGPNGSGKSTLSYILAGKEDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE++LD    ERA+ G+FLAFQYP+EIPG+  M+FLK A+N QRKAR E  L IP
Sbjct: 61  EILFNGENMLDMEPDERAAAGMFLAFQYPIEIPGVATMEFLKTAMNAQRKARGEDALTIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++V++  A L ++MDMLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMKRVKEQAAHLNVSMDMLKRPLNVGFSGGEKKRAEILQMSLLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ + GVN LR  DR+ ++ITHYQRLL++I PD +HVL  GKI+KTGD  +AL+LE+
Sbjct: 181 DALRVVSDGVNKLRGPDRAMVVITHYQRLLDHIVPDVVHVLSKGKIVKTGDKDLALELEK 240

Query: 241 NGYAELI 247
           NGYA+ +
Sbjct: 241 NGYADFV 247


>gi|328543980|ref|YP_004304089.1| ABC transporter nucleotide binding/ATPase protein [polymorphum
           gilvum SL003B-26A1]
 gi|326413724|gb|ADZ70787.1| ABC transporter nucleotide binding/ATPase protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 252

 Score =  342 bits (876), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 161/249 (64%), Positives = 203/249 (81%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I D   EI+RG++L V+P EV AIMGPNGSGKSTLSY+L+G +DYE+T G
Sbjct: 1   MLEIKNLHARIADDGAEILRGIDLVVKPGEVHAIMGPNGSGKSTLSYVLAGKEDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE++LD    ERA+ G+FLAFQYP+EIPG+  M+FLK ALN QRKAR E EL IP
Sbjct: 61  EILFNGENLLDMEPDERAAAGVFLAFQYPIEIPGVATMEFLKTALNAQRKARGEPELTIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + V++  A+L + MDMLKRPLN+GFSGGEKK +EILQM LLEPSLC+LDETDSGLDI
Sbjct: 121 AFLKLVKEKAADLNVTMDMLKRPLNVGFSGGEKKRSEILQMALLEPSLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVN LRS DR+ ++ITHYQRLL++I PD +HVL  G+I++TG   +AL+LE+
Sbjct: 181 DALRIVSDGVNKLRSPDRAMIVITHYQRLLDHIVPDVVHVLSKGRIVRTGGPDLALELEK 240

Query: 241 NGYAELIKE 249
           NGYA+ + E
Sbjct: 241 NGYADYVGE 249


>gi|118589098|ref|ZP_01546505.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase
           [Stappia aggregata IAM 12614]
 gi|118438427|gb|EAV45061.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase
           [Stappia aggregata IAM 12614]
          Length = 251

 Score =  339 bits (870), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 157/247 (63%), Positives = 201/247 (81%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I + +TEI+RG++L +   EV AIMGPNGSGKSTLSY+L+G  DYE+T G
Sbjct: 1   MLEIKNLHARIAEDETEILRGIDLTINAGEVHAIMGPNGSGKSTLSYILAGKDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE++L+    ERA+ G+FLAFQYP+EIPG+  M+FLK A+N QRKAR E  L IP
Sbjct: 61  EILFNGENLLEMEPDERAAAGLFLAFQYPIEIPGVATMEFLKTAMNAQRKARGEDTLSIP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++V++    L ++MDMLKRPLN+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFMKRVKEAAGHLNVSMDMLKRPLNVGFSGGEKKRAEILQMSLLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVN LR  DR+ ++ITHYQRLL++I PD +HVL  G+I+KTGD  +AL+LE+
Sbjct: 181 DALRIVSEGVNKLRGPDRAMVVITHYQRLLDHIVPDVVHVLSKGRIVKTGDKDLALELEK 240

Query: 241 NGYAELI 247
           NGYA+ I
Sbjct: 241 NGYADYI 247


>gi|304391538|ref|ZP_07373480.1| FeS assembly ATPase SufC [Ahrensia sp. R2A130]
 gi|303295767|gb|EFL90125.1| FeS assembly ATPase SufC [Ahrensia sp. R2A130]
          Length = 251

 Score =  331 bits (849), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 155/247 (62%), Positives = 195/247 (78%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  +I + +TEI+RGLNL V+  EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 1   MLEIKNLHVRIAEDETEILRGLNLSVKAGEVAAIMGPNGSGKSTLSYVLSGKDDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I Y GE +L+  + ERA+ G+FLAFQYPVEIPG+  + FLK A+N QRK R E EL  P
Sbjct: 61  SITYMGEDLLEMDVAERAAAGVFLAFQYPVEIPGVPTLTFLKEAMNAQRKQRGEDELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR    +L I+ +MLKRP+N+GFSGGEKK AEILQM LLEP LC+LDETDSGLDI
Sbjct: 121 DFIKRVRGAAKDLEIDFNMLKRPVNVGFSGGEKKRAEILQMGLLEPKLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVN LR  +R+ ++ITHYQRLL++I PD++HVL  G+I+K+GD  +AL+LE 
Sbjct: 181 DALKVVSDGVNHLRDPNRAVIVITHYQRLLDHIVPDSVHVLSKGRIVKSGDKDLALELEA 240

Query: 241 NGYAELI 247
            GYA++I
Sbjct: 241 KGYADII 247


>gi|298291335|ref|YP_003693274.1| FeS assembly ATPase SufC [Starkeya novella DSM 506]
 gi|296927846|gb|ADH88655.1| FeS assembly ATPase SufC [Starkeya novella DSM 506]
          Length = 254

 Score =  331 bits (848), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 159/246 (64%), Positives = 195/246 (79%), Gaps = 1/246 (0%)

Query: 1   MLEIKNLRAKI-VDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA 59
           MLEI NL AKI  D   EI++GL+LKV P EV AIMGPNGSGKSTLSY+L+G +DYE+T 
Sbjct: 3   MLEIDNLHAKIDGDEGQEILKGLSLKVNPGEVHAIMGPNGSGKSTLSYILAGKEDYEVTD 62

Query: 60  GDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLI 119
           G +   GE +L+  I ERA+KG+FLAFQYPVE+PG+  M FL+ ALN QRK R E E+  
Sbjct: 63  GSVTLDGEDLLEMEIDERAAKGVFLAFQYPVEVPGVATMTFLRSALNAQRKKRGEAEIST 122

Query: 120 PDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD 179
           PDF R VR   A LGI+ DML+R +N+GFSGGEKK AEILQM +LEP LCILDETDSGLD
Sbjct: 123 PDFLRLVRDKAANLGISQDMLRRGVNVGFSGGEKKRAEILQMAILEPKLCILDETDSGLD 182

Query: 180 IDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           IDALK+ ++GVNALRS DR+ ++ITHYQRLLN+I PD +HV+H G+I+++G   +AL+LE
Sbjct: 183 IDALKVVSEGVNALRSPDRAMIVITHYQRLLNHIVPDFVHVMHKGRIVRSGGKELALELE 242

Query: 240 ENGYAE 245
            NGYAE
Sbjct: 243 ANGYAE 248


>gi|254469941|ref|ZP_05083346.1| FeS assembly ATPase SufC [Pseudovibrio sp. JE062]
 gi|211961776|gb|EEA96971.1| FeS assembly ATPase SufC [Pseudovibrio sp. JE062]
          Length = 250

 Score =  324 bits (830), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 198/252 (78%), Gaps = 8/252 (3%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A++     +I+RG++L V P EV AIMGPNGSGKSTLSY+L+G +DYEIT G
Sbjct: 1   MLEIKNLHAEV--DGNKILRGIDLTVRPGEVHAIMGPNGSGKSTLSYVLAGKEDYEITEG 58

Query: 61  DILYKGESILDWSIV---ERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
            I Y G   +DWS +   ERA+ G+FLAFQYP+EIPG+  M FLK ALN QRKAR E E+
Sbjct: 59  SITYNG---VDWSELGADERAAAGMFLAFQYPIEIPGVATMTFLKTALNAQRKARGEDEI 115

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
             PDF + VR+ + EL +  DMLKRPLN+GFSGGEKK AEILQM LLEP+LC+LDETDSG
Sbjct: 116 STPDFMKLVREKSKELKVTPDMLKRPLNVGFSGGEKKRAEILQMSLLEPTLCVLDETDSG 175

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL+I ++GVN LRS +RS ++ITHYQRLL++I PD +H+L  GKI+KTG   +AL+
Sbjct: 176 LDIDALRIVSEGVNQLRSPERSMIVITHYQRLLDHIVPDVVHILSKGKIVKTGGKELALE 235

Query: 238 LEENGYAELIKE 249
           LE+NGYA+ + E
Sbjct: 236 LEKNGYADYVDE 247


>gi|159044176|ref|YP_001532970.1| ATP-dependent transporter [Dinoroseobacter shibae DFL 12]
 gi|157911936|gb|ABV93369.1| ATP-dependent transporter [Dinoroseobacter shibae DFL 12]
          Length = 251

 Score =  324 bits (830), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 154/249 (61%), Positives = 195/249 (78%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL  K+ + D +I++G++L VEP +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLQIKNLHVKLEEEDKQILKGVDLSVEPGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE ILD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E EL   
Sbjct: 61  SATLLGEDILDMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEDELSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR     L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKEVRAKAKALKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALRS+ RSFL+ITHYQRLL++IKPD +H++ +G+IIKTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRSEGRSFLVITHYQRLLDHIKPDVVHIMADGRIIKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+L+ E
Sbjct: 241 NGYADLLAE 249


>gi|154248388|ref|YP_001419346.1| FeS assembly ATPase SufC [Xanthobacter autotrophicus Py2]
 gi|154162473|gb|ABS69689.1| FeS assembly ATPase SufC [Xanthobacter autotrophicus Py2]
          Length = 249

 Score =  323 bits (829), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 155/244 (63%), Positives = 191/244 (78%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I   D EI++GL L V   EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 1   MLEIKNLHARI--GDNEILKGLTLTVPAGEVHAIMGPNGSGKSTLSYVLSGKPDYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G+ IL  +  ERA+ G+FLAFQYP+EIPG+  MQFL+ A+N Q+KAR E+E+  P
Sbjct: 59  TATFNGQDILSLAPEERAAAGVFLAFQYPIEIPGVANMQFLRAAMNAQKKARGEEEISTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR    +LGI  DML+R +N+GFSGGEKK  EILQM LLEP LCILDETDSGLDI
Sbjct: 119 DFLKLVRAKAPDLGITQDMLRRGVNVGFSGGEKKRNEILQMALLEPKLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ AQGVNALRS DR+ L+ITHYQRLL++I PD +HV+H G+I+++G   +AL+LEE
Sbjct: 179 DALKVVAQGVNALRSPDRAMLVITHYQRLLDHIVPDVVHVMHKGRIVRSGGAELALELEE 238

Query: 241 NGYA 244
           +GYA
Sbjct: 239 SGYA 242


>gi|119386673|ref|YP_917728.1| FeS assembly ATPase SufC [Paracoccus denitrificans PD1222]
 gi|119377268|gb|ABL72032.1| FeS assembly ATPase SufC [Paracoccus denitrificans PD1222]
          Length = 251

 Score =  321 bits (823), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 198/249 (79%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ D D +I++G++L V   EV AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEDEDKQILKGVDLTVPAGEVHAIMGPNGSGKSTLSYVLSGRDGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +    GES+L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  EATLDGESLLEMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSSA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  A L I+ +MLKRP+N+GFSGGEKK  EILQM +LEPS+CILDETDSGLD+
Sbjct: 121 DFLKLIRQKAATLKIDSEMLKRPVNVGFSGGEKKRNEILQMAMLEPSMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+++ A+GVNALRS DR+FL+ITHYQRLL++IKPD +H++ +G+I++TG   +AL++E+
Sbjct: 181 DAMRLVAEGVNALRSPDRAFLVITHYQRLLDHIKPDVVHIMADGRIVRTGGPELALEVEQ 240

Query: 241 NGYAELIKE 249
           NGY +L+ E
Sbjct: 241 NGYGDLLAE 249


>gi|296445837|ref|ZP_06887789.1| FeS assembly ATPase SufC [Methylosinus trichosporium OB3b]
 gi|296256665|gb|EFH03740.1| FeS assembly ATPase SufC [Methylosinus trichosporium OB3b]
          Length = 249

 Score =  321 bits (823), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 156/249 (62%), Positives = 197/249 (79%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M+EIKNL   I   + +I+ GLNL V+  EV AIMGPNG+GKSTLSY++SG + Y++T G
Sbjct: 1   MIEIKNLHVSI--GERKILDGLNLTVKDGEVAAIMGPNGTGKSTLSYVISGREGYDVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L  GE+IL     ERA+KG+FLAFQYPVEIPG+  M FLK A+N QR++R E+EL  P
Sbjct: 59  EVLLDGENILGLEPHERAAKGVFLAFQYPVEIPGVATMTFLKAAVNAQRRSRGEEELQTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+ +++LGINMDMLKRPLN+GFSGGEKK  +ILQM LLEP   ILDETDSGLDI
Sbjct: 119 DFMKMVREASSKLGINMDMLKRPLNVGFSGGEKKRMDILQMSLLEPKFGILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALRS  R FL+ITHYQRLL+YIKPDT+HV+  GKI KTG   +AL+LE+
Sbjct: 179 DALRIVSEGVNALRSPSRGFLVITHYQRLLDYIKPDTVHVMAKGKIQKTGGPELALELEK 238

Query: 241 NGYAELIKE 249
           +GY + + E
Sbjct: 239 SGYRDYVGE 247


>gi|86750109|ref|YP_486605.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris HaA2]
 gi|86573137|gb|ABD07694.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris HaA2]
          Length = 252

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 194/245 (79%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL+ ++   + EI+ GL L V P EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 4   LLEVKNLQVRV--AEREILHGLTLSVNPGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE +L  +  ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRK+R E EL  P
Sbjct: 62  EILFKGEDLLAMAPDERAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKSRGEAELSTP 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR++   LGI  +MLKR +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 122 DFLKRVREVAGSLGIPQEMLKRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IA++GVNALR+ DR+ ++ITHYQRLL+YI PD +HV+  GK++K+G   +AL+LE 
Sbjct: 182 DALRIASEGVNALRTPDRAMVVITHYQRLLDYIVPDFVHVMSRGKVVKSGGKELALELEA 241

Query: 241 NGYAE 245
           NGYA+
Sbjct: 242 NGYAQ 246


>gi|300023863|ref|YP_003756474.1| FeS assembly ATPase SufC [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525684|gb|ADJ24153.1| FeS assembly ATPase SufC [Hyphomicrobium denitrificans ATCC 51888]
          Length = 251

 Score =  319 bits (818), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 196/246 (79%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ D D  I++GL+L V   EV AIMGPNGSGKSTL+Y+L+G   YE+T G
Sbjct: 1   MLEIKNLHVKLEDEDRVILKGLSLTVPKGEVHAIMGPNGSGKSTLAYVLAGRAGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ GESIL+    ERA+KG+FLAFQYP+EIPG+  + FL+ A+N  RK R E EL  P
Sbjct: 61  DILWNGESILEMQPDERAAKGVFLAFQYPMEIPGVAGLTFLRTAMNAVRKKRGEAELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + V++   +L I+++MLKRP+N+GFSGGEKK +EILQM LLEP+LC+LDETDSGLDI
Sbjct: 121 AFMKIVKEKGEKLNIDVNMLKRPVNVGFSGGEKKRSEILQMALLEPTLCVLDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVNALR +DR+FL+ITHYQRLLNYI PD +HVL +G+I KTG   +AL+LE+
Sbjct: 181 DALRVVAEGVNALRDKDRAFLVITHYQRLLNYIVPDKVHVLADGRIQKTGGKELALELEK 240

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 241 SGYADF 246


>gi|323136295|ref|ZP_08071377.1| FeS assembly ATPase SufC [Methylocystis sp. ATCC 49242]
 gi|322398369|gb|EFY00889.1| FeS assembly ATPase SufC [Methylocystis sp. ATCC 49242]
          Length = 250

 Score =  319 bits (818), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 149/249 (59%), Positives = 197/249 (79%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL   +   D +I++GL L ++  EV A+MGPNG+GKSTLSY+++G + YEIT G
Sbjct: 1   MLEIKNLHVSV--GDRKILKGLTLTIKSGEVAAVMGPNGTGKSTLSYVIAGREGYEITEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L  GE+IL+    ERA++G+FLAFQYPVEIPG+  M FLK A+N QR++R E EL  P
Sbjct: 59  EVLLNGENILELEPHERAARGLFLAFQYPVEIPGVATMTFLKAAMNAQRRSRGEPELQTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR+ +A LG++ +ML+RPLN GFSGGEKK  E+LQM LLEP + ILDETDSGLDI
Sbjct: 119 DFMKRVREASARLGVSQEMLRRPLNSGFSGGEKKRMEVLQMALLEPRVGILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ ++GVNALRS +RSFL+ITHYQRLL+YIKPDT+HV+  G+I ++G   +AL+LEE
Sbjct: 179 DALRVVSEGVNALRSPERSFLVITHYQRLLDYIKPDTVHVMAQGRIQRSGGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY + I E
Sbjct: 239 RGYQDYIAE 247


>gi|316934379|ref|YP_004109361.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris DX-1]
 gi|315602093|gb|ADU44628.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris DX-1]
          Length = 252

 Score =  319 bits (817), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 149/245 (60%), Positives = 194/245 (79%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL+  +   D EI+ GL L V   EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 4   LLEVKNLQVSV--ADREILHGLTLTVNQGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE++L+    ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E EL  P
Sbjct: 62  EILFKGENLLEMEPNERAAKGVFLAFQYPVEIPGVATMNFLRTALNAQRKARGEDELSTP 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR+++  LGI  +MLKR +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 122 DFLKRVREVSGSLGIPQEMLKRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IA++GVNALRS +R+ ++ITHYQRLL+YI PD +HV+  GK++K+G   +AL+LE 
Sbjct: 182 DALRIASEGVNALRSPERAMVVITHYQRLLDYIVPDYVHVMSKGKVVKSGGKELALELEA 241

Query: 241 NGYAE 245
           NGYA+
Sbjct: 242 NGYAQ 246


>gi|86138292|ref|ZP_01056866.1| FeS assembly ATPase SufC [Roseobacter sp. MED193]
 gi|85824817|gb|EAQ45018.1| FeS assembly ATPase SufC [Roseobacter sp. MED193]
          Length = 251

 Score =  318 bits (815), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 151/249 (60%), Positives = 192/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ D D +I++GL+L VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEDEDKQILKGLDLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  SATLAGEDLLELDPEERAALGVFLAFQYPVEIPGVGNMTFLRTAVNSQRKARGEEELSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R    EL I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKSIRAKAKELKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR + R FL+ITHYQRLL++IKPD +H+L +GKI+KTG   +A+++E 
Sbjct: 181 DAMKLVAEGVNALRDEGRGFLVITHYQRLLDHIKPDVVHILADGKIVKTGGPELAMEVEN 240

Query: 241 NGYAELIKE 249
           NGYA ++ E
Sbjct: 241 NGYAGILAE 249


>gi|254563303|ref|YP_003070398.1| FeS assembly ATPase SufC [Methylobacterium extorquens DM4]
 gi|254270581|emb|CAX26584.1| FeS assembly ATPase SufC [Methylobacterium extorquens DM4]
          Length = 250

 Score =  318 bits (814), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 189/245 (77%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  +I   D  I+ GLNL V   EV AIMGPNGSGKSTLSY+++G +DYE+  G
Sbjct: 1   MLEIKNLVVQI--EDNRILNGLNLTVNDGEVAAIMGPNGSGKSTLSYVIAGKEDYEVLDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G+++L+ +  ERA+ GIFLAFQYP+EIPG+  M FLK  LN QRKAR E EL  P
Sbjct: 59  EILLDGQNVLEMAADERAAAGIFLAFQYPLEIPGVGTMTFLKACLNAQRKARGETELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R V     +L IN +MLKR LN+GFSGGEKK  EILQM LL+P  C+LDETDSGLDI
Sbjct: 119 DFIRAVNAAADKLEINKEMLKRALNVGFSGGEKKRMEILQMALLQPKFCVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALR+Q RSFL+ITHYQRLLN+I PDT+HV+  G+I+KTG   +AL+LE 
Sbjct: 179 DALRIVSEGVNALRAQGRSFLVITHYQRLLNHIVPDTVHVMSKGQIVKTGGKELALELEA 238

Query: 241 NGYAE 245
           +GYAE
Sbjct: 239 SGYAE 243


>gi|163853377|ref|YP_001641420.1| FeS assembly ATPase SufC [Methylobacterium extorquens PA1]
 gi|218532234|ref|YP_002423050.1| FeS assembly ATPase SufC [Methylobacterium chloromethanicum CM4]
 gi|240140793|ref|YP_002965273.1| FeS assembly ATPase SufC [Methylobacterium extorquens AM1]
 gi|163664982|gb|ABY32349.1| FeS assembly ATPase SufC [Methylobacterium extorquens PA1]
 gi|218524537|gb|ACK85122.1| FeS assembly ATPase SufC [Methylobacterium chloromethanicum CM4]
 gi|240010770|gb|ACS41996.1| FeS assembly ATPase SufC [Methylobacterium extorquens AM1]
          Length = 250

 Score =  318 bits (814), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 189/245 (77%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  +I   D  I+ GLNL V   EV AIMGPNGSGKSTLSY+++G +DYE+  G
Sbjct: 1   MLEIKNLVVQI--EDNRILNGLNLTVNDGEVAAIMGPNGSGKSTLSYVIAGKEDYEVLDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G+++L+ +  ERA+ GIFLAFQYP+EIPG+  M FLK  LN QRKAR E EL  P
Sbjct: 59  EILLDGQNVLEMAADERAAAGIFLAFQYPLEIPGVGTMTFLKACLNAQRKARGEAELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R V     +L IN +MLKR LN+GFSGGEKK  EILQM LL+P  C+LDETDSGLDI
Sbjct: 119 DFIRAVNAAADKLEINKEMLKRALNVGFSGGEKKRMEILQMALLQPKFCVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALR+Q RSFL+ITHYQRLLN+I PDT+HV+  G+I+KTG   +AL+LE 
Sbjct: 179 DALRIVSEGVNALRAQGRSFLVITHYQRLLNHIVPDTVHVMSKGQIVKTGGKELALELEA 238

Query: 241 NGYAE 245
           +GYAE
Sbjct: 239 SGYAE 243


>gi|188583647|ref|YP_001927092.1| FeS assembly ATPase SufC [Methylobacterium populi BJ001]
 gi|179347145|gb|ACB82557.1| FeS assembly ATPase SufC [Methylobacterium populi BJ001]
          Length = 250

 Score =  318 bits (814), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 189/245 (77%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  +I   D  I+ GLNL V   EV AIMGPNGSGKSTLSY+++G +DYE+  G
Sbjct: 1   MLEIKNLVVQI--EDNRILNGLNLTVNDGEVAAIMGPNGSGKSTLSYVIAGKEDYEVLDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G+++L+ +  ERA+ GIFLAFQYP+EIPG+  M FLK  LN QRKAR E EL  P
Sbjct: 59  EILLDGQNVLEMAADERAAAGIFLAFQYPLEIPGVGTMTFLKACLNAQRKARGEDELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R V     +L IN +MLKR LN+GFSGGEKK  EILQM LL+P  C+LDETDSGLDI
Sbjct: 119 DFIRAVNAAADKLEINKEMLKRALNVGFSGGEKKRMEILQMALLQPKFCVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALR+Q RSFL+ITHYQRLLN+I PDT+HV+  G+I+KTG   +AL+LE 
Sbjct: 179 DALRIVSEGVNALRAQGRSFLVITHYQRLLNHIVPDTVHVMSKGQIVKTGGKELALELEA 238

Query: 241 NGYAE 245
           +GYAE
Sbjct: 239 SGYAE 243


>gi|163741051|ref|ZP_02148443.1| FeS assembly ATPase SufC [Phaeobacter gallaeciensis 2.10]
 gi|161385404|gb|EDQ09781.1| FeS assembly ATPase SufC [Phaeobacter gallaeciensis 2.10]
          Length = 251

 Score =  318 bits (814), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 149/249 (59%), Positives = 194/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D +I++G+NL VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEDKQILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +    GE +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  EASLAGEDLLDMEPEERAAAGVFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSAS 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR     L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKEVRAKAKTLKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ ++GVNALR + R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVSEGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMADGRIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|209885128|ref|YP_002288985.1| FeS assembly ATPase SufC [Oligotropha carboxidovorans OM5]
 gi|209873324|gb|ACI93120.1| FeS assembly ATPase SufC [Oligotropha carboxidovorans OM5]
          Length = 252

 Score =  317 bits (813), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 194/246 (78%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L++K L+ ++   D EI+ GL+L V   EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 4   LLQVKGLKVQV--EDNEILHGLDLTVNAGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE +L     ERA+KG+FLAFQYP+EIPG+  M FL+ ALN QRKAR E EL  P
Sbjct: 62  EILFKGEDLLAMEPDERAAKGVFLAFQYPMEIPGVATMTFLRTALNAQRKARGEAELSTP 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +KVR+++A L +  DMLKR +N+GFSGGEKK  E+LQM L EPSLCILDE DSGLDI
Sbjct: 122 EFLKKVREVSARLNVPQDMLKRGVNVGFSGGEKKRNEVLQMALFEPSLCILDEMDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++AA GVNALRS+DR+ ++ITHYQRLLNYI PD +HV+  G+++K+G   +AL+LE+
Sbjct: 182 DALRVAADGVNALRSKDRAMVVITHYQRLLNYIVPDFVHVMSKGRVVKSGSKDLALELEK 241

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 242 SGYAQF 247


>gi|110679914|ref|YP_682921.1| FeS assembly ATPase SufC [Roseobacter denitrificans OCh 114]
 gi|109456030|gb|ABG32235.1| FeS assembly ATPase SufC [Roseobacter denitrificans OCh 114]
          Length = 251

 Score =  317 bits (813), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 194/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+ K+ + D EI++G++L++E  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLSIKNLQVKLEEEDKEILKGVDLEIEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +GE +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SADLEGEDVLDMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR    EL I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKAVRARAKELKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR++ R FL+ITHYQRLL++IKPD +H++ +GKI+KTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRNEGRGFLVITHYQRLLDHIKPDVVHIMADGKIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGY  ++ E
Sbjct: 241 NGYGNILAE 249


>gi|170747130|ref|YP_001753390.1| FeS assembly ATPase SufC [Methylobacterium radiotolerans JCM 2831]
 gi|170653652|gb|ACB22707.1| FeS assembly ATPase SufC [Methylobacterium radiotolerans JCM 2831]
          Length = 250

 Score =  316 bits (810), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 154/245 (62%), Positives = 188/245 (76%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  +I   D  I+ GLNL V   EV AIMGPNGSGKSTLSY+++G +DYE+  G
Sbjct: 1   MLEIKNLVVQI--EDNRILNGLNLTVNDGEVAAIMGPNGSGKSTLSYVIAGKEDYEVLDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G+++L+ +  ERA+ G+FLAFQYP+EIPG+  M FLK  LN QRKAR E EL  P
Sbjct: 59  EILLDGQNVLEMAADERAAAGVFLAFQYPLEIPGVGTMTFLKACLNAQRKARGEAELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R V     +L IN +MLKR LN+GFSGGEKK  EILQM LL+P  C+LDETDSGLDI
Sbjct: 119 DFIRAVNGAADKLEINKEMLKRALNVGFSGGEKKRMEILQMALLQPKFCVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALR Q RSFL+ITHYQRLLN+I PDT+HV+  G+I+KTG   +AL+LE 
Sbjct: 179 DALRIVSEGVNALRDQGRSFLVITHYQRLLNHIVPDTVHVMSKGQIVKTGGKELALELEA 238

Query: 241 NGYAE 245
           +GYAE
Sbjct: 239 SGYAE 243


>gi|163736414|ref|ZP_02143833.1| FeS assembly ATPase SufC [Phaeobacter gallaeciensis BS107]
 gi|161390284|gb|EDQ14634.1| FeS assembly ATPase [Phaeobacter gallaeciensis BS107]
          Length = 251

 Score =  316 bits (810), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 194/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D +I++G+NL VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEDKQILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +    GE +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  EASLAGEDLLEMEPEERAAAGVFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSAS 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR     L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKEVRAKAKTLKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ ++GVNALR + R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVSEGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMADGRIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|84516298|ref|ZP_01003658.1| FeS assembly ATPase SufC [Loktanella vestfoldensis SKA53]
 gi|84509994|gb|EAQ06451.1| FeS assembly ATPase SufC [Loktanella vestfoldensis SKA53]
          Length = 252

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 151/248 (60%), Positives = 195/248 (78%), Gaps = 1/248 (0%)

Query: 1   MLEIKNLRAKI-VDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA 59
           MLEI NL A++  D D  I++GL L ++P EV AIMGPNGSGKSTLSY+LSG   Y +TA
Sbjct: 1   MLEINNLHAELETDADVTILKGLTLSIKPGEVHAIMGPNGSGKSTLSYVLSGKDGYSVTA 60

Query: 60  GDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLI 119
           G  + +G  +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL  
Sbjct: 61  GSAMLEGVDLLEMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSA 120

Query: 120 PDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD 179
            DF ++VR    +L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD
Sbjct: 121 GDFLKEVRAKAKDLQIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLD 180

Query: 180 IDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           +DA+K+ A GVNALRS++RSFL+ITHYQRLL++IKPD +H+L +GKIIK+G   +AL++E
Sbjct: 181 VDAMKLVADGVNALRSENRSFLVITHYQRLLDHIKPDFVHILADGKIIKSGGPELALEVE 240

Query: 240 ENGYAELI 247
            NGYA+++
Sbjct: 241 NNGYADIL 248


>gi|163731802|ref|ZP_02139249.1| FeS assembly ATPase SufC [Roseobacter litoralis Och 149]
 gi|161395256|gb|EDQ19578.1| FeS assembly ATPase SufC [Roseobacter litoralis Och 149]
          Length = 251

 Score =  316 bits (809), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 197/249 (79%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+ K+ + D EI++G++L++E  +V AIMGPNGSGKSTLSY+LSG   YE+TAG
Sbjct: 1   MLSIKNLQVKLEEEDKEILKGVDLEIEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +GE +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SAELEGEDVLDMDPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR    EL I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVVRARAKELKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR++ R FL+ITHYQRLL++IKPD +H++ +G+I+K+G   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRNEGRGFLVITHYQRLLDHIKPDYVHIMSDGRIVKSGGPELALEVEH 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|148255358|ref|YP_001239943.1| hypothetical protein BBta_3967 [Bradyrhizobium sp. BTAi1]
 gi|146407531|gb|ABQ36037.1| SufC [Bradyrhizobium sp. BTAi1]
          Length = 250

 Score =  316 bits (809), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 149/246 (60%), Positives = 194/246 (78%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL+ ++   + EI+ GL L ++  +V AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 3   LLEIKNLQVRV--EEREILHGLTLTIDAGKVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE +L  +  ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E+E   P
Sbjct: 61  EILFKGEDLLAMAPDERAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGEEEYSTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +KVR+I+ +L I  DMLKR +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 121 DFLKKVREISKQLNIPQDMLKRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IAA GVNALRS +RS ++ITHYQRLLNYI PD +HV+  G+++K+G   +AL+LE 
Sbjct: 181 DALRIAADGVNALRSPERSMIVITHYQRLLNYIVPDVVHVMSKGRVVKSGGKELALELEA 240

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 241 SGYAQF 246


>gi|39935531|ref|NP_947807.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris CGA009]
 gi|192291122|ref|YP_001991727.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris TIE-1]
 gi|39649384|emb|CAE27906.1| sufC, related to ABC transporter ATP-binding protein
           [Rhodopseudomonas palustris CGA009]
 gi|192284871|gb|ACF01252.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris TIE-1]
          Length = 252

 Score =  316 bits (809), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 146/245 (59%), Positives = 194/245 (79%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+K+L+  +   D EI+ GL L V   EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 4   LLEVKDLQVSV--ADREILHGLTLTVNEGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE++L+    ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRK+R E EL  P
Sbjct: 62  EILFKGENLLEMEPNERAAKGVFLAFQYPVEIPGVATMNFLRTALNSQRKSRGEDELSTP 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR+++  LGI  +MLKR +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 122 DFLKRVREVSGSLGIPQEMLKRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IA++GVNALR+ +RS ++ITHYQRLL+YI PD +HV+  GK++++G   +AL+LE 
Sbjct: 182 DALRIASEGVNALRAPNRSMVVITHYQRLLDYIVPDVVHVMSKGKVVRSGGKELALELEA 241

Query: 241 NGYAE 245
           NGYA+
Sbjct: 242 NGYAQ 246


>gi|91976929|ref|YP_569588.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris BisB5]
 gi|91683385|gb|ABE39687.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris BisB5]
          Length = 252

 Score =  315 bits (808), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 146/245 (59%), Positives = 191/245 (77%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL+  +   D EI+ GL L V P EV AIMGPNGSGKSTLS++++G   Y++T G
Sbjct: 4   LLEVKNLQVSV--GDREILHGLTLSVNPGEVHAIMGPNGSGKSTLSHVIAGKPGYDVTGG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+KGE +L+ +   RA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 62  QILFKGEDLLEMAPDVRAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGEAEFSTP 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR++ A L I  +MLKR +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 122 DFLKRVREVAASLNIPQEMLKRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++A++GVNALR+ DR+ ++ITHYQRLL+YI PD +HV+  GK++K+G   +AL+LE 
Sbjct: 182 DALRVASEGVNALRTPDRAMVVITHYQRLLDYIVPDHVHVMSKGKVVKSGGKELALELEA 241

Query: 241 NGYAE 245
           NGYA+
Sbjct: 242 NGYAQ 246


>gi|310815930|ref|YP_003963894.1| FeS assembly ATPase SufC [Ketogulonicigenium vulgare Y25]
 gi|308754665|gb|ADO42594.1| FeS assembly ATPase SufC [Ketogulonicigenium vulgare Y25]
          Length = 250

 Score =  314 bits (805), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 196/247 (79%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL  K+ + D  I++G++L ++P EV AIMGPNGSGKST SY+L+G   YE+T G
Sbjct: 1   MLTIKNLHVKLEEEDKAILKGVDLVIKPGEVHAIMGPNGSGKSTTSYVLAGRDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ ++GE++L+    ERA+ G+FLAFQYPVEIPG+  + FL+ ALN QRK+R E+EL   
Sbjct: 61  EVEFEGENLLEMEPEERAAAGVFLAFQYPVEIPGVGNLTFLRTALNAQRKSRGEEELSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR   A L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP LCILDETDSGLD+
Sbjct: 121 DFLKLVRARAASLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKLCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALRS +RSFL+ITHYQRLL++IKPD +H++ NG+I+K+G   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRSPERSFLVITHYQRLLDHIKPDVVHIMANGRIVKSGGPELALEVEN 240

Query: 241 NGYAELI 247
           NGY +L+
Sbjct: 241 NGYGDLL 247


>gi|114764567|ref|ZP_01443771.1| FeS assembly ATPase SufC [Pelagibaca bermudensis HTCC2601]
 gi|114542943|gb|EAU45963.1| FeS assembly ATPase SufC [Roseovarius sp. HTCC2601]
          Length = 251

 Score =  314 bits (805), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 193/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL+ K+ + D +I++G++L VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLQVKLEEEDKQILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SAELLGEDLLDMDAEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNSQRKARGEEEMSST 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR+    L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP LCILDETDSGLD+
Sbjct: 121 EFLKVVREKAKSLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKLCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A GVNALR + R FL+ITHYQRLL++IKPD +H++H+G+IIKTG   +AL++E 
Sbjct: 181 DAMKLVADGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMHDGRIIKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
            GYA LI+E
Sbjct: 241 EGYAHLIEE 249


>gi|299133787|ref|ZP_07026981.1| FeS assembly ATPase SufC [Afipia sp. 1NLS2]
 gi|298591623|gb|EFI51824.1| FeS assembly ATPase SufC [Afipia sp. 1NLS2]
          Length = 252

 Score =  314 bits (804), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 191/246 (77%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+K L+ ++   D EI+ GL+L V   EV AIMGPNGSGKSTLS++++G   Y +T G
Sbjct: 4   LLEVKGLKVQV--EDNEILHGLDLTVNEGEVHAIMGPNGSGKSTLSHVIAGKPGYNVTGG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE++L+    ERA+KG+FLAFQYP+EIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 62  EILFKGENLLEMEPNERAAKGVFLAFQYPMEIPGVATMTFLRTALNAQRKARGESEFSTP 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +KV+++ A L I  DMLKR +N+GFSGGEKK  E+LQM L EPSLCILDE DSGLDI
Sbjct: 122 DFLKKVKEVAARLSIPQDMLKRGVNVGFSGGEKKRNEVLQMALFEPSLCILDEMDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IAA GVNALR + RS ++ITHYQRLLNYI PD +HV+  G+++K+G   +AL+LE+
Sbjct: 182 DALRIAADGVNALRGKSRSMIVITHYQRLLNYIIPDVVHVMSKGRVVKSGGKDLALELEK 241

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 242 SGYAQF 247


>gi|255263280|ref|ZP_05342622.1| FeS assembly ATPase SufC [Thalassiobium sp. R2A62]
 gi|255105615|gb|EET48289.1| FeS assembly ATPase SufC [Thalassiobium sp. R2A62]
          Length = 251

 Score =  314 bits (804), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 192/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK L+  + D D +I++G++L +EP +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKGLKVDLEDEDKQILKGVDLSIEPGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +LD    +RA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E E+   
Sbjct: 61  AATLDGVDLLDMEPEQRAAAGLFLAFQYPVEIPGVGNMTFLRTAVNSQRKARGEDEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR     L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKLVRAKAKSLKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALRS+ RSFL+ITHYQRLL++I+PD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRSEGRSFLVITHYQRLLDHIQPDVVHIMADGRIVKTGGPDLALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILSE 249


>gi|126728562|ref|ZP_01744377.1| FeS assembly ATPase SufC [Sagittula stellata E-37]
 gi|126710492|gb|EBA09543.1| FeS assembly ATPase SufC [Sagittula stellata E-37]
          Length = 251

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 193/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D +I++G++L VE  +V AIMGPNGSGKSTLSY+LSG   YEIT G
Sbjct: 1   MLEIKNLHVKLEEEDKQILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEITEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +GE +L+  + ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR ++E+   
Sbjct: 61  TATLEGEDLLEMEVEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGQEEMSSA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+    L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVIREKAKSLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A GVNALR   R FL+ITHYQRLL++IKPD +H++ NG+IIKTG   +AL++E 
Sbjct: 181 DAMKLVADGVNALRDAGRGFLVITHYQRLLDHIKPDVVHIMSNGRIIKTGGPDLALEVEH 240

Query: 241 NGYAELIKE 249
           NGYA+LI E
Sbjct: 241 NGYADLIAE 249


>gi|75675855|ref|YP_318276.1| FeS assembly ATPase SufC [Nitrobacter winogradskyi Nb-255]
 gi|74420725|gb|ABA04924.1| FeS assembly ATPase SufC [Nitrobacter winogradskyi Nb-255]
          Length = 249

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 191/246 (77%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+K+L+ ++   + EI+ GL+L V   EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 3   LLEVKDLQVRV--EEREILHGLSLTVNKGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+KGE +L+    ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 61  QILFKGEDLLEMEPDERAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGESEYSTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +KVR + A L I  DML+R +N+GFSGGEKK  E+LQM L EPSLCILDE DSGLDI
Sbjct: 121 NFLKKVRDVAASLNIPQDMLRRGINVGFSGGEKKRNEVLQMALFEPSLCILDEMDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++AA GVNALRS DR+ ++ITHYQRLLNYI PD +HV+  G+++K+G+  +AL+LE 
Sbjct: 181 DALRVAADGVNALRSPDRAMVVITHYQRLLNYIVPDVVHVMSKGRVVKSGNKDLALELEA 240

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 241 SGYAQF 246


>gi|146340500|ref|YP_001205548.1| SufC, related to ABC transporter associated with Fe-S cluster
           assembly ATP-binding protein [Bradyrhizobium sp. ORS278]
 gi|146193306|emb|CAL77322.1| SufC, related to ABC transporter associated with Fe-S cluster
           assembly (ATP-binding protein) [Bradyrhizobium sp.
           ORS278]
          Length = 250

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 193/246 (78%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL+ ++   + EI+ GL L ++  +V AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 3   LLEIKNLQVRV--EEREILHGLTLTIDEGKVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE +L     ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E+E   P
Sbjct: 61  EILFKGEDLLAMDPDERAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGEEEYSTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +KVR+I+ +L I  DMLKR +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 121 DFLKKVREISKQLSIPQDMLKRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IAA GVNALR+ +RS ++ITHYQRLLNYI PD +HV+  G+++K+G   +AL+LE 
Sbjct: 181 DALRIAADGVNALRAPERSMIVITHYQRLLNYIVPDVVHVMSKGRVVKSGGKELALELEA 240

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 241 SGYAQF 246


>gi|115524972|ref|YP_781883.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris BisA53]
 gi|115518919|gb|ABJ06903.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris BisA53]
          Length = 251

 Score =  313 bits (802), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 144/245 (58%), Positives = 193/245 (78%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL+ ++   + EI+ GL L VE  +V AIMGPNGSGKSTLS++++G   Y++T G
Sbjct: 3   LLEVKNLQVRV--EEREILHGLTLTVEAGQVHAIMGPNGSGKSTLSHVIAGKPGYQVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE +L+ S  +RA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 61  EILFKGEDLLEMSPDQRAAKGVFLAFQYPVEIPGVATMNFLRTALNAQRKARGEGEFSTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +KVR++ A LGI  +MLKR +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 121 EFLKKVREVAASLGIPQEMLKRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++AA GVN LRS DR+ ++ITHYQRLL+YI PD +HV+  G+++++G   +AL+LE 
Sbjct: 181 DALRVAADGVNKLRSPDRAMVVITHYQRLLDYIVPDVVHVMAKGRVVRSGGKELALELEA 240

Query: 241 NGYAE 245
           +GYA+
Sbjct: 241 SGYAQ 245


>gi|163746295|ref|ZP_02153653.1| FeS assembly ATPase SufC [Oceanibulbus indolifex HEL-45]
 gi|161380180|gb|EDQ04591.1| FeS assembly ATPase SufC [Oceanibulbus indolifex HEL-45]
          Length = 251

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 194/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL  K+ + D +I++G++L+VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLSIKNLHVKLEEEDKQILKGVDLEVEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G  +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SATLEGNDLLDLEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R    +L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKVIRAKAKDLKIDADMLKRPVNMGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR++ R FL+ITHYQRLL++IKPD +H++ +G+IIKTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRTEGRGFLVITHYQRLLDHIKPDVVHIMSDGRIIKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|126736365|ref|ZP_01752107.1| FeS assembly ATPase SufC [Roseobacter sp. CCS2]
 gi|126714186|gb|EBA11055.1| FeS assembly ATPase SufC [Roseobacter sp. CCS2]
          Length = 251

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 192/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L  K+ + D +I++G++LK+EP  V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLNIKGLEVKLEEEDKQILKGVDLKIEPGTVHAIMGPNGSGKSTLSYVLSGKDGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +GE +L     ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRK R E E+   
Sbjct: 61  SAALEGEDLLGMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKERGEDEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR     L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKEVRAKAKSLKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ ++GVNALRS+ RSFL+ITHYQRLL++IKPD +H++ +G+I+K+G   +AL++E 
Sbjct: 181 DAMKLVSEGVNALRSEGRSFLVITHYQRLLDHIKPDVVHIMADGRIVKSGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|85716314|ref|ZP_01047287.1| FeS assembly ATPase SufC [Nitrobacter sp. Nb-311A]
 gi|85696830|gb|EAQ34715.1| FeS assembly ATPase SufC [Nitrobacter sp. Nb-311A]
          Length = 247

 Score =  312 bits (800), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 190/246 (77%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+K+L+ ++   + EI+ GL+L V   EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 1   MLEVKDLQVRV--EEREILHGLSLTVNKGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+ GE +L+    ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 59  QILFNGEDLLEMEPDERAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGESEYSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +KVR + A L I  DML+R +N+GFSGGEKK  E+LQM L EPSLCILDE DSGLDI
Sbjct: 119 NFLKKVRDVAASLNIPQDMLRRGINVGFSGGEKKRNEVLQMALFEPSLCILDEMDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++AA GVNALRS DR+ ++ITHYQRLLNYI PD +HV+  G+++K+G+  +AL+LE 
Sbjct: 179 DALRVAADGVNALRSPDRAMVVITHYQRLLNYIVPDFVHVMSKGRVVKSGNKDLALELEA 238

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 239 SGYAQF 244


>gi|170743213|ref|YP_001771868.1| FeS assembly ATPase SufC [Methylobacterium sp. 4-46]
 gi|168197487|gb|ACA19434.1| FeS assembly ATPase SufC [Methylobacterium sp. 4-46]
          Length = 250

 Score =  312 bits (800), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 187/245 (76%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  +I   D  I+ GL+L V   E+ AIMGPNGSGKSTLSY+++G  DYE+  G
Sbjct: 1   MLEIKNLVVQI--EDKRILNGLDLTVADGEIAAIMGPNGSGKSTLSYVIAGKADYEVLDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L  GE+IL+ +  ERA+ GIFLAFQYP+EIPG+  M FLK ALN QRKAR E EL  P
Sbjct: 59  EVLLDGENILEMAPDERAAAGIFLAFQYPLEIPGVATMTFLKAALNAQRKARGEDELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V      L IN +MLKR LN+GFSGGEKK  EILQM LLEP  C+LDETDSGLDI
Sbjct: 119 DFMRRVYGAADRLEINREMLKRALNVGFSGGEKKRMEILQMALLEPRFCVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALR   RSFL+ITHYQRLLN+I PDT+HV+  G+++K+G   +AL+LE 
Sbjct: 179 DALRIVSEGVNALRDPKRSFLVITHYQRLLNHIVPDTVHVMSQGRVVKSGGKELALELEA 238

Query: 241 NGYAE 245
           +GYAE
Sbjct: 239 SGYAE 243


>gi|126737788|ref|ZP_01753518.1| FeS assembly ATPase SufC [Roseobacter sp. SK209-2-6]
 gi|126721181|gb|EBA17885.1| FeS assembly ATPase SufC [Roseobacter sp. SK209-2-6]
          Length = 251

 Score =  311 bits (798), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 192/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ D D +I++GL+L VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEDEDKQILKGLDLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  SATLAGEDLLELEPEERAALGVFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R    EL I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKTIRAKAKELKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR + R FL+ITHYQRLL++IKPD +H+L NG+I+KTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRDEGRGFLVITHYQRLLDHIKPDVVHILANGRIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA ++ E
Sbjct: 241 NGYAGILAE 249


>gi|254436527|ref|ZP_05050021.1| FeS assembly ATPase SufC [Octadecabacter antarcticus 307]
 gi|198251973|gb|EDY76287.1| FeS assembly ATPase SufC [Octadecabacter antarcticus 307]
          Length = 251

 Score =  311 bits (798), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 192/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L  K+ + D +I++G+NL VEP  V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLIIKDLHVKLEEEDKQILKGVNLTVEPGSVHAIMGPNGSGKSTLSYVLSGKGGYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +GE +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E E+   
Sbjct: 61  SATLEGEELLDMEAEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEDEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+    L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVIREKAKSLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALRS+ R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRSEGRGFLVITHYQRLLDHIKPDVVHIMSDGRIVKTGGPELALEIEH 240

Query: 241 NGYAELIKE 249
           NGY +++ E
Sbjct: 241 NGYGDILAE 249


>gi|220925676|ref|YP_002500978.1| FeS assembly ATPase SufC [Methylobacterium nodulans ORS 2060]
 gi|219950283|gb|ACL60675.1| FeS assembly ATPase SufC [Methylobacterium nodulans ORS 2060]
          Length = 250

 Score =  311 bits (798), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 190/245 (77%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A+I      I+ GL+L V+  EV AIMGPNGSGKSTLSY+++G +DYE+  G
Sbjct: 1   MLEIKNLVAEI--DGKRILNGLDLTVQDGEVAAIMGPNGSGKSTLSYVIAGKEDYEVLEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L  GE+IL+ +  ERA+ G+FLAFQYP+EIPG+  M FLK ALN QRKAR E+EL  P
Sbjct: 59  EVLLDGENILEMAPDERAAAGLFLAFQYPLEIPGVATMTFLKSALNAQRKARGEEELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V     +L I  +MLKR LN+GFSGGEKK  EILQM LLEP  C+LDETDSGLDI
Sbjct: 119 DFMRRVYGAADKLEIEREMLKRALNVGFSGGEKKRMEILQMALLEPRFCVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVNALR   RSFL+ITHYQRLLN+I PDT+HV+  G+I+++G   +AL+LE 
Sbjct: 179 DALRIVAEGVNALRDPKRSFLVITHYQRLLNHIVPDTVHVMSQGRIVRSGGKELALELEA 238

Query: 241 NGYAE 245
           +GYAE
Sbjct: 239 SGYAE 243


>gi|27379451|ref|NP_770980.1| ATP-binding protein [Bradyrhizobium japonicum USDA 110]
 gi|27352602|dbj|BAC49605.1| blr4340 [Bradyrhizobium japonicum USDA 110]
          Length = 259

 Score =  311 bits (797), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 191/246 (77%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+K+L+ ++   + EI+ GL L V   EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 13  LLEVKDLQVRV--EEREILHGLTLTVNEGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTGG 70

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+KGE +L+ +  ERA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 71  QILFKGEDLLEMAPDERAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGESEYSTP 130

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +KVR+++  L I  DMLKR +N+GFSGGEKK  E+LQM L EPSLCILDE DSGLDI
Sbjct: 131 DFLKKVREVSKSLNIPQDMLKRGVNVGFSGGEKKRNEVLQMALFEPSLCILDEMDSGLDI 190

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IAA GVNALR+  R+ ++ITHYQRLLNYI PD +HV+  G+++K+G   +AL+LE+
Sbjct: 191 DALRIAADGVNALRAPKRAMVVITHYQRLLNYIVPDFVHVMSKGRVVKSGGKELALELED 250

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 251 SGYAQF 256


>gi|90424336|ref|YP_532706.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris BisB18]
 gi|90106350|gb|ABD88387.1| FeS assembly ATPase SufC [Rhodopseudomonas palustris BisB18]
          Length = 251

 Score =  311 bits (796), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 144/245 (58%), Positives = 190/245 (77%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL+ ++   + EI+ GL L V   EV AIMGPNGSGKSTLS++++G   Y++T G
Sbjct: 3   LLEVKNLQVRV--EEREILHGLTLSVNAGEVHAIMGPNGSGKSTLSHVIAGKPGYQVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KGE +L+ +   RA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 61  EILFKGEDLLEMAPDVRAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGEGEFSTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +KVR++ A LGI  +ML+R +N+GFSGGEKK  E+LQM L +PSLCILDE DSGLDI
Sbjct: 121 DFLKKVREVAASLGIPQEMLRRGVNVGFSGGEKKRNEVLQMALFQPSLCILDEMDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++AA GVN LRS DR+ ++ITHYQRLL+YI PD +HV+  G+++K+G   +AL+LE 
Sbjct: 181 DALRVAADGVNKLRSPDRAMVVITHYQRLLDYIVPDVVHVMSKGRVVKSGGKELALELEA 240

Query: 241 NGYAE 245
            GYA+
Sbjct: 241 TGYAQ 245


>gi|254512357|ref|ZP_05124424.1| FeS assembly ATPase SufC [Rhodobacteraceae bacterium KLH11]
 gi|221536068|gb|EEE39056.1| FeS assembly ATPase SufC [Rhodobacteraceae bacterium KLH11]
          Length = 251

 Score =  311 bits (796), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D +I++G++L V+  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEDKQILKGVDLTVDAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E EL   
Sbjct: 61  SASLGGEDLLEMEPEERAAAGVFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEDELSAT 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR     L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKEVRAKAKALKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR + R FL+ITHYQRLL++IKPD +H++  G+I+K+G   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMAEGRIVKSGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|254487563|ref|ZP_05100768.1| FeS assembly ATPase SufC [Roseobacter sp. GAI101]
 gi|214044432|gb|EEB85070.1| FeS assembly ATPase SufC [Roseobacter sp. GAI101]
          Length = 251

 Score =  311 bits (796), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 194/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L+ K+ D D +I++G++L++E  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLSIKGLKVKLEDEDKQILKGVDLEIEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G  +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SATLEGVDLLDMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR    EL I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVVRARAKELKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR++ R FL+ITHYQRLL++IKPD +H++ +G+IIKTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRTEGRGFLVITHYQRLLDHIKPDVVHIMADGRIIKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|56696888|ref|YP_167250.1| FeS assembly ATPase SufC [Ruegeria pomeroyi DSS-3]
 gi|56678625|gb|AAV95291.1| FeS assembly ATPase SufC [Ruegeria pomeroyi DSS-3]
          Length = 251

 Score =  310 bits (795), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D +I++G++L VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEDKQILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  GATLSGADLLEMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++VR     L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKEVRAKAKALKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR   R FL+ITHYQRLL++IKPD +H++ +G+I+K+G   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRDAGRGFLVITHYQRLLDHIKPDVVHIMADGRIVKSGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|114768833|ref|ZP_01446459.1| FeS assembly ATPase SufC [alpha proteobacterium HTCC2255]
 gi|114549750|gb|EAU52631.1| FeS assembly ATPase SufC [alpha proteobacterium HTCC2255]
          Length = 251

 Score =  310 bits (794), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  + + D +I+ G++L +   EV AIMGPNGSGKST SY+L+G   Y +TAG
Sbjct: 1   MLNIKNLKVGLAEEDKQILNGVDLNIGEGEVHAIMGPNGSGKSTTSYVLAGKDGYNVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE++LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR EKEL   
Sbjct: 61  SAELNGENLLDMDPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEKELTAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR+    L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +C+LDETDSGLD+
Sbjct: 121 EFLKIVREKAKSLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCVLDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR   RSFL+ITHYQRLL++IKPD +H++ NGKIIKTG   +AL++E+
Sbjct: 181 DAMKLVAEGVNALRDGKRSFLVITHYQRLLDHIKPDVVHIMANGKIIKTGGPELALEVEQ 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|254450462|ref|ZP_05063899.1| FeS assembly ATPase SufC [Octadecabacter antarcticus 238]
 gi|198264868|gb|EDY89138.1| FeS assembly ATPase SufC [Octadecabacter antarcticus 238]
          Length = 251

 Score =  310 bits (793), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L  K+ D D +I++G+NL VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLVIKDLHVKLEDEDKQILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLSGKGGYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +GE +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E E+   
Sbjct: 61  SATLEGEELLDMDAEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEDEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R     L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVIRAKAKTLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALRS+ R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRSEGRGFLVITHYQRLLDHIKPDVVHIMSDGRIVKTGGPELALEIEN 240

Query: 241 NGYAELIKE 249
           NGY +++ E
Sbjct: 241 NGYGDILAE 249


>gi|260433730|ref|ZP_05787701.1| FeS assembly ATPase SufC [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417558|gb|EEX10817.1| FeS assembly ATPase SufC [Silicibacter lacuscaerulensis ITI-1157]
          Length = 251

 Score =  308 bits (789), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + + +I++G++L VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEEKQILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  SATLDGADLLEMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKLVREKAKSLKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR + R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMADGRIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGY +++ E
Sbjct: 241 NGYTDILAE 249


>gi|126726558|ref|ZP_01742399.1| FeS assembly ATPase SufC [Rhodobacterales bacterium HTCC2150]
 gi|126704421|gb|EBA03513.1| FeS assembly ATPase SufC [Rhodobacterales bacterium HTCC2150]
          Length = 251

 Score =  308 bits (788), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 190/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL+  + + D +I++G++L +   EV AIMGPNGSGKST SY+LSG   YE+T G
Sbjct: 1   MLEIKNLQVSLEEEDKQILKGVDLSIGEGEVHAIMGPNGSGKSTTSYVLSGKDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E EL   
Sbjct: 61  SAKLNGNDLLDMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNSQRKARGEDELSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR+    L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +C+LDETDSGLD+
Sbjct: 121 EFLKVVREKAKALKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCVLDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR   RSFL+ITHYQRLL++IKPD +H++ NG+IIK+G   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRDGKRSFLVITHYQRLLDHIKPDVVHIMANGRIIKSGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+L++E
Sbjct: 241 NGYADLLEE 249


>gi|99081086|ref|YP_613240.1| FeS assembly ATPase SufC [Ruegeria sp. TM1040]
 gi|99037366|gb|ABF63978.1| FeS assembly ATPase SufC [Ruegeria sp. TM1040]
          Length = 251

 Score =  308 bits (788), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 151/249 (60%), Positives = 192/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ D D +I++G+NL VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEDEDKQILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  SASLLGEELLELEPEERAALGVFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSAT 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR    EL I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKHVRAQAKELKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A GVNALR + R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVADGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMADGRIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILSE 249


>gi|260426304|ref|ZP_05780283.1| FeS assembly ATPase SufC [Citreicella sp. SE45]
 gi|260420796|gb|EEX14047.1| FeS assembly ATPase SufC [Citreicella sp. SE45]
          Length = 251

 Score =  307 bits (787), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 193/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL+ K+ + D +I++G+NL VE  +V AIMGPNGSGKSTLSY+LSG   Y +T G
Sbjct: 1   MLEIKNLQVKLEEEDKQILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLSGKDGYVVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +    GE IL+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR ++E+   
Sbjct: 61  EATLGGEDILEMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGDEEMSST 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR+    L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVVREKAKSLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ + GVNALR + R FL+ITHYQRLL++IKPD +H++++G+IIKTG   +AL++E 
Sbjct: 181 DAMKLVSDGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMYDGRIIKTGGPELALEVET 240

Query: 241 NGYAELIKE 249
            GYA LI+E
Sbjct: 241 QGYAHLIEE 249


>gi|92117850|ref|YP_577579.1| FeS assembly ATPase SufC [Nitrobacter hamburgensis X14]
 gi|91800744|gb|ABE63119.1| FeS assembly ATPase SufC [Nitrobacter hamburgensis X14]
          Length = 249

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 190/246 (77%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+K+L  ++   + EI+ GL+L V   EV AIMGPNGSGKSTLS++++G   YE+T G
Sbjct: 3   LLEVKDLHVRV--EEREILHGLSLIVNRGEVHAIMGPNGSGKSTLSHVIAGKPGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GE +L     +RA+KG+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E   P
Sbjct: 61  EILLGGEDLLAMEPDQRAAKGVFLAFQYPVEIPGVATMTFLRTALNAQRKARGESEYSTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +KVR++ A L I  DML+R +N+GFSGGEKK  E+LQM L EPSLCILDE DSGLDI
Sbjct: 121 NFLKKVREVAASLNIPQDMLRRGINVGFSGGEKKRNEVLQMGLFEPSLCILDEMDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++AA GVNALRS+DR+ ++ITHYQRLLNYI PD +HV+  G+++K+GD  +AL+LE 
Sbjct: 181 DALRVAADGVNALRSKDRAMVVITHYQRLLNYIVPDFVHVMSKGRVVKSGDKDLALELEA 240

Query: 241 NGYAEL 246
           +GYA+ 
Sbjct: 241 SGYAQF 246


>gi|149914904|ref|ZP_01903433.1| Suf C, ATPase [Roseobacter sp. AzwK-3b]
 gi|149811092|gb|EDM70929.1| Suf C, ATPase [Roseobacter sp. AzwK-3b]
          Length = 251

 Score =  306 bits (785), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL   + D D  I++G++L VE  +V AIMGPNGSGKSTLSY+L+G   YE+T G
Sbjct: 1   MLEIKNLHVDLEDEDKTILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLAGRDGYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G  IL+    ERA+ G+FLAFQYPVEIPG+  M FL+ ALN QRKA+  +E+   
Sbjct: 61  SATLEGVDILEMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTALNAQRKAKGLEEMSAT 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+  A L ++ DMLKRP+N+GFSGGEKK  EILQM LLEP +CILDETDSGLD+
Sbjct: 121 DFLKLVREKAATLKMDNDMLKRPVNVGFSGGEKKRNEILQMALLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR++ R FL+ITHYQRLL++IKPD +H++ NG+IIKTG   +AL++E+
Sbjct: 181 DAMKLVAEGVNALRNEGRGFLVITHYQRLLDHIKPDVVHIMSNGRIIKTGGPELALEVEQ 240

Query: 241 NGYAELIKE 249
           NGY ++  E
Sbjct: 241 NGYEDIKAE 249


>gi|85703163|ref|ZP_01034267.1| FeS assembly ATPase SufC [Roseovarius sp. 217]
 gi|85672091|gb|EAQ26948.1| FeS assembly ATPase SufC [Roseovarius sp. 217]
          Length = 251

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 188/249 (75%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL   + + D  I++G+NL VE  +V AIMGPNGSGKSTLSY+LSG   Y++T G
Sbjct: 1   MLEIKNLHVDLEEEDKTILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYKVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E E+   
Sbjct: 61  SATLSGVDLLDMEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEDEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKLVREKAKTLQIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A GVNALR   R FL+ITHYQRLL++IKPD +H++ +G+IIKTG   +AL++E+
Sbjct: 181 DAMKLVADGVNALRDPGRGFLVITHYQRLLDHIKPDVVHIMSDGRIIKTGGPDLALEVEQ 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILSE 249


>gi|84503546|ref|ZP_01001597.1| Suf C, ATPase [Oceanicola batsensis HTCC2597]
 gi|84388036|gb|EAQ01084.1| Suf C, ATPase [Oceanicola batsensis HTCC2597]
          Length = 251

 Score =  306 bits (783), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 190/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL  K+ D D +I++G++L VE  +V AIMGPNGSGKSTLSY+LSG + YE+T G
Sbjct: 1   MLTIKNLHVKLEDEDKQILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLSGREGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G  +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ ALN QRKAR E E+   
Sbjct: 61  SAELEGLDLLDMDPEERAAAGLFLAFQYPVEIPGVGNMTFLRTALNAQRKARGEDEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    L I+ DMLKRP+N+GFSGGEKK  EILQM +L+P +CILDETDSGLD+
Sbjct: 121 DFLKFIREKAKTLKIDADMLKRPVNVGFSGGEKKRNEILQMAVLQPRMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ + GVNALR   R FL+ITHYQRLL++I+PD +H++  G+I+KTG   +AL++E+
Sbjct: 181 DAMKLVSDGVNALRDAGRGFLVITHYQRLLDHIRPDVVHIMAGGRIVKTGGPELALEVEK 240

Query: 241 NGYAELIKE 249
           NGYA+L+ E
Sbjct: 241 NGYADLMAE 249


>gi|262277359|ref|ZP_06055152.1| FeS assembly ATPase SufC [alpha proteobacterium HIMB114]
 gi|262224462|gb|EEY74921.1| FeS assembly ATPase SufC [alpha proteobacterium HIMB114]
          Length = 245

 Score =  306 bits (783), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 152/247 (61%), Positives = 192/247 (77%), Gaps = 3/247 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M++IKNL+  + D D  II+GLNLK+   EV AIMGPNGSGKSTLSY LSG + YE   G
Sbjct: 1   MIDIKNLKVSVEDKD--IIKGLNLKINKGEVHAIMGPNGSGKSTLSYALSGKEGYE-AEG 57

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I Y GE+IL+ +  ERA KGIFLAFQYP+EIPG+    FL+ +LN  RKA+ EKEL   
Sbjct: 58  EINYNGENILELNTEERAQKGIFLAFQYPIEIPGVFTNNFLRTSLNAVRKAKGEKELNAV 117

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   V++ + +L I+ +ML RPLN+GFSGGEKK  EILQM LLEP+  I+DETDSGLDI
Sbjct: 118 EFLNLVKEKSQKLKIDKEMLSRPLNVGFSGGEKKRNEILQMSLLEPNFIIMDETDSGLDI 177

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNA+RS +RSFLIITHYQRLLNYIKPD +HV  +GKI+++GD+ +AL+LE 
Sbjct: 178 DALKIVSNGVNAMRSPERSFLIITHYQRLLNYIKPDFVHVFSDGKIVESGDWKLALELEN 237

Query: 241 NGYAELI 247
           +GYA+ +
Sbjct: 238 DGYAKFV 244


>gi|158422669|ref|YP_001523961.1| FeS assembly ATPase [Azorhizobium caulinodans ORS 571]
 gi|158329558|dbj|BAF87043.1| FeS assembly ATPase [Azorhizobium caulinodans ORS 571]
          Length = 260

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 144/245 (58%), Positives = 188/245 (76%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI++L+A++     +I+ GLNL V   E+ AIMGPNG+GKSTLSY+LSG   YEIT G
Sbjct: 11  LLEIRDLKAEV--AGRQILNGLNLTVNAGEIHAIMGPNGAGKSTLSYVLSGKPGYEITGG 68

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++   GE +L     ERA+KG+FLAFQYP+EIPG+  + FL+ ALN QR+ R E+EL  P
Sbjct: 69  EVFLNGEDLLAMEADERAAKGLFLAFQYPLEIPGVATLTFLRTALNAQRRKRGEEELSSP 128

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +KVR+++ +LGI+ DML+RP+N+GFSGGEKK  E LQM LLEP LC+LDETDSGLDI
Sbjct: 129 DFMKKVRELSKKLGIDPDMLRRPVNVGFSGGEKKRNETLQMALLEPRLCVLDETDSGLDI 188

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN LR+ +R  ++ITHYQRLL+YI PD +HVL  G+I++TG   +AL LE 
Sbjct: 189 DALKVVANGVNQLRAAERGMIVITHYQRLLDYIVPDVVHVLAAGRIVETGGKDLALQLEA 248

Query: 241 NGYAE 245
            GYA+
Sbjct: 249 TGYAQ 253


>gi|158425238|ref|YP_001526530.1| FeS assembly ATPase [Azorhizobium caulinodans ORS 571]
 gi|158332127|dbj|BAF89612.1| FeS assembly ATPase [Azorhizobium caulinodans ORS 571]
          Length = 251

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 148/244 (60%), Positives = 188/244 (77%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL A I   + EI++GL+LKV   EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 3   LLEINNLHASI--NEKEILKGLDLKVNAGEVHAIMGPNGSGKSTLSYVLSGKPDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             +  G  +L+    ERA+ G+FLAFQYPVE+PG+  M FL+ ALN QRKAR E EL  P
Sbjct: 61  SAVLDGVDLLELGADERAAAGLFLAFQYPVEVPGVATMTFLRTALNAQRKARGEDELSTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R V++    LGI+ +ML+R +N+GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 121 DFLRIVKEKAGFLGISQEMLRRGVNVGFSGGEKKRNEILQMALLEPKVAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS+DR+ ++ITHYQRLL++I PD +HV+H G+I+++G   +AL+LE 
Sbjct: 181 DALKIVSEGVNALRSKDRAMVVITHYQRLLDHIVPDVVHVMHKGRIVRSGGKELALELEA 240

Query: 241 NGYA 244
           +GYA
Sbjct: 241 SGYA 244


>gi|154244043|ref|YP_001415001.1| FeS assembly ATPase SufC [Xanthobacter autotrophicus Py2]
 gi|154158128|gb|ABS65344.1| FeS assembly ATPase SufC [Xanthobacter autotrophicus Py2]
          Length = 253

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 189/249 (75%), Gaps = 1/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L A+I     +II G+NL + P EV AIMGPNG+GKSTLSY+LSG   Y+ITAG
Sbjct: 4   LLEIKDLHAEI-SGGRKIIDGMNLTINPGEVHAIMGPNGAGKSTLSYVLSGKPGYDITAG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G ++L+ S  ERA++G+FL FQYP+EIPG+  M FL  A+N QR+ R E EL  P
Sbjct: 63  EVIFRGVNLLELSPDERAAQGLFLCFQYPLEIPGVSNMAFLHTAVNSQRRKRGETELTSP 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  RKVR++   LGIN +MLKRP+N+GFSGGEKK  E LQM LLEP LC+LDE DSGLDI
Sbjct: 123 ELVRKVRELGQTLGINAEMLKRPVNVGFSGGEKKRNETLQMALLEPYLCVLDEADSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALRS +RS L+ITHYQRLL+YI PD +HV   G+I+ TG   +AL+LE 
Sbjct: 183 DALKVVSNGVNALRSPERSMLVITHYQRLLDYIVPDVVHVFAAGRIVHTGGKELALELEA 242

Query: 241 NGYAELIKE 249
            GYA+   E
Sbjct: 243 TGYAQYQNE 251


>gi|83942224|ref|ZP_00954685.1| FeS assembly ATPase SufC [Sulfitobacter sp. EE-36]
 gi|83955459|ref|ZP_00964090.1| FeS assembly ATPase SufC [Sulfitobacter sp. NAS-14.1]
 gi|83840103|gb|EAP79278.1| FeS assembly ATPase SufC [Sulfitobacter sp. NAS-14.1]
 gi|83846317|gb|EAP84193.1| FeS assembly ATPase SufC [Sulfitobacter sp. EE-36]
          Length = 251

 Score =  305 bits (781), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L+ K+ + D +I++G++L+VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLSIKGLKVKLEEEDKQILKGVDLEVEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                   +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SAHLGDIDLLDLEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR    EL I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVVRARAKELKIDADMLKRPVNMGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A GVNALR++ R FL+ITHYQRLL++IKPD +H++ +G+IIKTG   +AL++E 
Sbjct: 181 DAMKLVADGVNALRTEGRGFLVITHYQRLLDHIKPDVVHIMADGRIIKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILSE 249


>gi|149202626|ref|ZP_01879598.1| FeS assembly ATPase SufC [Roseovarius sp. TM1035]
 gi|149143908|gb|EDM31942.1| FeS assembly ATPase SufC [Roseovarius sp. TM1035]
          Length = 251

 Score =  305 bits (781), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 144/249 (57%), Positives = 189/249 (75%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI NL   + + D  I++G+NL VE   V AIMGPNGSGKSTLSY+LSG   Y++T G
Sbjct: 1   MLEINNLHVDLEEEDKTILKGVNLSVEAGTVHAIMGPNGSGKSTLSYVLSGRDGYKVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SATLAGVDLLDMDPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR+    L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVVREKAKTLQIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ + GVNALR   R+FL+ITHYQRLL++IKPD +H++++G+IIKTG   +AL++E+
Sbjct: 181 DAMKLVSDGVNALRDAGRAFLVITHYQRLLDHIKPDVVHIMYDGRIIKTGGPELALEVEQ 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILAE 249


>gi|146342291|ref|YP_001207339.1| Fe-S cluster assembly ABC transporter ATP binding protein
           [Bradyrhizobium sp. ORS278]
 gi|146195097|emb|CAL79122.1| ABC transporter associated with Fe-S cluster assembly, ATP binding
           protein [Bradyrhizobium sp. ORS278]
          Length = 253

 Score =  305 bits (781), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 187/249 (75%), Gaps = 1/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK L A+I     +II+GL+L V   E+ AIMGPNG+GKSTLSY+L+G   YEITAG
Sbjct: 4   LLEIKGLHAEI-SGGRKIIQGLDLTVNKGEIHAIMGPNGAGKSTLSYVLAGKPGYEITAG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++   GE +L  S  ERA+KG+FLAFQYP+EIPG+  + FL+ A N QRKAR E+EL  P
Sbjct: 63  EVYLNGEDLLAMSADERAAKGVFLAFQYPLEIPGVATLTFLRAAFNAQRKARGEEELSSP 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  ++VR+I   L I+ +MLKRPLN+GFSGGEKK  E LQM LL+PSLC+LDETDSGLDI
Sbjct: 123 DLIKRVREIAKTLNIDSEMLKRPLNVGFSGGEKKRNETLQMALLQPSLCVLDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVNALRS +R  ++ITHYQRLL+YI PD +HV   G+I++TG   +A +LE 
Sbjct: 183 DALKVVANGVNALRSAERGMIVITHYQRLLDYIVPDIVHVFAAGRIVRTGAADLARELEA 242

Query: 241 NGYAELIKE 249
            GYA+   E
Sbjct: 243 TGYAQYQSE 251


>gi|259415792|ref|ZP_05739712.1| FeS assembly ATPase SufC [Silicibacter sp. TrichCH4B]
 gi|259347231|gb|EEW59008.1| FeS assembly ATPase SufC [Silicibacter sp. TrichCH4B]
          Length = 251

 Score =  305 bits (780), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 149/249 (59%), Positives = 193/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D +I++G+NL VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEDKQILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLSGKDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+EL   
Sbjct: 61  SASLLGEELLELEPEERAALGVFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEELSAT 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+   EL I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKHVREKAKELKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A GVNALR + R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVADGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMADGRIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILSE 249


>gi|146278395|ref|YP_001168554.1| FeS assembly ATPase SufC [Rhodobacter sphaeroides ATCC 17025]
 gi|145556636|gb|ABP71249.1| FeS assembly ATPase SufC [Rhodobacter sphaeroides ATCC 17025]
          Length = 252

 Score =  304 bits (779), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 143/247 (57%), Positives = 189/247 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D  I++G+NL VE  +V AIMGPNGSGKSTLSY+L+G   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEDKVILKGVNLTVEAGKVHAIMGPNGSGKSTLSYVLAGRDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+     RA+ G+FLAFQYPVEIPG+  M F++ ALN QRK R E+E+   
Sbjct: 61  SATLDGEELLEMEPEVRAAAGLFLAFQYPVEIPGVGNMTFMRTALNAQRKVRGEEEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ DM+KRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKLVREKAKALKIDADMMKRPVNVGFSGGEKKRNEILQMAVLEPRMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNALR   R FL+ITHYQRLL++I+PD +H++ NG+I+KTG   +AL++E+
Sbjct: 181 DALKLVSEGVNALRDAGRGFLVITHYQRLLDHIQPDVVHIMANGRIVKTGGPELALEVEK 240

Query: 241 NGYAELI 247
           NGYA+++
Sbjct: 241 NGYADIL 247


>gi|312115587|ref|YP_004013183.1| FeS assembly ATPase SufC [Rhodomicrobium vannielii ATCC 17100]
 gi|311220716|gb|ADP72084.1| FeS assembly ATPase SufC [Rhodomicrobium vannielii ATCC 17100]
          Length = 249

 Score =  304 bits (779), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 143/244 (58%), Positives = 186/244 (76%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+LRA++     EI++G NL V   EV AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKDLRAEV--DGKEILKGFNLTVPKGEVHAIMGPNGSGKSTLSYVLSGKDGYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G+ +   S  ERA  G+FLAFQYP+EIPG+  + FL+ A+N  RKAR E E+ IP
Sbjct: 59  SATWNGQDLFAMSPEERAQAGVFLAFQYPMEIPGVASLTFLRAAMNAHRKARGEAEISIP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R V+    +L I+M+MLKRPLN+GFSGGEKK  E+LQM LL+P+LC+LDE DSGLDI
Sbjct: 119 DFMRAVKTEAEKLSISMEMLKRPLNVGFSGGEKKRNEVLQMALLKPTLCLLDEMDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++IAA+GVN LRS D + ++ITHYQRLLNYI PD +HV+  G+++++G   +A++LEE
Sbjct: 179 DAIRIAAEGVNRLRSPDTAMIVITHYQRLLNYITPDVVHVMARGQVLRSGGKELAVELEE 238

Query: 241 NGYA 244
           +GYA
Sbjct: 239 SGYA 242


>gi|84686883|ref|ZP_01014767.1| FeS assembly ATPase SufC [Maritimibacter alkaliphilus HTCC2654]
 gi|84665080|gb|EAQ11560.1| FeS assembly ATPase SufC [Rhodobacterales bacterium HTCC2654]
          Length = 250

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 192/248 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL  K+ + D +I++GL+L+V   EV AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLKIENLHVKLEEEDKQILKGLSLEVPAGEVHAIMGPNGSGKSTLSYVLSGKDGYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G  +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  TATLEGNDLLDLEAEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R    +L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVIRAKAKDLKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ + GVNALR  +R+FL+ITHYQRLL++I PD +H++  GKI+K+G   +AL++E+
Sbjct: 181 DAMKLVSDGVNALRDPNRAFLVITHYQRLLDHIVPDVVHIMAGGKIVKSGGPELALEVEK 240

Query: 241 NGYAELIK 248
           NGYA+L++
Sbjct: 241 NGYADLME 248


>gi|83952076|ref|ZP_00960808.1| FeS assembly ATPase SufC [Roseovarius nubinhibens ISM]
 gi|83837082|gb|EAP76379.1| FeS assembly ATPase SufC [Roseovarius nubinhibens ISM]
          Length = 251

 Score =  302 bits (774), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 191/249 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL   + + D  I++G++L VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 1   MLEIKNLHVDLEEEDKSILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRKAR E+E+   
Sbjct: 61  SATLDGEDLLELEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKVVREKAKSLKIDADMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A+GVNALR + R FL+ITHYQRLL++IKPD +H++ +G+I+KTG   +AL++E 
Sbjct: 181 DAMKLVAEGVNALRDEGRGFLVITHYQRLLDHIKPDVVHIMADGRIVKTGGPELALEVEN 240

Query: 241 NGYAELIKE 249
           NGYA +++E
Sbjct: 241 NGYAGILEE 249


>gi|89054850|ref|YP_510301.1| FeS assembly ATPase SufC [Jannaschia sp. CCS1]
 gi|88864399|gb|ABD55276.1| FeS assembly ATPase SufC [Jannaschia sp. CCS1]
          Length = 251

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 193/249 (77%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IK L  K+ + D +I++G++L V+  +V AIMGPNGSGKSTLSY+LSG   YE+TAG
Sbjct: 1   MLDIKGLAVKLEEEDKQILKGVDLSVDAGKVHAIMGPNGSGKSTLSYVLSGKGGYEVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +    GE +LD    ERA+ G+FLAFQYPVEIPG+  M FL+ A+N QRK R E+E+   
Sbjct: 61  EATLDGEDLLDMDPEERAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKLRGEEEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R    +L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVIRAKAKDLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ ++GVNALR   R FL+ITHYQRLL++I+PD +H++ +G+I+KTG   +AL++E+
Sbjct: 181 DAMKLVSEGVNALRDAGRGFLVITHYQRLLDHIQPDVVHIMADGRIVKTGGPELALEVEK 240

Query: 241 NGYAELIKE 249
           NGYA+++ E
Sbjct: 241 NGYADILSE 249


>gi|148257192|ref|YP_001241777.1| ABC transporter associated with Fe-S cluster assembly, ATP binding
           protein [Bradyrhizobium sp. BTAi1]
 gi|146409365|gb|ABQ37871.1| ABC transporter associated with Fe-S cluster assembly, ATP binding
           protein [Bradyrhizobium sp. BTAi1]
          Length = 253

 Score =  301 bits (772), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 185/249 (74%), Gaps = 1/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK L A+I     +II+GL+L V   E+ AIMGPNG+GKSTLSY+L+G   YEITAG
Sbjct: 4   LLEIKGLHAEIAG-GRKIIQGLDLTVNKGEIHAIMGPNGAGKSTLSYVLAGKPGYEITAG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++   GE +L     ERA+KG+FLAFQYP+EIPG+  + FL+ A N QRKAR E+EL  P
Sbjct: 63  EVYLNGEDLLAMEANERAAKGVFLAFQYPLEIPGVATLTFLRAAFNAQRKARGEEELSSP 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  ++VR+I   L I+ +MLKRPLN+GFSGGEKK  E LQM LL+PSLC+LDETDSGLDI
Sbjct: 123 DLIKRVREIAKTLNIDAEMLKRPLNVGFSGGEKKRNETLQMALLQPSLCVLDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVNALRS +R  ++ITHYQRLL+YI PD +HV   G+I++TG   +A +LE 
Sbjct: 183 DALKVVANGVNALRSGERGMIVITHYQRLLDYIVPDIVHVFAAGRIVRTGGADLARELEA 242

Query: 241 NGYAELIKE 249
            GY +   E
Sbjct: 243 TGYGQYQSE 251


>gi|182677101|ref|YP_001831247.1| FeS assembly ATPase SufC [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182632984|gb|ACB93758.1| FeS assembly ATPase SufC [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 251

 Score =  299 bits (765), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL   I   D +I+    + V+  EV AIMGPNG+GKSTLSY++SG   Y + +G
Sbjct: 1   MLEVKNLNVSI--GDRKILNDFCITVKDGEVAAIMGPNGTGKSTLSYVMSGRPGYTVESG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L  G ++LD+   ERA+KG+FLAFQYP+EIPG+  M FLK ALN QRK R E EL  P
Sbjct: 59  EVLLNGVNLLDFEPNERAAKGLFLAFQYPLEIPGVATMTFLKAALNAQRKYRGETELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  ++V    ++LGI  DM+KR LN+GFSGGEKK  +ILQM LLEPS  ILDETDSGLDI
Sbjct: 119 ELMKRVNAAASKLGIKSDMMKRALNVGFSGGEKKRMDILQMALLEPSFGILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALRS  R FL+ITHYQRLL+YI PDT+HV+  G+I++TG   +AL+LE+
Sbjct: 179 DALRIVSEGVNALRSPTRGFLVITHYQRLLDYIVPDTVHVMAGGRIVRTGGKELALELEK 238

Query: 241 NGYAELIKE 249
           +GYAE + E
Sbjct: 239 SGYAEYLGE 247


>gi|89068820|ref|ZP_01156203.1| Suf C, ATPase [Oceanicola granulosus HTCC2516]
 gi|89045590|gb|EAR51653.1| Suf C, ATPase [Oceanicola granulosus HTCC2516]
          Length = 252

 Score =  298 bits (764), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 188/249 (75%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+IK L  K+ + D +I++G++L+VE  +V AIMGPNGSGKSTLSY+LSG   YE+T G
Sbjct: 2   LLDIKGLEVKLEEEDKQILKGVDLEVEAGKVHAIMGPNGSGKSTLSYVLSGRDGYEVTGG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +L+    ERA+ G+FLAFQYPVEIPG+  M FL+ +LN Q+KAR E E+   
Sbjct: 62  SARLDGVDLLELEPEERAAAGLFLAFQYPVEIPGVGNMTFLRTSLNAQKKARGEPEVSSA 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ DMLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 122 DFLKLVREKAKSLQIDPDMLKRPVNMGFSGGEKKRNEILQMAILEPRMCILDETDSGLDV 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ + GVNALR   R FL+ITHYQRLLN+I PD +H++ +G+I+KTG   +AL++EE
Sbjct: 182 DAMKLVSDGVNALRDAGRGFLVITHYQRLLNHITPDVVHIMSDGRIVKTGGPELALEVEE 241

Query: 241 NGYAELIKE 249
           NGY +++ E
Sbjct: 242 NGYGDILGE 250


>gi|77464008|ref|YP_353512.1| SUF C, ATPase [Rhodobacter sphaeroides 2.4.1]
 gi|332558882|ref|ZP_08413204.1| SUF C, ATPase [Rhodobacter sphaeroides WS8N]
 gi|77388426|gb|ABA79611.1| Suf C, ATPase [Rhodobacter sphaeroides 2.4.1]
 gi|332276594|gb|EGJ21909.1| SUF C, ATPase [Rhodobacter sphaeroides WS8N]
          Length = 252

 Score =  297 bits (761), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 143/247 (57%), Positives = 190/247 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D  I++G++L VE  +V AIMGPNGSGKSTLSY+L+G   YE+T G
Sbjct: 1   MLEIKNLHVKLEEEDKVILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLAGRDGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M F++ ALN QRKAR ++E+   
Sbjct: 61  SATLDGEELLEMEPEERAAAGLFLAFQYPVEIPGVGNMTFMRTALNAQRKARGQEEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ DM+KRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKLVREKAKALKIDADMMKRPVNVGFSGGEKKRNEILQMAILEPRMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALR   R FL+ITHYQRLL++I+PD +H++ NG+I+KTG   +AL++E+
Sbjct: 181 DALKLVSDGVNALRDAGRGFLVITHYQRLLDHIRPDVVHIMANGRIVKTGGPELALEVEK 240

Query: 241 NGYAELI 247
           NGYA+++
Sbjct: 241 NGYADIL 247


>gi|154253699|ref|YP_001414523.1| FeS assembly ATPase SufC [Parvibaculum lavamentivorans DS-1]
 gi|154157649|gb|ABS64866.1| FeS assembly ATPase SufC [Parvibaculum lavamentivorans DS-1]
          Length = 249

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/241 (60%), Positives = 183/241 (75%), Gaps = 2/241 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+     EI++G++L V   EV AIMGPNGSGKSTLSY+L+G   YE+T G
Sbjct: 1   MLEIKNLHVKV--DGKEILKGIDLNVPAGEVHAIMGPNGSGKSTLSYVLAGRDGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +KG  +L+ S+ ERA+ GIFLAFQYP+EIPG+  M FLK ALN QRKAR E EL   
Sbjct: 59  SIRFKGRDLLEMSVDERAAAGIFLAFQYPLEIPGVTTMTFLKTALNAQRKARGEDELDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+    L ++ DMLKR LN+G+SGGEKK AEILQM LLEP+L +LDETDSGLDI
Sbjct: 119 RFLKLVREKAKPLNVSDDMLKRALNVGYSGGEKKRAEILQMSLLEPALAVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVN+LR+ DR+ ++ITHYQRLL+YI PD +HVL  G+I+KTG   +AL+LE+
Sbjct: 179 DALKTVADGVNSLRASDRAMVVITHYQRLLDYIVPDVVHVLSKGRIVKTGGKDLALELEK 238

Query: 241 N 241
           +
Sbjct: 239 S 239


>gi|221639870|ref|YP_002526132.1| FeS assembly ATPase SufC [Rhodobacter sphaeroides KD131]
 gi|221160651|gb|ACM01631.1| FeS assembly ATPase SufC [Rhodobacter sphaeroides KD131]
          Length = 252

 Score =  295 bits (756), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 189/247 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D  I++G++L VE  +V AIMGPNGSGKSTLSY+L+G   Y +T G
Sbjct: 1   MLEIKNLHVKLEEEDKVILKGVDLTVEAGKVHAIMGPNGSGKSTLSYVLAGRDGYAVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M F++ ALN QRKAR ++E+   
Sbjct: 61  SATLDGEELLEMEPEERAAAGLFLAFQYPVEIPGVGNMTFMRTALNAQRKARGQEEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ DM+KRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKLVREKAKALKIDADMMKRPVNVGFSGGEKKRNEILQMAILEPRMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALR   R FL+ITHYQRLL++I+PD +H++ NG+I+KTG   +AL++E+
Sbjct: 181 DALKLVSDGVNALRDAGRGFLVITHYQRLLDHIRPDVVHIMANGRIVKTGGPELALEVEK 240

Query: 241 NGYAELI 247
           NGYA+++
Sbjct: 241 NGYADIL 247


>gi|260772563|ref|ZP_05881479.1| iron-sulfur cluster assembly ATPase protein SufC [Vibrio
           metschnikovii CIP 69.14]
 gi|260611702|gb|EEX36905.1| iron-sulfur cluster assembly ATPase protein SufC [Vibrio
           metschnikovii CIP 69.14]
          Length = 253

 Score =  295 bits (755), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 190/246 (77%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A++   D  II+GLNL ++P EV AIMGPNG+GKSTL Y+LSG   YE+T G
Sbjct: 1   MLNIKNLHARVEQKD--IIKGLNLDIKPGEVHAIMGPNGAGKSTLGYVLSGRDGYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           + +  G+S+LD  + ERA  G+FLAFQYPVEIPG+  ++F+K ++N  R  R ++ L   
Sbjct: 59  EAMLHGQSLLDMDVEERARHGLFLAFQYPVEIPGVSNLEFMKESVNAMRAHRGQEPLTAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +K ++ + ++ + +D LKR +N GFSGGEKK  EI+QM LLEPSLCILDE+DSGLD+
Sbjct: 119 EFLKKAKEASKQVQLPLDFLKRGVNEGFSGGEKKRNEIMQMILLEPSLCILDESDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+ RS+DRSF++ITHYQRLL+YI+PD +H+L NG+I+K+GD S+A ++E+
Sbjct: 179 DALQVVANGVNSQRSKDRSFVVITHYQRLLDYIEPDFVHILANGQIVKSGDASLAREIEQ 238

Query: 241 NGYAEL 246
            GYA L
Sbjct: 239 QGYAFL 244


>gi|260574653|ref|ZP_05842656.1| FeS assembly ATPase SufC [Rhodobacter sp. SW2]
 gi|259023070|gb|EEW26363.1| FeS assembly ATPase SufC [Rhodobacter sp. SW2]
          Length = 251

 Score =  295 bits (754), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 186/249 (74%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL  K+ + D  I++GL L V   EV AIMGPNGSGKSTLSY+LSG   Y +TAG
Sbjct: 1   MLKINNLHVKLEEEDKVILKGLTLHVPAGEVHAIMGPNGSGKSTLSYVLSGKGGYTVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G  +L+     RA+ G+FLAFQYPVEIPG+  M FL+ A+N QRK R E E+   
Sbjct: 61  SATLEGADLLEMEPEHRAAAGLFLAFQYPVEIPGVGNMTFLRTAVNAQRKTRGEPEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR     L I+ +M+KRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 EFLKVVRDKAKTLKIDAEMMKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ + GVNALR+  RSFL+ITHYQRLL++IKPD +H++ +G+II+TG   +AL++E+
Sbjct: 181 DAMKLVSDGVNALRAPGRSFLVITHYQRLLDHIKPDVVHIMADGRIIRTGGPELALEVEQ 240

Query: 241 NGYAELIKE 249
           NGYA+++ +
Sbjct: 241 NGYADILAQ 249


>gi|315499750|ref|YP_004088553.1| fes assembly atpase sufc [Asticcacaulis excentricus CB 48]
 gi|315417762|gb|ADU14402.1| FeS assembly ATPase SufC [Asticcacaulis excentricus CB 48]
          Length = 249

 Score =  294 bits (753), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL   +   D  I++GLNL V   EV AIMGPNG+GKSTL Y L+G  +YE+T G
Sbjct: 1   MLNIENLTVSV--DDKTILKGLNLSVPAGEVHAIMGPNGAGKSTLGYTLAGRPNYEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + GE +L+  + ERA+ G+FL+FQYP+EIPG+  M F++ ALN QRK R+E+E+  P
Sbjct: 59  AVDFNGEDLLEKDVHERAAAGLFLSFQYPLEIPGVPAMTFIRTALNAQRKLRDEEEMSAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R++   L I+MDMLKRPLN+GFSGGEKK  E+LQM LL+P   ILDETDSGLDI
Sbjct: 119 EFLKTIREVAKALKIDMDMLKRPLNVGFSGGEKKRMEVLQMALLQPKFLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALRS DR  L+ITHYQRLL++I+PD IH+L +G+I+ +G   +AL+LE 
Sbjct: 179 DALKVVSDGVNALRSSDRGMLVITHYQRLLDHIRPDRIHILVDGRIVHSGGPELALELEA 238

Query: 241 NGYAELIKE 249
           +GY   + E
Sbjct: 239 HGYDRYVNE 247


>gi|197105182|ref|YP_002130559.1| ABC-type transport system involved in Fe-S cluster assembly, ATPase
           component [Phenylobacterium zucineum HLK1]
 gi|196478602|gb|ACG78130.1| ABC-type transport system involved in Fe-S cluster assembly, ATPase
           component [Phenylobacterium zucineum HLK1]
          Length = 248

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +KNL A +   D EI++GL+L+V   EV AIMGPNG+GKSTLSY+L+G + YE+TAG
Sbjct: 1   MLSVKNLHAAV--EDKEILKGLSLEVPAGEVHAIMGPNGAGKSTLSYVLTGREGYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L     ERA+KG+FL+FQYP+EIPG+  + F++ ALN QRKAR E E+  P
Sbjct: 59  SATLDGEDLLALEPNERAAKGVFLSFQYPLEIPGVPALTFIRTALNAQRKARGEDEISAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R   AEL I+ DM+KR LN+GFSGGEKK  EILQM +L P   ILDETDSGLDI
Sbjct: 119 EFLKLARTKAAELKIDFDMMKRALNVGFSGGEKKRMEILQMAMLSPRFLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVNA+R  DR+ L+ITHYQRLL+YIKPD +HVL  G+I+ +G   +AL+LE 
Sbjct: 179 DALRIVADGVNAMRGPDRAMLVITHYQRLLDYIKPDRVHVLSAGRIVASGGPELALELER 238

Query: 241 NGY 243
            GY
Sbjct: 239 EGY 241


>gi|126462853|ref|YP_001043967.1| FeS assembly ATPase SufC [Rhodobacter sphaeroides ATCC 17029]
 gi|126104517|gb|ABN77195.1| FeS assembly ATPase SufC [Rhodobacter sphaeroides ATCC 17029]
          Length = 252

 Score =  291 bits (745), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 188/247 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL  K+ + D  I++G++L VE  +V AIMG NGSGKSTLSY+L+G   Y +T G
Sbjct: 1   MLEIKNLHVKLEEEDKVILKGVDLTVEAGKVHAIMGLNGSGKSTLSYVLAGRDGYAVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L+    ERA+ G+FLAFQYPVEIPG+  M F++ ALN QRKAR ++E+   
Sbjct: 61  SATLDGEELLEMEPEERAAAGLFLAFQYPVEIPGVGNMTFMRTALNAQRKARGQEEMSAG 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    L I+ DM+KRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 121 DFLKLVREKAKALKIDADMMKRPVNVGFSGGEKKRNEILQMAILEPRMCILDETDSGLDV 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALR   R FL+ITHYQRLL++I+PD +H++ NG+I+KTG   +AL++E+
Sbjct: 181 DALKLVSDGVNALRDAGRGFLVITHYQRLLDHIRPDVVHIMANGRIVKTGGPELALEVEK 240

Query: 241 NGYAELI 247
           NGYA+++
Sbjct: 241 NGYADIL 247


>gi|90021062|ref|YP_526889.1| Iron-regulated ABC transporter ATPase subunit SufC [Saccharophagus
           degradans 2-40]
 gi|89950662|gb|ABD80677.1| Iron-regulated ABC transporter ATPase subunit SufC [Saccharophagus
           degradans 2-40]
          Length = 249

 Score =  291 bits (744), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 189/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A++ + D  I++GLNL+++P EV AIMGPNG+GKSTL  +LSG + YE+T G
Sbjct: 1   MLSIKNLHARVEEKD--ILKGLNLEIKPGEVHAIMGPNGAGKSTLGNVLSGREGYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G+++LDW   ERA +G+FLAFQYPVEIPG+  M+FLK +++  R  +        
Sbjct: 59  EVLFDGKNLLDWETEERAREGLFLAFQYPVEIPGVSNMEFLKASVDAVRAHQGLPAYDSV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++ R    E+ +  + LKR +N GFSGGEKK  E++QM LL+P LCILDETDSGLDI
Sbjct: 119 SFLKEARARCQEVDLKQEFLKRGVNEGFSGGEKKRNELMQMMLLQPKLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVNALRS DRSF+++THYQRLL+YI+PD +HVL +GKI+K+GD S+AL+LEE
Sbjct: 179 DALQVVAKGVNALRSPDRSFIVVTHYQRLLDYIEPDFVHVLADGKIVKSGDKSLALELEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 KGYGWLENE 247


>gi|329850526|ref|ZP_08265371.1| feS assembly ATPase SufC [Asticcacaulis biprosthecum C19]
 gi|328840841|gb|EGF90412.1| feS assembly ATPase SufC [Asticcacaulis biprosthecum C19]
          Length = 251

 Score =  291 bits (744), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 182/246 (73%), Gaps = 2/246 (0%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L I NL    VDT T I++GL+L V   EV AIMGPNG+GKSTL Y L+G  +Y +T G 
Sbjct: 4   LSISNLTVS-VDTKT-ILKGLSLTVPNGEVHAIMGPNGAGKSTLGYALAGRPNYAVTGGT 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
             + GE +LD  + ERA+ G++L+FQYP+EIPG+  + FL+ ALN Q+K R E E+  PD
Sbjct: 62  ATFNGEDLLDKDVHERAAAGLYLSFQYPLEIPGVPALTFLRTALNAQKKLRGEDEVSAPD 121

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R+VR++   L I+MDMLKRPLN+GFSGGEKK  E+LQM +LEP   ILDETDSGLDID
Sbjct: 122 FLRRVREVAKSLKIDMDMLKRPLNVGFSGGEKKRMEVLQMAMLEPKFLILDETDSGLDID 181

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ + GVNALRS +R  L+ITHYQRLL++IKPD +HVL  G+I+K+G   +AL+LE  
Sbjct: 182 ALKVVSDGVNALRSPERGMLVITHYQRLLDHIKPDQVHVLVAGRIVKSGGPELALELEAR 241

Query: 242 GYAELI 247
           GY E +
Sbjct: 242 GYDEYL 247


>gi|254293808|ref|YP_003059831.1| FeS assembly ATPase SufC [Hirschia baltica ATCC 49814]
 gi|254042339|gb|ACT59134.1| FeS assembly ATPase SufC [Hirschia baltica ATCC 49814]
          Length = 255

 Score =  290 bits (743), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 186/252 (73%), Gaps = 3/252 (1%)

Query: 1   MLEIKNLRAKIVDTD---TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           ML +  L A++   D    EII+GL+L V   EV AIMGPNG+GKSTLSY+L+G   YE 
Sbjct: 1   MLALNELVARVEKEDGEGKEIIKGLSLNVPAGEVHAIMGPNGAGKSTLSYVLTGRDGYEA 60

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T+G     GE++L+    ERA+KG++L+FQYP+EIPG+ +M F++ A+N QRK R E+E+
Sbjct: 61  TSGTAELNGENLLEMDPEERAAKGLYLSFQYPLEIPGVPVMTFVRTAMNAQRKMRGEEEI 120

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
             PDF RK R+I   L I+ DMLKRPLN+GFSGGEKK  EI Q  +LEP   ILDETDSG
Sbjct: 121 SAPDFLRKAREIAKVLKIDADMLKRPLNVGFSGGEKKRLEIFQAMMLEPKFLILDETDSG 180

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL++ ++GVNALR+ DR  L+ITHYQRLL++IKPD +HVL +GKIIKTG   +AL 
Sbjct: 181 LDIDALRVVSEGVNALRAPDRGMLVITHYQRLLDHIKPDKVHVLADGKIIKTGGPELALR 240

Query: 238 LEENGYAELIKE 249
           LE+ GY  ++ E
Sbjct: 241 LEDEGYDGVLAE 252


>gi|332992279|gb|AEF02334.1| Cysteine desulfurase activator ATPase [Alteromonas sp. SN2]
          Length = 253

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 190/248 (76%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A + + +  II+GLNL+V+P EV AIMGPNG+GKSTL Y+LSG   YE++ G
Sbjct: 1   MLSIKNLHASVEEKN--IIKGLNLEVKPGEVHAIMGPNGAGKSTLGYVLSGRDGYEVSEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++   G+ +LD  + ERA +G+FLAFQYPVEIPG+  M+F+K ++N  R+ R E  L   
Sbjct: 59  EVTLNGKDLLDLEVEERAREGLFLAFQYPVEIPGVSNMEFMKESVNAMREQRGEDPLTAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +K ++   ++ + +D LKR +N GFSGGEKK  EI+QM LLEP LCILDE+DSGLD+
Sbjct: 119 EFLKKAKEACKQVQLPLDFLKRGVNEGFSGGEKKRNEIMQMILLEPKLCILDESDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+ R  +RSF+++THYQRLL+YIKPD +H+L +GKI+K+GD S+AL++E+
Sbjct: 179 DALQVVADGVNSQRDGERSFIVVTHYQRLLDYIKPDFVHILADGKIVKSGDASLALEVEK 238

Query: 241 NGYAELIK 248
           +GYA L K
Sbjct: 239 SGYAFLGK 246


>gi|269926804|ref|YP_003323427.1| FeS assembly ATPase SufC [Thermobaculum terrenum ATCC BAA-798]
 gi|269790464|gb|ACZ42605.1| FeS assembly ATPase SufC [Thermobaculum terrenum ATCC BAA-798]
          Length = 257

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 140/243 (57%), Positives = 186/243 (76%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IK+L  K+ + D EIIRGL+L++E  +V AIMGPNGSGKSTLSY L+GH +YE+T G
Sbjct: 4   VLVIKDLHVKLAEEDKEIIRGLDLELEKGKVHAIMGPNGSGKSTLSYTLAGHPNYEVTEG 63

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL++GESIL+    ERA +GIFLAFQYP+ IPG+ M  FL+ A+N  R+AR E  + +P
Sbjct: 64  DILFEGESILELEPDERAQRGIFLAFQYPMAIPGVTMANFLRSAVNAVRQARGEAPMPVP 123

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +K+ +  A L ++     R +N GFSGGEKK AEILQM +LEP L I+DETDSGLDI
Sbjct: 124 EFRKKLNEKMAMLKMDRSFASRYINDGFSGGEKKRAEILQMAMLEPKLAIMDETDSGLDI 183

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+++D + L+ITHYQR+LNYIKPD +HVL +G+I+ +G   +AL+LE+
Sbjct: 184 DALRIVADGVNTLKTKDMTVLLITHYQRILNYIKPDVVHVLVDGRIVTSGGPELALELED 243

Query: 241 NGY 243
            GY
Sbjct: 244 KGY 246


>gi|330814302|ref|YP_004358541.1| iron-sulfur cluster assembly protein SufB [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327487397|gb|AEA81802.1| iron-sulfur cluster assembly protein SufB [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 245

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 145/247 (58%), Positives = 186/247 (75%), Gaps = 3/247 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M+EI NL+A +   + EI++GLNL +   EV AIMGPNGSGKSTLSY LSG + Y ++ G
Sbjct: 1   MIEITNLKAGV--DEKEILKGLNLSIGKGEVHAIMGPNGSGKSTLSYALSGKEGYNVS-G 57

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I +  +++L+ +  ERA +G+FLA QYP EIPG+    FL+ +LN  RKA  + EL   
Sbjct: 58  EIKFNKKNLLELNTEERAQEGVFLALQYPTEIPGVFTKNFLRTSLNSIRKANGKSELNAI 117

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++ + EL I+ +ML RPLN+GFSGGEKK  EILQM LLEPS  I+DETDSGLDI
Sbjct: 118 EFLKILKEKSTELKIDDEMLARPLNVGFSGGEKKRNEILQMSLLEPSFIIMDETDSGLDI 177

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN LR  DRSFLIITHYQRLLNYIKPD +HVL +GKI+KTGD+ +ALDLE+
Sbjct: 178 DALKIVSNGVNTLRDPDRSFLIITHYQRLLNYIKPDFVHVLSDGKIVKTGDWKLALDLEK 237

Query: 241 NGYAELI 247
            GY + I
Sbjct: 238 EGYGQFI 244


>gi|192362310|ref|YP_001981955.1| FeS assembly ATPase SufC [Cellvibrio japonicus Ueda107]
 gi|190688475|gb|ACE86153.1| FeS assembly ATPase SufC [Cellvibrio japonicus Ueda107]
          Length = 254

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 183/246 (74%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I +L A++ + D  I++GLNL V P EV AIMGPNG+GKSTL  +LSG + YE+T G
Sbjct: 6   MLRITDLHARVEEKD--ILKGLNLTVNPGEVHAIMGPNGAGKSTLGNVLSGREGYEVTGG 63

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG  +    I ERA +G+FLAFQYPVEIPG+  M+FLK A++ +RK R E EL   
Sbjct: 64  SVEFKGRDLFALDIEERAREGLFLAFQYPVEIPGVSNMEFLKAAVDAKRKHRGEPELSAV 123

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R  + ++ ++   LKR +N GFSGGEKK  EILQM LLEP LCILDETDSGLDI
Sbjct: 124 EFMKLARDASKKVSLDQAFLKRGVNEGFSGGEKKRNEILQMMLLEPGLCILDETDSGLDI 183

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVNA+RS +RSF+++THYQRLL+YI PD +HVL NGKI+KTG   +AL+LEE
Sbjct: 184 DALQVVANGVNAMRSPERSFIVVTHYQRLLDYIVPDYVHVLANGKIVKTGGKELALELEE 243

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 244 KGYSWL 249


>gi|83593904|ref|YP_427656.1| FeS assembly ATPase SufC [Rhodospirillum rubrum ATCC 11170]
 gi|83576818|gb|ABC23369.1| FeS assembly ATPase SufC [Rhodospirillum rubrum ATCC 11170]
          Length = 273

 Score =  289 bits (739), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 189/255 (74%), Gaps = 8/255 (3%)

Query: 1   MLEIKNLRAKIVDTDT--------EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGH 52
           +LEIK+L A++ D  +        EI++GL+L + P EV AIMGPNG+GKSTLS +++G 
Sbjct: 15  LLEIKDLHARVEDEASGRGEGAYREILKGLSLTINPGEVHAIMGPNGAGKSTLSSVITGK 74

Query: 53  KDYEITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKAR 112
             YE+TAG ++Y+G  +      ERA +GIFLAFQYPVEIPG+    FLK A+N +RK  
Sbjct: 75  PGYEMTAGSLIYQGRDLCALEPHERACEGIFLAFQYPVEIPGVGFTTFLKTAINARRKYF 134

Query: 113 NEKELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILD 172
            ++++   DF + ++  T  LGI  DM+KRP+N+GFSGGEKK AEILQM +LEP+L ILD
Sbjct: 135 GQEDIDAMDFLKLMKSKTKLLGIADDMMKRPVNVGFSGGEKKRAEILQMAMLEPTLMILD 194

Query: 173 ETDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDY 232
           E DSGLDIDAL+IAAQGVN +RS DR+ L ITHYQRLL+YI PD +HVL +GKI+K+G  
Sbjct: 195 EMDSGLDIDALRIAAQGVNDMRSPDRAILCITHYQRLLDYIVPDFVHVLADGKIVKSGGK 254

Query: 233 SIALDLEENGYAELI 247
            +AL+LEE GYAE +
Sbjct: 255 DLALELEEKGYAEFV 269


>gi|325953987|ref|YP_004237647.1| FeS assembly ATPase SufC [Weeksella virosa DSM 16922]
 gi|323436605|gb|ADX67069.1| FeS assembly ATPase SufC [Weeksella virosa DSM 16922]
          Length = 253

 Score =  289 bits (739), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 188/249 (75%), Gaps = 1/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+IKNL AKI D+D EII+GLNL+++P EV AIMGPNG+GKSTLS +++G +DYE+TAG
Sbjct: 2   LLDIKNLHAKIADSDKEIIKGLNLQIKPGEVHAIMGPNGAGKSTLSSVIAGKEDYEVTAG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+  E IL+ +  ERA KGIF++FQYP+EIPG+ +  F+K ++NE RKA+  +E+   
Sbjct: 62  EILFNDEEILEMAPEERAHKGIFMSFQYPIEIPGVSVSNFIKTSINETRKAQGLEEMGAS 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+    L I  D L R LN GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 122 EMLKMIREKAELLNIKKDFLSRSLNEGFSGGEKKRNEIFQMLMLNPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVNA R++    L+ITHYQRLL+YI PD +HVL +GKIIK+G   +AL+LEE
Sbjct: 182 DALRIVADGVNAYRNEHNGVLLITHYQRLLDYIVPDFVHVLADGKIIKSGSKELALELEE 241

Query: 241 NGYAELIKE 249
            GY + +KE
Sbjct: 242 KGY-DWVKE 249


>gi|300774696|ref|ZP_07084559.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Chryseobacterium gleum ATCC 35910]
 gi|300506511|gb|EFK37646.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Chryseobacterium gleum ATCC 35910]
          Length = 247

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 145/247 (58%), Positives = 188/247 (76%), Gaps = 1/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL AKI D   EI++G+NL+++P EV AIMGPNG+GKSTLS +++G +DYE+T G
Sbjct: 1   MLEIKNLHAKIEDG-AEILKGINLEIKPGEVHAIMGPNGAGKSTLSSVIAGKEDYEVTGG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL++G+ I + +  +RA KGIFL+FQYPVEIPG+ +  F+K ALNE RKA   +E+   
Sbjct: 60  EILFEGQDISEDAPEDRAHKGIFLSFQYPVEIPGVSVTNFIKAALNETRKANGLEEMPAK 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +    +R+ + +LGI  D L R LN GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 120 EMLALIREKSEKLGIKKDFLSRSLNEGFSGGEKKRNEIFQMMMLNPKLAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN  +++  + L+ITHYQRLLNYI+PD +HVL +GKIIKTGD S+AL+LEE
Sbjct: 180 DALRIVADGVNYFKNEGNAVLLITHYQRLLNYIQPDFVHVLADGKIIKTGDKSLALELEE 239

Query: 241 NGYAELI 247
            GY  L+
Sbjct: 240 KGYDWLL 246


>gi|239994259|ref|ZP_04714783.1| Cysteine desulfurase activator ATPase [Alteromonas macleodii ATCC
           27126]
          Length = 253

 Score =  288 bits (736), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 190/248 (76%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A + + +  II+GLNL+V+P EV AIMGPNG+GKSTL Y+LSG + YE++ G
Sbjct: 1   MLSIKNLHASVEEKN--IIKGLNLEVKPGEVHAIMGPNGAGKSTLGYVLSGREGYEVSEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +    G+ +L+  + ERA +G+FLAFQYPVEIPG+  M+F+K ++N  R+ R E  L   
Sbjct: 59  EATLNGKDLLELEVEERAREGLFLAFQYPVEIPGVSNMEFMKESVNAMREQRGEAPLTAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +K ++   ++ + +D LKR +N GFSGGEKK  EI+QM LLEP LCILDE+DSGLD+
Sbjct: 119 EFLKKAKEACKQVQLPLDFLKRGVNEGFSGGEKKRNEIMQMILLEPKLCILDESDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+ R  +RSF+++THYQRLL+YIKPD +H+L +GKI+K+GD S+AL++E+
Sbjct: 179 DALQVVADGVNSQRDGERSFIVVTHYQRLLDYIKPDFVHILADGKIVKSGDASLALEVEK 238

Query: 241 NGYAELIK 248
           +GYA L K
Sbjct: 239 SGYAFLGK 246


>gi|254418776|ref|ZP_05032500.1| FeS assembly ATPase SufC [Brevundimonas sp. BAL3]
 gi|196184953|gb|EDX79929.1| FeS assembly ATPase SufC [Brevundimonas sp. BAL3]
          Length = 249

 Score =  288 bits (736), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL   +   D  I++GL L V   EV AIMGPNG+GKSTL Y LSG   YE T G
Sbjct: 1   MLSISNLHVSV--GDKPILKGLTLDVPAGEVHAIMGPNGAGKSTLGYALSGRPGYEATEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + GE +L     ERA+KG+FL+FQYP+EIPG+  + F++ ALN Q++AR E+E+  P
Sbjct: 59  AVEWAGEDLLALDPAERAAKGVFLSFQYPIEIPGVPALTFVRTALNAQKRARGEEEVAAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+ +  L ++ DMLKRPLN+GFSGGEKK  EILQM LLEPSL ILDETDSGLDI
Sbjct: 119 AFLKLVREASKALKMDFDMLKRPLNVGFSGGEKKRMEILQMALLEPSLLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALR  DR+ L+ITHYQRLL+YIKPD +HVL  G+I+ +G   +A  LE 
Sbjct: 179 DALRIVSEGVNALRRPDRAMLVITHYQRLLDYIKPDRVHVLAGGRIVASGGPELAHQLEA 238

Query: 241 NGYAELIKE 249
            GY + + E
Sbjct: 239 EGYDKYLPE 247


>gi|114797142|ref|YP_761305.1| FeS assembly ATPase SufC [Hyphomonas neptunium ATCC 15444]
 gi|114737316|gb|ABI75441.1| FeS assembly ATPase SufC [Hyphomonas neptunium ATCC 15444]
          Length = 253

 Score =  288 bits (736), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 140/251 (55%), Positives = 184/251 (73%), Gaps = 2/251 (0%)

Query: 1   MLEIKNLRAKIVDTDTE--IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEIT 58
           ML+I+NL A + + D    II GL+L+V   EV AIMGPNG+GKSTLSY+L+G + YE+T
Sbjct: 1   MLKIENLSATVGEPDAAKTIINGLSLEVPAGEVHAIMGPNGAGKSTLSYVLTGREGYEVT 60

Query: 59  AGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELL 118
            G     G+ IL     +RAS G+FL+FQYP+EIPG+ +M F++ A+N QRKAR E E+ 
Sbjct: 61  GGSATLDGQDILALDPEDRASAGLFLSFQYPIEIPGVPVMTFVRTAMNAQRKARGEPEIS 120

Query: 119 IPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGL 178
            PD+ +K R +   L ++ DMLKRP+N+GFSGGEKK  EI QM +LEP   +LDETDSGL
Sbjct: 121 APDYLKKSRDVAKMLNLDADMLKRPVNVGFSGGEKKRLEIYQMLMLEPRFMVLDETDSGL 180

Query: 179 DIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDL 238
           DIDAL+  A+GVNALR+ +R  L+ITHYQRLL+YIKPD +HVL  G+IIK+G   +AL L
Sbjct: 181 DIDALRTVAEGVNALRAPERGMLVITHYQRLLDYIKPDKVHVLAKGRIIKSGGPELALRL 240

Query: 239 EENGYAELIKE 249
           E+ GY  ++ E
Sbjct: 241 EKEGYDGVLAE 251


>gi|294677416|ref|YP_003578031.1| FeS assembly ATPase SufC [Rhodobacter capsulatus SB 1003]
 gi|294476236|gb|ADE85624.1| FeS assembly ATPase SufC [Rhodobacter capsulatus SB 1003]
          Length = 255

 Score =  288 bits (736), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 189/247 (76%), Gaps = 1/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI NL  K+ + +  I++G+NL VE  +V AIMGPNGSGKST+SY+L+G   Y +TAG
Sbjct: 1   MLEINNLHVKLEEGEKVILKGMNLTVETGKVHAIMGPNGSGKSTMSYVLAGRPGYTVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
               +G+ +LD     RA+ G+FLAFQYPVEIPG+  M FL+ ALN + +AR   EL   
Sbjct: 61  SAKLQGQELLDMEPEARAAAGLFLAFQYPVEIPGVGNMTFLRTALN-RTQARAIDELSAG 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR     L I+ +MLKRP+N+GFSGGEKK  EILQM +LEP +CILDETDSGLD+
Sbjct: 120 EFLKLVRDKAKSLKIDAEMLKRPVNVGFSGGEKKRNEILQMAMLEPKMCILDETDSGLDV 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+++ ++GVNALRS+ RSFL+ITHYQRLL++I+PD +H++ +G+I++TG   +AL++E+
Sbjct: 180 DAMRLVSEGVNALRSEGRSFLVITHYQRLLDHIQPDVVHIMADGRILQTGGPDLALEVEK 239

Query: 241 NGYAELI 247
           NGYAE++
Sbjct: 240 NGYAEIL 246


>gi|302383289|ref|YP_003819112.1| FeS assembly ATPase SufC [Brevundimonas subvibrioides ATCC 15264]
 gi|302193917|gb|ADL01489.1| FeS assembly ATPase SufC [Brevundimonas subvibrioides ATCC 15264]
          Length = 249

 Score =  287 bits (735), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL   +   D  I++GL L V   EV AIMGPNG+GKSTL Y LSG   YE T G
Sbjct: 1   MLKINNLHVSV--GDKPILKGLTLDVPAGEVHAIMGPNGAGKSTLGYALSGRPGYEATEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+     RA++G+FL+FQYP+EIPG+  + F++ ALN Q++AR E+E+  P
Sbjct: 59  AVSWNGQDLLELDPAARAAEGVFLSFQYPIEIPGVPALTFVRTALNAQKRARGEEEVSAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++V+  +A L ++ +MLKRPLN+GFSGGEKK  EILQM LLEPSL ILDETDSGLDI
Sbjct: 119 AFLKQVKAASAALKMDFEMLKRPLNVGFSGGEKKRMEILQMALLEPSLLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVNALRS DR+ L+ITHYQRLL+YIKPD +HVL  G+I+ +G   +AL LE 
Sbjct: 179 DALRIVSEGVNALRSPDRAMLVITHYQRLLDYIKPDRVHVLAAGRIVASGGPELALQLEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 EGY 241


>gi|329889573|ref|ZP_08267916.1| feS assembly ATPase SufC [Brevundimonas diminuta ATCC 11568]
 gi|328844874|gb|EGF94438.1| feS assembly ATPase SufC [Brevundimonas diminuta ATCC 11568]
          Length = 249

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL   +   D  I++GL L V   EV A+MGPNG+GKSTL Y LSG   YE+T G
Sbjct: 1   MLKINNLHVSV--ADKPILKGLTLDVPAGEVHAVMGPNGAGKSTLGYSLSGRPGYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G  +LD    ERA+ G+FL+FQYP+EIPG+  M F++ ALN Q++AR E+E+  P
Sbjct: 59  SASWNGVDLLDIEPAERAAAGLFLSFQYPIEIPGVPAMTFIRTALNAQKRARGEEEVSAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + V+  +  L ++ DMLKRPLN+GFSGGEKK  EILQM LLEPSL ILDETDSGLDI
Sbjct: 119 AFLKLVKAASQSLKMDFDMLKRPLNVGFSGGEKKRMEILQMALLEPSLLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVNA+RS +RS L+ITHYQRLL+YIKPD +HVL  G+I+ +G   +A +LE 
Sbjct: 179 DALRIVADGVNAMRSPERSMLVITHYQRLLDYIKPDRVHVLAGGRIVASGGPELAHELEA 238

Query: 241 NGYAELIKE 249
            GY + + E
Sbjct: 239 EGYDKFLPE 247


>gi|114319887|ref|YP_741570.1| FeS assembly ATPase SufC [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226281|gb|ABI56080.1| Iron-regulated ABC transporter ATPase subunit SufC [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 249

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 188/244 (77%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A++   DTEI++G+NL++   EV AIMGPNGSGKSTLS +L+G ++YE+TAG
Sbjct: 1   MLKIRNLHARV--EDTEILKGVNLEIGEGEVHAIMGPNGSGKSTLSKVLAGDENYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L++G+ +L+    ERA +G+FL FQYPVE+PG+  + FLK A+N  RK R E EL   
Sbjct: 59  EVLFRGKDLLELEPEERAGEGVFLGFQYPVEVPGVSNVYFLKTAINSVRKYRGEPELSAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  R ++     + +  +++ RP+N GFSGGEKK  EI QM  L P + ILDETDSGLDI
Sbjct: 119 EVLRHIKDAAKMVKMGDELVNRPVNEGFSGGEKKRNEIFQMAALAPHMAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVN++R   RSFL+ITHYQRLLNYIKPD +HV+ +GKI+K+GDY++AL+LEE
Sbjct: 179 DALRIVSEGVNSMRHPHRSFLLITHYQRLLNYIKPDHVHVMLDGKIVKSGDYTLALELEE 238

Query: 241 NGYA 244
           +GYA
Sbjct: 239 SGYA 242


>gi|332141974|ref|YP_004427712.1| Cysteine desulfurase activator ATPase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327551996|gb|AEA98714.1| Cysteine desulfurase activator ATPase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 253

 Score =  286 bits (731), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 189/248 (76%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A + + +  II+GLNL+V+P EV AIMGPNG+GKSTL Y+LSG   YE++ G
Sbjct: 1   MLSIKNLHASMEEKN--IIKGLNLEVKPGEVHAIMGPNGAGKSTLGYVLSGRDGYEVSDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +    G+ +L+  + ERA +G+FLAFQYPVEIPG+  M+F+K ++N  R+ R E  L   
Sbjct: 59  EATLNGKDLLELDVEERAREGLFLAFQYPVEIPGVSNMEFMKESVNAMREERGEAPLTAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +K ++   ++ + +D LKR +N GFSGGEKK  EI+QM LLEP LCILDE+DSGLD+
Sbjct: 119 EFLKKAKEACKQVQLPLDFLKRGVNEGFSGGEKKRNEIMQMILLEPKLCILDESDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+ R  +RSF+++THYQRLL+YIKPD +H+L +GKI+K+GD S+AL++E+
Sbjct: 179 DALQVVADGVNSQRDGERSFIVVTHYQRLLDYIKPDFVHILADGKIVKSGDASLALEVEK 238

Query: 241 NGYAELIK 248
           +GYA L K
Sbjct: 239 SGYAFLGK 246


>gi|288961955|ref|YP_003452265.1| Fe-S cluster assembly ATP-binding protein [Azospirillum sp. B510]
 gi|288914235|dbj|BAI75721.1| Fe-S cluster assembly ATP-binding protein [Azospirillum sp. B510]
          Length = 250

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 182/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M+EIKNL A +     EI++G++L + P EV AIMGPNG+GKST+SY+L+G   YE+T G
Sbjct: 1   MIEIKNLHATV--DGKEILKGVDLTIRPGEVHAIMGPNGAGKSTMSYVLAGRDGYEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y G+ +L     +RA++G+FLAFQYPVEIPG+    FLK A+N  RK R EKEL   
Sbjct: 59  SVTYYGKDLLAMEPEQRAAEGVFLAFQYPVEIPGVGNTTFLKTAINAIRKYRGEKELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + +R+ T  LG+  +MLKR +N+GFSGGEKK  E LQM +LEP   ILDETDSGLDI
Sbjct: 119 QFLKLIREKTKALGMTDEMLKRAVNVGFSGGEKKRNETLQMAVLEPKFAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALRS +RS L+ITHYQRLL+YI PD +HVL  G+I+K+G   +AL+LE+
Sbjct: 179 DALKIVAEGVNALRSPERSMLVITHYQRLLDYIVPDYVHVLAAGRIVKSGGKELALELEK 238

Query: 241 NGYAEL 246
           NGY + 
Sbjct: 239 NGYRDF 244


>gi|88706200|ref|ZP_01103907.1| ABC transporter ATP-binding protein [Congregibacter litoralis KT71]
 gi|88699594|gb|EAQ96706.1| ABC transporter ATP-binding protein [Congregibacter litoralis KT71]
          Length = 249

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A++     EI+RGLNL+V   EV AIMGPNGSGKSTL ++L+G   YE+T G
Sbjct: 1   MLKIENLHARV--EGKEILRGLNLEVAAGEVHAIMGPNGSGKSTLGHVLAGRPGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + GE++L+    ER+  G+FLAFQYPVEIPG+  M+FLK A++  R+ R ++ L   
Sbjct: 59  SITFNGENLLEQDTEERSRAGLFLAFQYPVEIPGVSNMEFLKAAVDAVREHRGQEALDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++ R+ +    +  D LKR +N GFSGGEKK  E++QM LLEPSLC++DETDSGLDI
Sbjct: 119 NFMKRAREASKAANLPADFLKRGVNEGFSGGEKKRNELIQMMLLEPSLCLMDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ AQGVNA+RS DR+F+++THYQRLL++++PD +HVL  G+I+++GD  +AL LE+
Sbjct: 179 DALQVVAQGVNAMRSDDRAFILVTHYQRLLDFVEPDHVHVLSEGRIVRSGDKDLALHLED 238

Query: 241 NGYAELIKE 249
            GYA L  E
Sbjct: 239 KGYAWLEDE 247


>gi|152995374|ref|YP_001340209.1| FeS assembly ATPase SufC [Marinomonas sp. MWYL1]
 gi|150836298|gb|ABR70274.1| FeS assembly ATPase SufC [Marinomonas sp. MWYL1]
          Length = 261

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IK+L A +   + +II+GL+L ++P EV AIMGPNG+GKSTL Y+LSG   Y + +G
Sbjct: 7   LLTIKDLHASV--EEKQIIKGLDLDIKPGEVHAIMGPNGAGKSTLGYVLSGRDGYSVDSG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +   GE +L+    +RA  G+FLAFQYPVEIPG+  ++FLK +++ QR+AR E  +   
Sbjct: 65  SVTLDGEDLLEMETEDRARAGLFLAFQYPVEIPGVSNLEFLKASVDAQRQARGEDAITSA 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++ +    ++ + +  LKR +N GFSGGEKK  E++QM LL+P LCILDETDSGLDI
Sbjct: 125 DFLKEAKAACKQVNLPVAFLKRGVNEGFSGGEKKRNELMQMLLLKPKLCILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVN+ RS DRSF+++THYQRLL+YIKPD +HVL +GKI+K+GD S+AL+LE 
Sbjct: 185 DALQVVAEGVNSQRSADRSFIVVTHYQRLLDYIKPDFVHVLSDGKIVKSGDASLALELEA 244

Query: 241 NGYAELIKE 249
            GYA L KE
Sbjct: 245 QGYAWLQKE 253


>gi|217977770|ref|YP_002361917.1| FeS assembly ATPase SufC [Methylocella silvestris BL2]
 gi|217503146|gb|ACK50555.1| FeS assembly ATPase SufC [Methylocella silvestris BL2]
          Length = 249

 Score =  285 bits (729), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL   I      I+  LNL V   EV AIMGPNG+GKSTLSY+++G KDY + +G
Sbjct: 1   MLEIKNLTVSI--DGRPILDDLNLTVRDGEVAAIMGPNGTGKSTLSYVIAGRKDYTVESG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G  +L      RA+KG+FLAFQYP+EIPG+  M FLK ALN QRK R E+EL  P
Sbjct: 59  EILLDGVDLLGLEPDVRAAKGVFLAFQYPLEIPGVATMTFLKAALNAQRKQRGEEELSTP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  ++V+    +L I  DMLKR LN+GFSGGEKK  +ILQM LLEP+L ILDETDSGLDI
Sbjct: 119 ELMKRVKAGAEKLEIKPDMLKRALNVGFSGGEKKRMDILQMALLEPTLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVNALRS  RSFLIITHYQRLL+YI PDT+HV+  G+I KTG   +AL+LE+
Sbjct: 179 DALRVVAAGVNALRSPKRSFLIITHYQRLLDYIVPDTVHVMAKGRIAKTGGADLALELEK 238

Query: 241 NGYAELIKE 249
           +GY + + +
Sbjct: 239 SGYRDYVAD 247


>gi|254786627|ref|YP_003074056.1| FeS assembly ATPase SufC [Teredinibacter turnerae T7901]
 gi|237683463|gb|ACR10727.1| FeS assembly ATPase SufC [Teredinibacter turnerae T7901]
          Length = 256

 Score =  285 bits (728), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 140/246 (56%), Positives = 181/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +   D  I++GL+L+++P EV AIMGPNGSGKST  ++LSG   YE+T G
Sbjct: 5   MLSIKNLHASV--EDKSILQGLSLEIKPGEVHAIMGPNGSGKSTTGHVLSGRDGYEVTEG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L     ERA +G+FLAFQYPVEIPG+  M+F+K A++  R+ R E  L   
Sbjct: 63  SVGFLGKDLLALDTEERAREGLFLAFQYPVEIPGVSNMEFMKAAVDAVREHRGEPALDSV 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R+    + ++ + LKR +N GFSGGEKK  EI+QM LL+P LCILDETDSGLDI
Sbjct: 123 SFMKMAREYCKAVNLDQNFLKRGVNEGFSGGEKKRNEIMQMMLLQPKLCILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVNALRS DRSF+++THYQRLLNYI+PD +HVL  GKIIK+GD S+AL+LEE
Sbjct: 183 DALQVVADGVNALRSADRSFIVVTHYQRLLNYIEPDFVHVLAKGKIIKSGDKSLALELEE 242

Query: 241 NGYAEL 246
            GY  L
Sbjct: 243 KGYGWL 248


>gi|315022124|gb|EFT35153.1| Iron-sulfur cluster assembly ATPase protein SufC [Riemerella
           anatipestifer RA-YM]
          Length = 246

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 189/247 (76%), Gaps = 1/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL AKI D   EI++G+NL+++P EV AIMGPNG+GKSTLS +++G +DYE+T G
Sbjct: 1   MLNIKNLHAKIEDG-AEILKGINLEIKPGEVHAIMGPNGAGKSTLSSVIAGKEDYEVTDG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL++GE+I++ +  ERA KGIFL+FQYPVEIPG+ +  F+K A+NE RKA   +++   
Sbjct: 60  EILFEGENIVEDAPEERAHKGIFLSFQYPVEIPGVSVTNFIKAAINETRKANGLEDMPAK 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +    +R+ +  LGI  D L R LN GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 120 EMLALIREKSELLGIKKDFLSRSLNEGFSGGEKKRNEIFQMMMLNPKLAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVN  +++  + L+ITHYQRLLNYI+PD +HVL +GKIIKTGD ++AL+LEE
Sbjct: 180 DALRIVSEGVNHFKNEGNAVLLITHYQRLLNYIQPDFVHVLADGKIIKTGDKTLALELEE 239

Query: 241 NGYAELI 247
            GY  L+
Sbjct: 240 KGYDWLL 246


>gi|304397638|ref|ZP_07379515.1| FeS assembly ATPase SufC [Pantoea sp. aB]
 gi|304354810|gb|EFM19180.1| FeS assembly ATPase SufC [Pantoea sp. aB]
          Length = 248

 Score =  284 bits (727), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGLNL+++P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R ++EL   
Sbjct: 59  SVTFKGKDLLELAPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYRQQEELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEEKIQLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR + R+F+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKIVANGVNSLRDEKRAFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|156934262|ref|YP_001438178.1| cysteine desulfurase ATPase component [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156532516|gb|ABU77342.1| hypothetical protein ESA_02092 [Cronobacter sakazakii ATCC BAA-894]
          Length = 248

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   +  I+RGLNL+++P EV AIMGPNGSGKSTLS  L+G +DYEIT G
Sbjct: 1   MLSIKDLQVSV--EEKAILRGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R+ R ++EL   
Sbjct: 59  EVRFKGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVREYRGQEELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 DFQDLMEEKIKLLQMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSEGVNALRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|167646553|ref|YP_001684216.1| FeS assembly ATPase SufC [Caulobacter sp. K31]
 gi|167348983|gb|ABZ71718.1| FeS assembly ATPase SufC [Caulobacter sp. K31]
          Length = 248

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 140/243 (57%), Positives = 174/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL A +   D  I++GL L V   EV AIMGPNG+GKSTLSY+L+G   YE+T G
Sbjct: 1   MLSIQNLHANV--GDKPILKGLTLDVPAGEVHAIMGPNGAGKSTLSYVLTGRGGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L     ERA+KG+FL+FQYP+EIPG+  + F++ ALN QR+AR E E+  P
Sbjct: 59  SATLNGEDLLALEPNERAAKGVFLSFQYPLEIPGVPALTFIRTALNAQRRARGEDEIAAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R+  A L I+ DMLKR LN+GFSGGEKK  EILQM +L P   ILDETDSGLDI
Sbjct: 119 AFLKLAREKAASLKIDFDMLKRGLNVGFSGGEKKRMEILQMAMLSPKFLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALR+ DR  L+ITHYQRLL+YIKPD +HVL  G+I+ +G   +AL LE 
Sbjct: 179 DALKIVSEGVNALRAPDRGMLVITHYQRLLDYIKPDRVHVLAAGRIVASGGPELALQLEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 EGY 241


>gi|163796148|ref|ZP_02190110.1| Suf C, ATPase [alpha proteobacterium BAL199]
 gi|159178607|gb|EDP63147.1| Suf C, ATPase [alpha proteobacterium BAL199]
          Length = 250

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 144/249 (57%), Positives = 184/249 (73%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTE-IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA 59
           +LEIK+L A   D D + I++G++L +EP EV AIMGPNGSGKSTLSY+L+G   YE+T 
Sbjct: 3   LLEIKDLHA---DVDGKPILKGIDLVIEPGEVHAIMGPNGSGKSTLSYVLAGRGGYEVTG 59

Query: 60  GDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLI 119
           G + + G+ +L+    ERA  GIFLAFQYPVE+PG+  M FLK ALN +RKA  E E+  
Sbjct: 60  GSVTFDGKDLLEMEADERAVAGIFLAFQYPVELPGVGGMTFLKEALNARRKAAGEDEIDA 119

Query: 120 PDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD 179
             F + VR     L I  +MLKR +N+GFSGGEKK  EILQM +LEP LC+LDETDSGLD
Sbjct: 120 MAFLKLVRAKAKTLEITDEMLKRAVNVGFSGGEKKRNEILQMAVLEPMLCVLDETDSGLD 179

Query: 180 IDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           IDALKI + GVNALR+  RS L+ITHYQRLLN+I PD +HVL +G+I +TG   +AL+LE
Sbjct: 180 IDALKIVSDGVNALRAAGRSMLVITHYQRLLNHIVPDKVHVLAHGRIRRTGGKELALELE 239

Query: 240 ENGYAELIK 248
           + GYA+ ++
Sbjct: 240 QKGYADFVE 248


>gi|329296199|ref|ZP_08253535.1| cysteine desulfurase ATPase component [Plautia stali symbiont]
          Length = 248

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D EI+RGLNL+V+P EV AIMGPNGSGKSTLS  L+G +DYEIT G
Sbjct: 1   MLSIKDLQVSV--EDKEILRGLNLEVKPGEVHAIMGPNGSGKSTLSATLAGREDYEITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+    ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R ++EL   
Sbjct: 59  SVTFKGKDLLELEPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  L+P LCILDETDSGLDI
Sbjct: 119 DFQDFIEDKIKLLKMPEDLLTRSVNVGFSGGEKKRNDILQMTALDPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+++   LEE
Sbjct: 179 DALKIVAEGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGKIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|260597665|ref|YP_003210236.1| cysteine desulfurase ATPase [Cronobacter turicensis z3032]
 gi|260216842|emb|CBA30352.1| Probable ATP-dependent transporter sufC [Cronobacter turicensis
           z3032]
          Length = 248

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   +  I+RGLNL+++P EV AIMGPNGSGKSTLS  L+G +DYEIT G
Sbjct: 1   MLSIKDLQVSV--EEKAILRGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R+ R + EL   
Sbjct: 59  EVRFKGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVREYRGQDELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 DFQDLMEEKIKLLQMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSEGVNALRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|308186667|ref|YP_003930798.1| Iron-sulfur cluster biosynthesis protein sufC [Pantoea vagans C9-1]
 gi|308057177|gb|ADO09349.1| Iron-sulfur cluster biosynthesis protein sufC [Pantoea vagans C9-1]
          Length = 248

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGLNL+++P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R + EL   
Sbjct: 59  SVSFKGKDLLELAPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYRQQDELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEEKIHLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR + R+F+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKIVANGVNSLRDEKRAFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|37526511|ref|NP_929855.1| cysteine desulfurase ATPase component [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785942|emb|CAE14994.1| Probable ATP-dependent transporter SufC [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 248

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNLR  +     EI++GLNL V+P E+ AIMGPNGSGKSTLS  L+G ++YEI  G
Sbjct: 1   MLSIKNLRVSV--EGNEILKGLNLDVKPGEIHAIMGPNGSGKSTLSATLAGREEYEIDDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I +KG+++L +   ERA +GIFLAFQYPVEIPG+    FL+ A+N  R+ R+++ L   
Sbjct: 59  EITFKGKNLLGFEPEERAGEGIFLAFQYPVEIPGVSNQFFLQTAVNAVRQYRHQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP+LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLDMPPDLLTRSVNVGFSGGEKKRNDILQMAALEPTLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR  +RSF+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+S+A  LEE
Sbjct: 179 DALKIVANGVNSLRDPNRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFSLAKKLEE 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 QGYGWLIDQ 247


>gi|313206629|ref|YP_004045806.1| fes assembly ATPase sufc [Riemerella anatipestifer DSM 15868]
 gi|312445945|gb|ADQ82300.1| FeS assembly ATPase SufC [Riemerella anatipestifer DSM 15868]
 gi|325335930|gb|ADZ12204.1| ABC-type transport system involved in Fe-S cluster assembly, ATPase
           component [Riemerella anatipestifer RA-GD]
          Length = 246

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 189/247 (76%), Gaps = 1/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A+I D   EI++G+NL+++P EV AIMGPNG+GKSTLS +++G +DYE+T G
Sbjct: 1   MLNIKNLYARIEDG-AEILKGINLEIKPGEVHAIMGPNGAGKSTLSSVIAGKEDYEVTDG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL++GE+I++ +  ERA KGIFL+FQYPVEIPG+ +  F+K A+NE RKA   +++   
Sbjct: 60  EILFEGENIVEDAPEERAHKGIFLSFQYPVEIPGVSVTNFIKAAINETRKANGLEDMPAK 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +    +R+ +  LGI  D L R LN GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 120 EMLALIREKSELLGIKKDFLSRSLNEGFSGGEKKRNEIFQMMMLNPKLAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVN  +++  + L+ITHYQRLLNYI+PD +HVL +GKIIKTGD ++AL+LEE
Sbjct: 180 DALRIVSEGVNHFKNEGNAVLLITHYQRLLNYIQPDFVHVLADGKIIKTGDKTLALELEE 239

Query: 241 NGYAELI 247
            GY  L+
Sbjct: 240 KGYDWLL 246


>gi|291617269|ref|YP_003520011.1| SufC [Pantoea ananatis LMG 20103]
 gi|291152299|gb|ADD76883.1| SufC [Pantoea ananatis LMG 20103]
 gi|327393721|dbj|BAK11143.1| probable ATP-dependent transporter SufC [Pantoea ananatis AJ13355]
          Length = 248

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGLNL+++P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+    ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R + EL   
Sbjct: 59  SVTFKGKDLLELEPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYRQQDELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEEKIDLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR + R+F+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKIVANGVNSLRDEKRAFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|317047892|ref|YP_004115540.1| FeS assembly ATPase SufC [Pantoea sp. At-9b]
 gi|316949509|gb|ADU68984.1| FeS assembly ATPase SufC [Pantoea sp. At-9b]
          Length = 248

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D EI+RGLNL+V+P EV AIMGPNGSGKSTLS  L+G +DYEIT G
Sbjct: 1   MLSIKDLQVSV--EDKEILRGLNLEVKPGEVHAIMGPNGSGKSTLSATLAGREDYEITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+    ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVTFKGKDLLELEPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEDKIHLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGKIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|255039510|ref|YP_003090131.1| FeS assembly ATPase SufC [Dyadobacter fermentans DSM 18053]
 gi|254952266|gb|ACT96966.1| FeS assembly ATPase SufC [Dyadobacter fermentans DSM 18053]
          Length = 252

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 186/243 (76%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I +LRA I     EI++G+NL+V+P EV AIMGPNGSGKSTL+ +L+G ++YE+T G
Sbjct: 1   MLSINDLRASI--EGKEILKGINLEVKPGEVHAIMGPNGSGKSTLASVLAGREEYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G+ +L+ +  ERA++GIFLAFQYPVEIPG+  + FLK A+NE RK + E  L   
Sbjct: 59  NVVFEGKELLELAPEERAAEGIFLAFQYPVEIPGVTTINFLKTAVNEIRKYKGEAPLDAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+    + +N  +LKR LN GFSGGEKK  E+ QM +LEP L ILDETDSGLDI
Sbjct: 119 QFLKMVREKAKLVSMNDSLLKRALNEGFSGGEKKRNEVFQMAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN+LRS +RS +++THYQRLL+YI PD +HVL+ G+I+K+G   +AL+LEE
Sbjct: 179 DALRIVAEGVNSLRSPERSTIVVTHYQRLLDYIVPDYVHVLYKGRIVKSGPKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|23006692|ref|ZP_00048895.1| COG0396: ABC-type transport system involved in Fe-S cluster
           assembly, ATPase component [Magnetospirillum
           magnetotacticum MS-1]
          Length = 215

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 165/208 (79%)

Query: 38  NGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIM 97
           NGSGKSTLSY+++G +DYE+  G+IL  G++IL+ +  ERA+ GIFLAFQYP+EIPG+  
Sbjct: 1   NGSGKSTLSYVIAGKEDYEVLDGEILLDGQNILEMAADERAAAGIFLAFQYPLEIPGVGT 60

Query: 98  MQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAE 157
           M FLK  LN QRKAR E EL  PDF R V     +L IN +MLKR LN+GFSGGEKK  E
Sbjct: 61  MTFLKACLNAQRKARGEDELSTPDFIRAVNAAADKLEINKEMLKRALNVGFSGGEKKRME 120

Query: 158 ILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDT 217
           ILQM LL+P  C+LDETDSGLDIDAL+I ++GVNALR++ RSFL+ITHYQRLLN+I PDT
Sbjct: 121 ILQMALLQPKFCVLDETDSGLDIDALRIVSEGVNALRAEGRSFLVITHYQRLLNHIVPDT 180

Query: 218 IHVLHNGKIIKTGDYSIALDLEENGYAE 245
           +HV+  G+I+KTG   +AL+LE +GYAE
Sbjct: 181 VHVMSKGQIVKTGGKELALELEASGYAE 208


>gi|253989389|ref|YP_003040745.1| cysteine desulfurase ATPase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780839|emb|CAQ84001.1| putative atp-binding component of a transport system [Photorhabdus
           asymbiotica]
          Length = 248

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +KNLR  +     EI++GLNL+V+P EV AIMGPNGSGKSTLS  L+G ++YEI  G
Sbjct: 1   MLSVKNLRVSV--EGNEILKGLNLEVKPGEVHAIMGPNGSGKSTLSATLAGREEYEINDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I++KG+ + +    ERA +GIFLAFQYPVEIPG+    FL+ A+N  R+ R+++ L   
Sbjct: 59  NIIFKGKDLRELEPEERAGEGIFLAFQYPVEIPGVSNQFFLQTAVNAVREYRDQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP+LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLDMQQDLLTRSVNVGFSGGEKKRNDILQMAALEPTLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   RSF+I+THYQR+L+Y+KPD +HVL+ G+II++GD+S+A  LEE
Sbjct: 179 DALKIVANGVNSLRDPSRSFIIVTHYQRILDYVKPDFVHVLYQGRIIESGDFSLAKKLEE 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 QGYGWLIDQ 247


>gi|153947283|ref|YP_001400718.1| cysteine desulfurase ATPase component [Yersinia pseudotuberculosis
           IP 31758]
 gi|152958778|gb|ABS46239.1| FeS assembly ATPase SufC [Yersinia pseudotuberculosis IP 31758]
          Length = 248

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 189/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+++L+ +  +RA +G+FLAFQYPVEIPG+    FL+ ++N  RK R +  L   
Sbjct: 59  EVTFKGKNLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQAPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF+  + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+++RSF+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|294083585|ref|YP_003550342.1| FeS assembly ATPase SufC [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663157|gb|ADE38258.1| FeS assembly ATPase SufC [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 251

 Score =  281 bits (718), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 181/244 (74%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI++L A +   DT I++G+NL +   E+ AIMGPNGSGKST+SY+LSG   YE+T+G
Sbjct: 4   LLEIRDLHASV--GDTPILKGINLTINAGEIHAIMGPNGSGKSTMSYVLSGRNGYEVTSG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+L  G S+L+    ERA  G+FLAFQYPVE+PG+  M FL+ A+N +R    E E+   
Sbjct: 62  DVLMNGVSMLEMEPDERARAGMFLAFQYPVELPGVGGMSFLRAAVNARRIEAGEDEVDQL 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR     LGIN +MLKR +N+GFSGGEKK  EILQM LLEP + +LDETDSGLD+
Sbjct: 122 EFVKMVRAKAKILGINDEMLKRAVNVGFSGGEKKRYEILQMALLEPMMAVLDETDSGLDV 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVN LR   RS L+ITHYQRLL+YI PD +H+L  GKI K+GD S+AL++EE
Sbjct: 182 DALKIVSEGVNLLRDPARSMLVITHYQRLLDYIVPDYVHILAGGKIRKSGDKSLALEVEE 241

Query: 241 NGYA 244
            GYA
Sbjct: 242 QGYA 245


>gi|51596636|ref|YP_070827.1| cysteine desulfurase ATPase component [Yersinia pseudotuberculosis
           IP 32953]
 gi|170024088|ref|YP_001720593.1| cysteine desulfurase ATPase component [Yersinia pseudotuberculosis
           YPIII]
 gi|186895692|ref|YP_001872804.1| cysteine desulfurase ATPase [Yersinia pseudotuberculosis PB1/+]
 gi|51589918|emb|CAH21550.1| putative ATP-dependent transporter [Yersinia pseudotuberculosis IP
           32953]
 gi|169750622|gb|ACA68140.1| FeS assembly ATPase SufC [Yersinia pseudotuberculosis YPIII]
 gi|186698718|gb|ACC89347.1| FeS assembly ATPase SufC [Yersinia pseudotuberculosis PB1/+]
          Length = 248

 Score =  281 bits (718), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 188/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+    FL+ ++N  RK R +  L   
Sbjct: 59  EVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQAPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF+  + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+++RSF+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|292490817|ref|YP_003526256.1| FeS assembly ATPase SufC [Nitrosococcus halophilus Nc4]
 gi|291579412|gb|ADE13869.1| FeS assembly ATPase SufC [Nitrosococcus halophilus Nc4]
          Length = 257

 Score =  281 bits (718), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 145/246 (58%), Positives = 181/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +      I+RG++L V+P EV AIMGPNGSGKSTL+ +L+G +DYE TAG
Sbjct: 1   MLTIKNLHASV--DGKPILRGIDLNVKPGEVHAIMGPNGSGKSTLASVLAGREDYEATAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILY+G+++LD +  ERA  GIFLAFQYPVEIPG+  +  LK ALN  RK R   EL   
Sbjct: 59  EILYQGQNLLDLAPEERARAGIFLAFQYPVEIPGVSNVYLLKAALNSVRKHRGLDELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L+R +N GFSGGEKK  EILQM +LEP+L ILDETDSGLDI
Sbjct: 119 DFLALVREKMKLVKMDESFLQRAVNEGFSGGEKKRNEILQMAILEPTLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVNALRS +R  +++THYQRLLNYI PD +HVL  G+I+K+GD  +AL+LEE
Sbjct: 179 DALRIVADGVNALRSPERGLILVTHYQRLLNYIVPDYVHVLSQGRIVKSGDKKLALELEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|146311418|ref|YP_001176492.1| cysteine desulfurase ATPase component [Enterobacter sp. 638]
 gi|145318294|gb|ABP60441.1| Iron-regulated ABC transporter ATPase subunit SufC [Enterobacter
           sp. 638]
          Length = 248

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +   D  I+RGLN++V P EV AIMGPNGSGKSTLS  L+G +DYE+  G
Sbjct: 1   MLSIKNLQVSV--EDKAILRGLNIEVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVVGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  +RA +GIF+AFQYPVEIPG+    FL+ +LN  RK R E+EL   
Sbjct: 59  TVEFKGKDLLELSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTSLNAVRKYRGEEELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 DFQDLMEEKIKLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVADGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|255534220|ref|YP_003094591.1| Iron-sulfur cluster assembly ATPase protein SufC [Flavobacteriaceae
           bacterium 3519-10]
 gi|255340416|gb|ACU06529.1| Iron-sulfur cluster assembly ATPase protein SufC [Flavobacteriaceae
           bacterium 3519-10]
          Length = 247

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 138/248 (55%), Positives = 187/248 (75%), Gaps = 1/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A+I ++  EI++G+NL++ P EV AIMGPNG+GKSTLS +++G ++YEIT G
Sbjct: 1   MLHINNLHAQI-ESGVEILKGINLQINPGEVHAIMGPNGAGKSTLSSVIAGKEEYEITEG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI + G++I++ +  +RA KGIF++FQYPVEIPG+ +  F+K ALNE RKA   +++   
Sbjct: 60  DIFFNGQNIIEDAPEDRAHKGIFMSFQYPVEIPGVSVTNFIKAALNETRKANGLEDMPAR 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +    +R+ + +LGI  D L R LN GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 120 EMLALIRENSEKLGIKRDFLSRSLNEGFSGGEKKRNEIFQMMMLNPKLAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN+ R++  + L+ITHYQRLL+YI+PD +HVL +GKIIKTGD ++AL+LEE
Sbjct: 180 DALRIVADGVNSFRNEGNAVLLITHYQRLLDYIQPDFVHVLADGKIIKTGDKTLALELEE 239

Query: 241 NGYAELIK 248
            GY  L+ 
Sbjct: 240 RGYDWLLN 247


>gi|238897307|ref|YP_002922984.1| putative transport protein associated with Fe-S cluster assembly
           (ABC superfamily, atp_bind) [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465062|gb|ACQ66836.1| putative transport protein associated with Fe-S cluster assembly
           (ABC superfamily, atp_bind) [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 246

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 185/246 (75%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL   +   +T I++GL+L ++  EV AIMGPNGSGKSTLS  L+G ++Y++T G
Sbjct: 1   MLSINNLNVSV--EETPILKGLDLTIKSGEVHAIMGPNGSGKSTLSSTLAGREEYQVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+KG+++L+    ERA +G+FLAFQYPVEIPG+    FL+ A+N  RK R +  L   
Sbjct: 59  EVLFKGKNLLELDPSERAGEGVFLAFQYPVEIPGVSNRFFLQTAVNAVRKYRQQAPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DFT  + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEP+LCILDETDSGLDI
Sbjct: 119 DFTDFIEEKMALLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPALCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI AQGVN+LR++ R+F+I+THYQR+L YIKPD +HVLH G++IK+GD+++  +LEE
Sbjct: 179 DALKIVAQGVNSLRNEKRAFIIVTHYQRILEYIKPDFVHVLHEGRMIKSGDFTLVKELEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 RGYGWL 244


>gi|87118503|ref|ZP_01074402.1| Cysteine desulfurase activator ATPase [Marinomonas sp. MED121]
 gi|86166137|gb|EAQ67403.1| Cysteine desulfurase activator ATPase [Marinomonas sp. MED121]
          Length = 265

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 182/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IK+L A + + +  I++GLNL V+P EV AIMGPNG+GKST+ Y+LSG + Y +  G
Sbjct: 12  LLTIKDLHASVEEKN--ILKGLNLDVKPGEVHAIMGPNGAGKSTMGYVLSGREGYSVEQG 69

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             L  G  IL+    ERA  G+FLAFQYPVEIPG+  ++FLK +++ QR+AR E  +   
Sbjct: 70  SALLDGVDILELEAEERARAGLFLAFQYPVEIPGVSNLEFLKASVDAQREARGEGAVSSA 129

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +  +    ++ + +  LKR +N GFSGGEKK  EI+QM LL+P +CILDETDSGLDI
Sbjct: 130 DFLKLAKAACKQVNLPLAFLKRGVNEGFSGGEKKRNEIMQMLLLQPKVCILDETDSGLDI 189

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVN+ RS DRSF+++THYQRLL+YIKPD +HVL +GKI+K+GD S+AL+LE 
Sbjct: 190 DALQVVAEGVNSQRSSDRSFVVVTHYQRLLDYIKPDFVHVLADGKIVKSGDASLALELEA 249

Query: 241 NGYAEL 246
            GYA L
Sbjct: 250 QGYAWL 255


>gi|183598855|ref|ZP_02960348.1| hypothetical protein PROSTU_02287 [Providencia stuartii ATCC 25827]
 gi|188021062|gb|EDU59102.1| hypothetical protein PROSTU_02287 [Providencia stuartii ATCC 25827]
          Length = 248

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +KNL   +     EI++GL+L+V+P EV AIMGPNGSGKSTLS  L+G ++Y+I +G
Sbjct: 1   MLSVKNLHVSV--EGNEILKGLSLEVKPGEVHAIMGPNGSGKSTLSATLAGREEYDIDSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++KG+ +L+    ERA +GIFLAFQYPVEIPG+    FL+ A+N  R+ R ++ L   
Sbjct: 59  EVIFKGKDLLELDPEERAGEGIFLAFQYPVEIPGVSNQFFLQTAVNAVREYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEDKINLLEMPQDLLTRSVNVGFSGGEKKRNDILQMAALEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVN+LRS DRSF+I+THYQR+L+Y+KPD +HVL+ GKIIK+GD+S+A  LEE
Sbjct: 179 DALKTVANGVNSLRSPDRSFIIVTHYQRILDYVKPDFVHVLYQGKIIKSGDFSLAKKLEE 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 QGYGWLIDQ 247


>gi|123442431|ref|YP_001006410.1| cysteine desulfurase ATPase component [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122089392|emb|CAL12240.1| putative ATP-dependent transporter [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318605863|emb|CBY27361.1| iron-sulfur cluster assembly ATPase protein SufC [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 248

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+     RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVTFKGKDLLELDPEARAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+QDR+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNQDRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|83644266|ref|YP_432701.1| FeS assembly ATPase SufC [Hahella chejuensis KCTC 2396]
 gi|83632309|gb|ABC28276.1| FeS assembly ATPase SufC [Hahella chejuensis KCTC 2396]
          Length = 252

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 185/246 (75%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L A++   + EI++GL L V+P EV AIMGPNGSGKSTL+++LSG + Y++T+G
Sbjct: 1   MLSIKDLYARV--EEKEILKGLTLDVKPGEVHAIMGPNGSGKSTLTHVLSGREGYDVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I Y G+ +L+    +RA +GIFLAFQYPVEIPG+  +QFL+ A+N  RK R E+EL   
Sbjct: 59  EISYYGQDLLEMEPEDRAREGIFLAFQYPVEIPGVSNIQFLRTAMNSIRKHRGEEELDAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R+    + ++ + LKR +N GFSGGEKK  EILQM +LEP L +LDETDSGLDI
Sbjct: 119 TFLKLARQKIGMVNLDPEFLKRGVNEGFSGGEKKRNEILQMLMLEPKLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVNALRS DR+ +++THYQRLLNYI PD +HVL NG+I+K+G   +AL+LEE
Sbjct: 179 DALQVVANGVNALRSPDRAVVLVTHYQRLLNYIVPDYVHVLANGRIVKSGGRELALELEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|86140877|ref|ZP_01059436.1| ABC transporter, ATP-binding protein [Leeuwenhoekiella blandensis
           MED217]
 gi|85832819|gb|EAQ51268.1| ABC transporter, ATP-binding protein [Leeuwenhoekiella blandensis
           MED217]
          Length = 250

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 182/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A I D D  I++G++LKV   EV AIMGPNGSGKSTLS +++G ++YE+  G
Sbjct: 1   MLEIKNLNAGIEDKD--ILKGIDLKVNAGEVHAIMGPNGSGKSTLSSVIAGKEEYEVNGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI+++GESIL+    ERA +G+FL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  DIIFEGESILELDAEERAHQGVFLSFQYPVEIPGVSVTNFIKTAINETRKAKGLEDMPAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DMLKMIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVN LRS+D + ++ITHYQRLL YI PD +HVL +GKI+K+G   +AL+LEE
Sbjct: 179 DALRIVSNGVNKLRSKDNAVIVITHYQRLLEYIVPDFVHVLVDGKIVKSGGKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|150026422|ref|YP_001297248.1| Fe-S assembly ATPase, SufC [Flavobacterium psychrophilum JIP02/86]
 gi|149772963|emb|CAL44447.1| Fe-S assembly ATPase, SufC [Flavobacterium psychrophilum JIP02/86]
          Length = 249

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A I   D EI++G+NL+V+  EV AIMGPNG+GKSTLS +++G+++Y +T G
Sbjct: 1   MLSIKNLHASI--EDKEILKGINLEVKAGEVHAIMGPNGAGKSTLSSIIAGNENYTVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL +GE I + +  ERA KG+FL+FQYPVEIPG+ +  F+K A+NE RKAR ++++   
Sbjct: 59  EILLEGEDISELAPEERAHKGVFLSFQYPVEIPGVSVTNFMKTAINESRKARGQEDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKFIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL+YI PD +HVLH+GKI+K+G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLKSKDNAVIVITHYQRLLDYIVPDFVHVLHDGKIVKSGGKELALELEE 238

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 239 KGYDWLKQE 247


>gi|168463222|ref|ZP_02697153.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195634452|gb|EDX52804.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 248

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   +  I+RGLNL++ P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EEKAILRGLNLEIRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R +  L   
Sbjct: 59  SVTFKGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRAYRGQASLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALR   R+F+I+THYQR+L+YIKPD +HVL+ G+I+++GD+++   LEE
Sbjct: 179 DALKIVAEGVNALRDDKRTFIIVTHYQRILDYIKPDYVHVLYQGRIVRSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|167551664|ref|ZP_02345418.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168239252|ref|ZP_02664310.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168240880|ref|ZP_02665812.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194447531|ref|YP_002045376.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194735450|ref|YP_002114386.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|198244878|ref|YP_002215756.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204927493|ref|ZP_03218694.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205352909|ref|YP_002226710.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857123|ref|YP_002243774.1| cysteine desulfurase ATPase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|194405835|gb|ACF66054.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194710952|gb|ACF90173.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288012|gb|EDY27399.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197939394|gb|ACH76727.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204322835|gb|EDZ08031.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205272690|emb|CAR37604.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205323621|gb|EDZ11460.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205339643|gb|EDZ26407.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|206708926|emb|CAR33256.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|322616755|gb|EFY13664.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619985|gb|EFY16858.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622296|gb|EFY19141.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322627819|gb|EFY24609.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633082|gb|EFY29825.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636672|gb|EFY33375.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641303|gb|EFY37944.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644929|gb|EFY41462.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650232|gb|EFY46646.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655807|gb|EFY52109.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660133|gb|EFY56372.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322665301|gb|EFY61489.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669558|gb|EFY65706.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673484|gb|EFY69586.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322677412|gb|EFY73476.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322679925|gb|EFY75964.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687397|gb|EFY83369.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192350|gb|EFZ77581.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198631|gb|EFZ83732.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323203112|gb|EFZ88143.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208677|gb|EFZ93615.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323213808|gb|EFZ98586.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217654|gb|EGA02369.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222899|gb|EGA07250.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323227191|gb|EGA11364.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229456|gb|EGA13579.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323232679|gb|EGA16775.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240283|gb|EGA24327.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242729|gb|EGA26750.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323245940|gb|EGA29928.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252816|gb|EGA36653.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323260085|gb|EGA43710.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267150|gb|EGA50635.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323271526|gb|EGA54947.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326623502|gb|EGE29847.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326627982|gb|EGE34325.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 248

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   +  I+RGLNL++ P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EEKAILRGLNLEIRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R +  L   
Sbjct: 59  SVTFKGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRAYRGQTSLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALR   R+F+I+THYQR+L+YIKPD +HVL+ G+I+++GD+++   LEE
Sbjct: 179 DALKIVAEGVNALRDDKRAFIIVTHYQRILDYIKPDYVHVLYQGRIVRSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|300113347|ref|YP_003759922.1| FeS assembly ATPase SufC [Nitrosococcus watsonii C-113]
 gi|299539284|gb|ADJ27601.1| FeS assembly ATPase SufC [Nitrosococcus watsonii C-113]
          Length = 258

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 182/244 (74%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL  ++   D  I+RG++L+V P EV AIMGPNGSGKSTL+ +L+G + YE+TAG
Sbjct: 1   MLTIRNLHTQV--DDKPILRGIDLQVNPGEVHAIMGPNGSGKSTLANVLAGREGYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++LY+G+S+LD +  ERA  GIFLAFQYPVEIPG+  +  LK ALN  RK R   EL   
Sbjct: 59  EVLYQGQSLLDLAPEERACAGIFLAFQYPVEIPGVSNVYLLKTALNAVRKHRGLPELDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L+R +N GFSGGEKK  EILQM +LEP+L ILDETDSGLDI
Sbjct: 119 DFLALVREKMKLVKMDESFLQRAVNEGFSGGEKKRNEILQMAILEPALAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS +R  +++THYQRLL+YI PD +HVL  G+I+K+GD ++AL+LE+
Sbjct: 179 DALKIVADGVNALRSPERGLILVTHYQRLLDYIVPDYVHVLSQGRIVKSGDKTLALELEK 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 EGYG 242


>gi|194364777|ref|YP_002027387.1| FeS assembly ATPase SufC [Stenotrophomonas maltophilia R551-3]
 gi|194347581|gb|ACF50704.1| FeS assembly ATPase SufC [Stenotrophomonas maltophilia R551-3]
          Length = 256

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 182/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A+I   D EI++GL+L+V+P +V AIMGPNG+GKSTL  +L+G   Y++T G
Sbjct: 3   MLKIENLHARI--GDKEILKGLSLEVKPGQVHAIMGPNGAGKSTLGNVLAGRDGYDVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G  +LD     RA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 61  SVQFEGTDLLDQDPEARAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEEELDSM 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 121 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS DRSFL+ITHYQRLL+YIKPD +HVL +G+I+K+G   +AL+LE 
Sbjct: 181 DALKSVADGVNALRSADRSFLVITHYQRLLDYIKPDVVHVLADGRIVKSGGPELALELEA 240

Query: 241 NGY 243
           +GY
Sbjct: 241 HGY 243


>gi|16764721|ref|NP_460336.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56413655|ref|YP_150730.1| cysteine desulfurase ATPase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62179961|ref|YP_216378.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161614215|ref|YP_001588180.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167994392|ref|ZP_02575484.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168233561|ref|ZP_02658619.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168263802|ref|ZP_02685775.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168822237|ref|ZP_02834237.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445473|ref|YP_002040626.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194469271|ref|ZP_03075255.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197250520|ref|YP_002146668.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265761|ref|ZP_03165835.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197362579|ref|YP_002142216.1| cysteine desulfurase ATPase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|200390974|ref|ZP_03217585.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|224584117|ref|YP_002637915.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238910813|ref|ZP_04654650.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|16419891|gb|AAL20295.1| putative transport protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56127912|gb|AAV77418.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62127594|gb|AAX65297.1| putative ABC superfamily (atp_bind) transport protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161363579|gb|ABX67347.1| hypothetical protein SPAB_01958 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404136|gb|ACF64358.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194455635|gb|EDX44474.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197094056|emb|CAR59556.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|197214223|gb|ACH51620.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197244016|gb|EDY26636.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|199603419|gb|EDZ01965.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205327735|gb|EDZ14499.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205332378|gb|EDZ19142.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205341284|gb|EDZ28048.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347556|gb|EDZ34187.1| FeS assembly ATPase SufC [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|224468644|gb|ACN46474.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|261246579|emb|CBG24389.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267993258|gb|ACY88143.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157906|emb|CBW17401.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312912356|dbj|BAJ36330.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320086148|emb|CBY95922.1| Phosphate import ATP-binding protein pstB Phosphate-transporting
           ATPase; ABC phosphate transporter [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321223997|gb|EFX49060.1| Iron-sulfur cluster assembly ATPase protein SufC [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322714428|gb|EFZ05999.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129641|gb|ADX17071.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332988258|gb|AEF07241.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 248

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   +  I+RGLNL++ P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EEKAILRGLNLEIRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R +  L   
Sbjct: 59  SVTFKGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRAYRGQASLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALR   R+F+I+THYQR+L+YIKPD +HVL+ G+I+++GD+++   LEE
Sbjct: 179 DALKIVAEGVNALRDDKRAFIIVTHYQRILDYIKPDYVHVLYQGRIVRSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|332161645|ref|YP_004298222.1| cysteine desulfurase ATPase component [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325665875|gb|ADZ42519.1| cysteine desulfurase ATPase component [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330861452|emb|CBX71675.1| putative ATP-dependent transporter sufC [Yersinia enterocolitica
           W22703]
          Length = 248

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLELKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+     RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVTFKGKDLLELDPEARAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+QDR+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNQDRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|83858478|ref|ZP_00952000.1| ABC transporter, ATP-binding protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853301|gb|EAP91153.1| ABC transporter, ATP-binding protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 254

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 181/246 (73%), Gaps = 3/246 (1%)

Query: 1   MLEIKNLRAKIVDTDT---EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           ML I+NL+A++   D    +I++G++LKV   EV AIMGPNG GKSTLSY+LSG   YEI
Sbjct: 1   MLVIENLQARVDAEDGDGRQILKGVSLKVPAGEVHAIMGPNGCGKSTLSYVLSGRDGYEI 60

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T G + + G+ + +    ERA+ G+FL+FQYPVEIPG+  + F+K ALN Q++ R E E+
Sbjct: 61  TGGSMSFDGQDLAEMEPEERAAAGVFLSFQYPVEIPGVPTLTFIKEALNAQKRLRGEDEV 120

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
             P F +  R+  A+LGI+ DMLKRP+N+GFSGGEKK  EI Q  +L+P   ILDETDSG
Sbjct: 121 PAPAFMKLAREAAAQLGISNDMLKRPVNVGFSGGEKKRMEIFQALMLQPKFLILDETDSG 180

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ A+GVNALR+++R  L+ITHYQRLL+Y+KPD +HV+  G+I +TG   +A  
Sbjct: 181 LDIDALKVVAEGVNALRNEERGMLVITHYQRLLDYLKPDVVHVMAAGRIQETGGPELAHK 240

Query: 238 LEENGY 243
           LE+ GY
Sbjct: 241 LEKEGY 246


>gi|225010411|ref|ZP_03700883.1| FeS assembly ATPase SufC [Flavobacteria bacterium MS024-3C]
 gi|225005890|gb|EEG43840.1| FeS assembly ATPase SufC [Flavobacteria bacterium MS024-3C]
          Length = 250

 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 184/243 (75%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A +   + EI++G+NL V+P EV AIMGPNG+GKSTL+ +++G  ++E+T G
Sbjct: 1   MLEIKNLHASV--DNKEILKGINLVVKPGEVHAIMGPNGAGKSTLASVVAGKDEFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L  G+ + D +  ERA KGIFL+FQYPVEIPG+ +  F+K A+NE RKAR ++++   
Sbjct: 59  EVLLDGQDLADDAPEERAHKGIFLSFQYPVEIPGVTVTNFMKTAINESRKARGQEDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +++    L I+   L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 EMLKMIKEKAELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKVAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS+D + ++ITHYQRLL+YI PD +HVL++GKI+K+GD S+AL+LEE
Sbjct: 179 DALRIVAAGVNKLRSKDNAVVVITHYQRLLDYIVPDFVHVLYDGKIVKSGDASLALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|254525259|ref|ZP_05137314.1| FeS assembly ATPase SufC [Stenotrophomonas sp. SKA14]
 gi|219722850|gb|EED41375.1| FeS assembly ATPase SufC [Stenotrophomonas sp. SKA14]
          Length = 254

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 181/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A+I   D EI++GL+L+V+P +V AIMGPNG+GKSTL  +L+G   YE+T G
Sbjct: 1   MLKIDNLHARI--GDKEILKGLSLEVKPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G  +LD     RA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 59  SVQFEGTDLLDQDPEARAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEEELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALR+ DRSFL+ITHYQRLL+YIKPD +HVL +G+I+K+G   +AL+LE 
Sbjct: 179 DALKSVADGVNALRAADRSFLVITHYQRLLDYIKPDVVHVLADGRIVKSGGPELALELEA 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|188990790|ref|YP_001902800.1| ABC transporter-like ATPase involved in Fe-S cluster assembly
           [Xanthomonas campestris pv. campestris str. B100]
 gi|167732550|emb|CAP50744.1| ABC transporter-like ATPase involved in Fe-S cluster assembly
           [Xanthomonas campestris pv. campestris]
          Length = 254

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/243 (57%), Positives = 181/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL A I   D  I++GL+L ++P +V AIMGPNG+GKSTL  +L+G   YE+TAG
Sbjct: 1   MLNIQNLHASIAGKD--ILKGLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G  +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 59  TVQFEGADLLDLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEEELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL +G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSTERSFLVITHYQRLLDYIKPDVVHVLSDGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|295096074|emb|CBK85164.1| Iron-regulated ABC transporter ATPase subunit SufC [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 248

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   + EI+RGLN  V+P EV AIMGPNGSGKSTLS  L+G +DYE+T+G
Sbjct: 1   MLSIKDLQVSV--EEKEILRGLNFDVKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  RK R  + L   
Sbjct: 59  SVEFNGKDLLEMSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRKYRGLEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP+LCILDETDSGLDI
Sbjct: 119 DFQDLMEEKIKLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPALCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR  +RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVADGVNSLRDGNRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|326794500|ref|YP_004312320.1| FeS assembly ATPase SufC [Marinomonas mediterranea MMB-1]
 gi|326545264|gb|ADZ90484.1| FeS assembly ATPase SufC [Marinomonas mediterranea MMB-1]
          Length = 261

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IK+L A + + +  II+GLNL+++P EV AIMGPNG+GKSTL Y+LSG + YE+ +G
Sbjct: 7   LLSIKDLHASVEEKN--IIKGLNLEIKPGEVHAIMGPNGAGKSTLGYVLSGREGYEVDSG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +   GE + +    ERA  G+FLAFQYPVEIPG+  ++FLK A++  R+A  ++ +   
Sbjct: 65  TVSLNGEDLFEMETEERARAGLFLAFQYPVEIPGVSNLEFLKAAVDATREANGQEAVSSA 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++ ++   ++ + +  LKR +N GFSGGEKK  E++QM LL+P +CILDETDSGLDI
Sbjct: 125 EFLKQAKEACKKVNLPVSFLKRGVNEGFSGGEKKRNELMQMLLLKPKVCILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVN+ RS DRSF+++THYQRLL+YIKPD +HVL +GKI+K+GD S+AL+LE 
Sbjct: 185 DALQVVAEGVNSQRSDDRSFIVVTHYQRLLDYIKPDYVHVLSDGKIVKSGDASLALELEA 244

Query: 241 NGYAELIKE 249
            GY+ L  E
Sbjct: 245 QGYSWLQTE 253


>gi|319953154|ref|YP_004164421.1| iron-regulated abc transporter atpase subunit sufc [Cellulophaga
           algicola DSM 14237]
 gi|319421814|gb|ADV48923.1| Iron-regulated ABC transporter ATPase subunit SufC [Cellulophaga
           algicola DSM 14237]
          Length = 252

 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 182/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +     EI+RG+NL+V+  EV AIMGPNGSGKSTLS +++G +++E+T G
Sbjct: 1   MLQIKNLHASV--EGKEILRGINLEVKAGEVHAIMGPNGSGKSTLSSVIAGKEEFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            ++ +GE + D S  ERA KGIFL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  QVILEGEDLEDVSPEERAHKGIFLSFQYPVEIPGVSVTNFMKTAINEGRKAKGLEDMPAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DMLKLIREKSEMLEIDRKFLSRSLNQGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL+YI PD +HVLHNGKI+K+G   +AL+LEE
Sbjct: 179 DALRIVASGVNKLKSKDNAVILITHYQRLLDYIIPDFVHVLHNGKIVKSGGKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|320539150|ref|ZP_08038821.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Serratia symbiotica str. Tucson]
 gi|320030788|gb|EFW12796.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Serratia symbiotica str. Tucson]
          Length = 248

 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL+  +     EI++GLNL + P EV AIMGPNGSGKSTLS +L+G ++YE+T G
Sbjct: 1   MLSINNLKVSV--EGNEILKGLNLAINPGEVHAIMGPNGSGKSTLSAMLAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+ +KG+ +L+ +  ERA +G+FLAFQYPVEIPG+    FL+ ++N  RK R +  L   
Sbjct: 59  DVTFKGKDLLELAPEERAGEGVFLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQPALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEP+LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIALLDMPTDLLTRSVNVGFSGGEKKRNDILQMAALEPTLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   R+F+I+THYQR+L+YIKPD +HVL  G+I+K+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRDGKRAFIIVTHYQRILDYIKPDYVHVLSQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLAEQ 247


>gi|295689539|ref|YP_003593232.1| FeS assembly ATPase SufC [Caulobacter segnis ATCC 21756]
 gi|295431442|gb|ADG10614.1| FeS assembly ATPase SufC [Caulobacter segnis ATCC 21756]
          Length = 249

 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 176/247 (71%), Gaps = 2/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A++   D  I++G+ L V   EV AIMGPNG+GKSTLSY+L+G   YE+T G
Sbjct: 1   MLSIKNLHARV--EDKPILKGVTLDVPAGEVHAIMGPNGAGKSTLSYVLTGRDGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L     ERA+KG+FL+FQYP+EIPG+  + F++ ALN QR+AR E E+  P
Sbjct: 59  SATLNGEDVLSLEPNERAAKGLFLSFQYPLEIPGVPALTFIRTALNAQRRARGEDEVAAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  ++  A L I+ +MLKR LN+GFSGGEKK  EI QM +L P   ILDETDSGLDI
Sbjct: 119 AFLKLAKEKAAALKIDFEMLKRGLNVGFSGGEKKRMEIFQMSMLSPKFLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS +R  L+ITHYQRLL++IKPD +HVL  G+I+ +G   +AL LE 
Sbjct: 179 DALKIVSEGVNALRSPERGMLVITHYQRLLDHIKPDKVHVLAAGRIVASGGPELALQLEA 238

Query: 241 NGYAELI 247
            GY  ++
Sbjct: 239 EGYDRIV 245


>gi|16760536|ref|NP_456153.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141703|ref|NP_805045.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213053497|ref|ZP_03346375.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213428571|ref|ZP_03361321.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213581032|ref|ZP_03362858.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213649928|ref|ZP_03379981.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289825919|ref|ZP_06545078.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25384388|pir||AI0702 probable ABC transport ATP-binding chain STY1752 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16502832|emb|CAD01994.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29137331|gb|AAO68894.1| putative ABC transport ATP-binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 248

 Score =  278 bits (712), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   +  I+RGLNL + P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EEKAILRGLNLDIRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R +  L   
Sbjct: 59  SVTFKGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRAYRGQASLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALR   R+F+I+THYQR+L+YIKPD +HVL+ G+I+++GD+++   LEE
Sbjct: 179 DALKIVAEGVNALRDDKRAFIIVTHYQRILDYIKPDYVHVLYQGRIVRSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|108807742|ref|YP_651658.1| cysteine desulfurase ATPase component [Yersinia pestis Antiqua]
 gi|108812019|ref|YP_647786.1| cysteine desulfurase ATPase component [Yersinia pestis Nepal516]
 gi|145598049|ref|YP_001162125.1| cysteine desulfurase ATPase component [Yersinia pestis Pestoides F]
 gi|149365688|ref|ZP_01887723.1| putative ATP-dependent transporter [Yersinia pestis CA88-4125]
 gi|161484816|ref|NP_669251.2| cysteine desulfurase ATPase component [Yersinia pestis KIM 10]
 gi|161511368|ref|NP_993519.2| cysteine desulfurase ATPase [Yersinia pestis biovar Microtus str.
           91001]
 gi|162420792|ref|YP_001607001.1| cysteine desulfurase ATPase component [Yersinia pestis Angola]
 gi|165927465|ref|ZP_02223297.1| FeS assembly ATPase SufC [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939513|ref|ZP_02228059.1| FeS assembly ATPase SufC [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011793|ref|ZP_02232691.1| FeS assembly ATPase SufC [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211181|ref|ZP_02237216.1| FeS assembly ATPase SufC [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400729|ref|ZP_02306235.1| FeS assembly ATPase SufC [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422139|ref|ZP_02313892.1| FeS assembly ATPase SufC [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425036|ref|ZP_02316789.1| FeS assembly ATPase SufC [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167471029|ref|ZP_02335733.1| FeS assembly ATPase SufC [Yersinia pestis FV-1]
 gi|218929492|ref|YP_002347367.1| cysteine desulfurase ATPase component [Yersinia pestis CO92]
 gi|229837927|ref|ZP_04458086.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229895087|ref|ZP_04510263.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis Pestoides A]
 gi|229898488|ref|ZP_04513633.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229902331|ref|ZP_04517451.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis Nepal516]
 gi|270490489|ref|ZP_06207563.1| FeS assembly ATPase SufC [Yersinia pestis KIM D27]
 gi|294503594|ref|YP_003567656.1| putative ATP-dependent transporter [Yersinia pestis Z176003]
 gi|108775667|gb|ABG18186.1| Iron-regulated ABC transporter ATPase subunit SufC [Yersinia pestis
           Nepal516]
 gi|108779655|gb|ABG13713.1| Iron-regulated ABC transporter ATPase subunit SufC [Yersinia pestis
           Antiqua]
 gi|115348103|emb|CAL21030.1| putative ATP-dependent transporter [Yersinia pestis CO92]
 gi|145209745|gb|ABP39152.1| Iron-regulated ABC transporter ATPase subunit SufC [Yersinia pestis
           Pestoides F]
 gi|149292101|gb|EDM42175.1| putative ATP-dependent transporter [Yersinia pestis CA88-4125]
 gi|162353607|gb|ABX87555.1| FeS assembly ATPase SufC [Yersinia pestis Angola]
 gi|165912562|gb|EDR31193.1| FeS assembly ATPase SufC [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920520|gb|EDR37797.1| FeS assembly ATPase SufC [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989258|gb|EDR41559.1| FeS assembly ATPase SufC [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166208361|gb|EDR52841.1| FeS assembly ATPase SufC [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958951|gb|EDR55972.1| FeS assembly ATPase SufC [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049582|gb|EDR60990.1| FeS assembly ATPase SufC [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056223|gb|EDR66001.1| FeS assembly ATPase SufC [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229680666|gb|EEO76762.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis Nepal516]
 gi|229688036|gb|EEO80107.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229694293|gb|EEO84340.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229701849|gb|EEO89872.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis Pestoides A]
 gi|262361636|gb|ACY58357.1| putative ATP-dependent transporter [Yersinia pestis D106004]
 gi|262365622|gb|ACY62179.1| putative ATP-dependent transporter [Yersinia pestis D182038]
 gi|270338993|gb|EFA49770.1| FeS assembly ATPase SufC [Yersinia pestis KIM D27]
 gi|294354053|gb|ADE64394.1| putative ATP-dependent transporter [Yersinia pestis Z176003]
 gi|320015057|gb|ADV98628.1| transport protein associated with Fe-S cluster assembly [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 248

 Score =  278 bits (712), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+     L+ ++N  RK R +  L   
Sbjct: 59  EVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFLLQTSVNAVRKYRQQAPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF+  + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+++RSF+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|312172292|emb|CBX80549.1| FeS assembly ATPase SufC [Erwinia amylovora ATCC BAA-2158]
          Length = 248

 Score =  278 bits (712), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGLNL+++P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVQFKGKDLLELAPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFKDFIEEKIHLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKIVSHGVNSLRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|114569867|ref|YP_756547.1| FeS assembly ATPase SufC [Maricaulis maris MCS10]
 gi|114340329|gb|ABI65609.1| FeS assembly ATPase SufC [Maricaulis maris MCS10]
          Length = 254

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 136/252 (53%), Positives = 184/252 (73%), Gaps = 3/252 (1%)

Query: 1   MLEIKNLRAKIVDTDTE---IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           ML+I +L+ K+   D E   I++GL+L+V   EV AIMGPNGSGKSTLSY+L+G   YE+
Sbjct: 1   MLKINDLKCKVETQDGEEKAILKGLSLEVPAGEVHAIMGPNGSGKSTLSYVLTGRDGYEV 60

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T G++ +  E + + +  ERA+ G++L+FQYPVEIPG+  + FLK ALN QR  R E+E+
Sbjct: 61  TGGEMRFADEDLAELAPEERAALGLYLSFQYPVEIPGVPTITFLKEALNAQRATRGEEEV 120

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
             P+F + +R    +L ++MDMLKR +N+GFSGGEKK  EILQ  +LEP   ILDETDSG
Sbjct: 121 TAPEFMKLIRAKAKQLNVSMDMLKRAVNVGFSGGEKKRMEILQALVLEPKFLILDETDSG 180

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALKI + GVNALRS +R  L+ITHYQRLL++I PD +HV+ NG+I+K+G   +A +
Sbjct: 181 LDIDALKIVSDGVNALRSPERGMLVITHYQRLLDHITPDVVHVMANGRIVKSGGPELARE 240

Query: 238 LEENGYAELIKE 249
           LE  GY + + E
Sbjct: 241 LEAEGYDKYLGE 252


>gi|78484925|ref|YP_390850.1| FeS assembly ATPase SufC [Thiomicrospira crunogena XCL-2]
 gi|78363211|gb|ABB41176.1| Iron-regulated ABC transporter ATPase subunit SufC [Thiomicrospira
           crunogena XCL-2]
          Length = 261

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 186/249 (74%), Gaps = 1/249 (0%)

Query: 1   MLEIKNLRAKIV-DTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA 59
           +L+++NL A++  D   +I++GLNL+V+P EV AIMGPNG+GKSTLS +L+G +DYE+T 
Sbjct: 2   LLKVENLHAQVAEDESKQILKGLNLEVKPGEVHAIMGPNGAGKSTLSSVLAGREDYEVTE 61

Query: 60  GDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLI 119
           G  ++ GE +L+    +RA KG+FLAFQYPVEIPG+    F++ A+N  R+      L +
Sbjct: 62  GSAIFNGEDLLELDPEDRARKGVFLAFQYPVEIPGVSNKLFMQTAVNAIREENGLPVLDM 121

Query: 120 PDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD 179
            DF    +     L +  D+L R +N+GFSGGEKK  +I QM LLEP LCILDETDSGLD
Sbjct: 122 FDFDEYAQAKIDLLNMRKDLLDRSVNVGFSGGEKKRNDIFQMALLEPKLCILDETDSGLD 181

Query: 180 IDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           IDA+K+ A GVN+LR++DRSF+++THYQRLL+YIKPD +HVL++GKIIK+G + +  +LE
Sbjct: 182 IDAMKVVANGVNSLRTKDRSFIVVTHYQRLLDYIKPDYVHVLYDGKIIKSGGFELVHELE 241

Query: 240 ENGYAELIK 248
           E GY ++I+
Sbjct: 242 EKGYDDIIQ 250


>gi|21958757|gb|AAM85502.1|AE013796_5 putative ATP-binding component of a transport system [Yersinia
           pestis KIM 10]
 gi|45436843|gb|AAS62396.1| putative ATP-dependent transporter [Yersinia pestis biovar Microtus
           str. 91001]
          Length = 257

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 10  MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 67

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+     L+ ++N  RK R +  L   
Sbjct: 68  EVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFLLQTSVNAVRKYRQQAPLDRF 127

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF+  + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 128 DFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 187

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+++RSF+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 188 DALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 247

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 248 QGYGWLTDQ 256


>gi|261339558|ref|ZP_05967416.1| FeS assembly ATPase SufC [Enterobacter cancerogenus ATCC 35316]
 gi|288318375|gb|EFC57313.1| FeS assembly ATPase SufC [Enterobacter cancerogenus ATCC 35316]
          Length = 248

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D EI+RGLN  V+P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKEILRGLNFNVKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTHG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  RK R    L   
Sbjct: 59  AVEFNGKDLLEMSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRKYRGLDALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 DFQDLMEEKIKLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR  +RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVADGVNSLRDGNRSFIIVTHYQRILDYIKPDFVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|238749443|ref|ZP_04610948.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           rohdei ATCC 43380]
 gi|238712098|gb|EEQ04311.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           rohdei ATCC 43380]
          Length = 248

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+    +RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVTFKGKDLLELDPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF+  + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFSDFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+++R+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNENRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|238787122|ref|ZP_04630922.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           frederiksenii ATCC 33641]
 gi|238724910|gb|EEQ16550.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           frederiksenii ATCC 33641]
          Length = 248

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+    +RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVTFKGKDLLELDPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR ++R+F+I+THYQR+L+Y+KPD +HVL+ GKIIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRDENRAFIIVTHYQRILDYVKPDFVHVLYQGKIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|223936060|ref|ZP_03627974.1| FeS assembly ATPase SufC [bacterium Ellin514]
 gi|223895282|gb|EEF61729.1| FeS assembly ATPase SufC [bacterium Ellin514]
          Length = 256

 Score =  278 bits (711), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 140/247 (56%), Positives = 185/247 (74%), Gaps = 2/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL A +   D +I++G+NL + P EV A+MGPNGSGKSTL+ +L+G + Y++T G
Sbjct: 5   LLEIKNLHAGV--DDKKILKGINLTINPGEVHAVMGPNGSGKSTLASILAGREGYDVTEG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +LY G+ +L+    ERA +G+FLAFQYPVEIPG+    FLK ALNE RK +   EL   
Sbjct: 63  QVLYDGKDLLEMDPEERAREGVFLAFQYPVEIPGVNSTYFLKAALNEIRKHKGLPELDAM 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++    L +  D+LKRP+N GFSGGEKK  EI QM +LEP L +LDETDSGLDI
Sbjct: 123 EFLQLVKQKVKLLELPEDLLKRPVNEGFSGGEKKRNEIFQMAVLEPKLSVLDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN L+S++ + L+ITHYQRLL+YI PD +HVL+NGKI+KTGD S+AL+LE+
Sbjct: 183 DALKVVANGVNKLKSKNNAQLVITHYQRLLDYIIPDFVHVLYNGKIVKTGDKSLALELEK 242

Query: 241 NGYAELI 247
            GY  +I
Sbjct: 243 RGYDWVI 249


>gi|322833500|ref|YP_004213527.1| FeS assembly ATPase SufC [Rahnella sp. Y9602]
 gi|321168701|gb|ADW74400.1| FeS assembly ATPase SufC [Rahnella sp. Y9602]
          Length = 248

 Score =  278 bits (710), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+ ++   + EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKNLKVRV--EEKEILKGLDLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +++ G+ +L+ +  +RA +G+F+AFQYPVEIPG+    FL+ A+N  RK R ++ +   
Sbjct: 59  SVIFNGKDLLELAPEDRAGEGVFMAFQYPVEIPGVTNHFFLQTAVNAVRKYRGQEPMDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEP+LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIAMLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPNLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVSDGVNTLRDGKRSFVIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|85059411|ref|YP_455113.1| cysteine desulfurase ATPase component [Sodalis glossinidius str.
           'morsitans']
 gi|84779931|dbj|BAE74708.1| putative ABC transporter ATP-binding component [Sodalis
           glossinidius str. 'morsitans']
          Length = 248

 Score =  278 bits (710), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I++GLNL+V+P EV AIMGPNGSGKSTLS  L+G +DY++T+G
Sbjct: 1   MLSIKDLNVSV--EDNAILKGLNLEVKPGEVHAIMGPNGSGKSTLSATLAGSEDYKVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+++KG  +L     ERA KG+F+AFQYPVEIPG+    FL+ A+N  RK R +  L   
Sbjct: 59  DVMFKGRDLLALEPEERAGKGVFMAFQYPVEIPGVSNQFFLQTAVNAVRKYREQPPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIDAKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A G+N LR   RSF+I+THYQR+L+YI+PD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVAHGINTLRDGKRSFIIVTHYQRILDYIQPDHVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|238796353|ref|ZP_04639862.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           mollaretii ATCC 43969]
 gi|238719798|gb|EEQ11605.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           mollaretii ATCC 43969]
          Length = 248

 Score =  278 bits (710), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF+  + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFSDFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR++ R+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNEKRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|16126105|ref|NP_420669.1| ABC transporter ATP-binding protein [Caulobacter crescentus CB15]
 gi|221234875|ref|YP_002517311.1| ATP-dependent transporter SufC [Caulobacter crescentus NA1000]
 gi|13423305|gb|AAK23837.1| ABC transporter, ATP-binding protein [Caulobacter crescentus CB15]
 gi|220964047|gb|ACL95403.1| ATP-dependent transporter sufC [Caulobacter crescentus NA1000]
          Length = 249

 Score =  278 bits (710), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 177/247 (71%), Gaps = 2/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A++   D  I+RG+ L V   EV AIMGPNG+GKSTLSY+L+G   YE+T G
Sbjct: 1   MLKIQNLHARV--EDKPILRGVTLDVPAGEVHAIMGPNGAGKSTLSYVLTGRDGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                GE +L     ERA+KG+FL+FQYP+EIPG+  + F++ ALN QR+AR E E+  P
Sbjct: 59  SASLNGEDLLALEPNERAAKGLFLSFQYPLEIPGVPALTFIRTALNAQRRARGEDEIAAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  ++  A L I+ +MLKR LN+GFSGGEKK  EI QM +L P   ILDETDSGLDI
Sbjct: 119 AFLKLAKEKAASLKIDFEMLKRGLNVGFSGGEKKRMEIFQMSMLSPKFLILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS +R  L+ITHYQRLL++IKPD +HVL  G+I+ +G   +AL LE 
Sbjct: 179 DALKIVSEGVNALRSPERGMLVITHYQRLLDHIKPDKVHVLAAGRIVASGGPELALQLEA 238

Query: 241 NGYAELI 247
            GY  ++
Sbjct: 239 EGYDRIV 245


>gi|324113447|gb|EGC07422.1| FeS assembly ATPase SufC [Escherichia fergusonii B253]
          Length = 248

 Score =  278 bits (710), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+TAG
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|323968449|gb|EGB63855.1| FeS assembly ATPase SufC [Escherichia coli M863]
 gi|327252799|gb|EGE64453.1| feS assembly ATPase SufC [Escherichia coli STEC_7v]
          Length = 248

 Score =  277 bits (709), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+TAG
Sbjct: 1   MLSIKDLHVSV--EDKTILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|304311760|ref|YP_003811358.1| FeS assembly ATPase [gamma proteobacterium HdN1]
 gi|301797493|emb|CBL45713.1| FeS assembly ATPase [gamma proteobacterium HdN1]
          Length = 251

 Score =  277 bits (709), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A++     +I+ GLNL+V+P EV AIMGPNGSGKSTL+ +L+G   YE+T G
Sbjct: 1   MLTIKNLTAQV--DGKKILNGLNLQVKPGEVHAIMGPNGSGKSTLANVLAGRAGYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           + L++G+++L+ S   RA +G+FLAFQYPVEIPG+  +QFLK A++  R  R +  L   
Sbjct: 59  EALFEGKNLLELSPDVRAREGLFLAFQYPVEIPGVTNLQFLKAAVDAMRHHRGQTPLDAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F R  R+    L +N D LKR +N GFSGGEKK  EILQM LLEP L +LDETDSGLDI
Sbjct: 119 AFMRLAREKCKGLALNPDFLKRGVNEGFSGGEKKRNEILQMALLEPKLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+IAA+GVNA RS +R+ ++ITHYQRLL+YI PD +HVL  G+IIK+G   +AL+LE+
Sbjct: 179 DALQIAAEGVNAFRSPERAVVLITHYQRLLDYIVPDYVHVLAQGRIIKSGTRELALELED 238

Query: 241 NGYAELIKE 249
            GY+ +++E
Sbjct: 239 KGYSWVLEE 247


>gi|254282508|ref|ZP_04957476.1| FeS assembly ATPase SufC [gamma proteobacterium NOR51-B]
 gi|219678711|gb|EED35060.1| FeS assembly ATPase SufC [gamma proteobacterium NOR51-B]
          Length = 259

 Score =  277 bits (709), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 183/246 (74%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A+I   D  I++GLNL+V P EV AIMGPNGSGKSTL ++L+G   YE+T G
Sbjct: 12  MLNINNLHARI--DDKAILKGLNLEVNPGEVHAIMGPNGSGKSTLGHVLAGRPGYEVTEG 69

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +   G+ +L+     RA  G+FLAFQYPVEIPG+  M+FLK +++  R+AR    +   
Sbjct: 70  GVTLLGQDLLELDTEARAHLGLFLAFQYPVEIPGVSNMEFLKASVDAVREARGLDSIDSV 129

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R+++ ++ ++ + LKR +N GFSGGEKK  E++QM +LEP LCILDETDSGLDI
Sbjct: 130 SFMKHAREVSKQVDLDPNFLKRGVNEGFSGGEKKRNELMQMMMLEPKLCILDETDSGLDI 189

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVNA+R+ DRSF+++THYQRLL+YI+PD +HVL  G+IIK+GD ++AL+LEE
Sbjct: 190 DALQVVAKGVNAMRADDRSFVLVTHYQRLLDYIEPDFVHVLAGGRIIKSGDKTLALELEE 249

Query: 241 NGYAEL 246
            GY  L
Sbjct: 250 KGYGWL 255


>gi|296116550|ref|ZP_06835160.1| FeS assembly ATPase SufC [Gluconacetobacter hansenii ATCC 23769]
 gi|295976762|gb|EFG83530.1| FeS assembly ATPase SufC [Gluconacetobacter hansenii ATCC 23769]
          Length = 257

 Score =  277 bits (709), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 183/251 (72%), Gaps = 2/251 (0%)

Query: 1   MLEIKNLRAKIVDTDT--EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEIT 58
            + I  L A+I D  T  EI+RG++L++   EV AIMGPNGSGKSTLSY+L+G +DYE+T
Sbjct: 5   FVRIDGLCARISDAGTPKEILRGVDLEIPAGEVHAIMGPNGSGKSTLSYVLAGREDYEVT 64

Query: 59  AGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELL 118
            G   +KG+ +L     ERA+ G+FLAFQ PVE+PG+    FL+ A+N  R+AR ++EL 
Sbjct: 65  GGSASFKGQDLLALEPEERAALGLFLAFQAPVELPGVNNANFLRTAVNAVRRARGQEELD 124

Query: 119 IPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGL 178
              F + VRK T  L ++ DMLKR +N+GFSGGEKK  E+LQMR+L+PS  ILDETDSGL
Sbjct: 125 AVGFLKAVRKETKHLSMSDDMLKRNVNVGFSGGEKKRNEVLQMRMLQPSFAILDETDSGL 184

Query: 179 DIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDL 238
           DIDAL+I A+GVN+LRS D S L+ITH+QRLL+YI PD IHV+  G+II +G   +A +L
Sbjct: 185 DIDALRIVAEGVNSLRSPDFSALVITHHQRLLDYIVPDRIHVMAKGRIIHSGGPELAREL 244

Query: 239 EENGYAELIKE 249
           E  GYA+ + E
Sbjct: 245 EAQGYAKFLAE 255


>gi|213962909|ref|ZP_03391169.1| FeS assembly ATPase SufC [Capnocytophaga sputigena Capno]
 gi|213954566|gb|EEB65888.1| FeS assembly ATPase SufC [Capnocytophaga sputigena Capno]
          Length = 246

 Score =  277 bits (709), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 186/243 (76%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G++L+++  EV AIMGPNG+GKSTLS ++SG++++E+T G
Sbjct: 1   MLIIKNLHAGV--DGKEILKGIDLEIKAGEVHAIMGPNGAGKSTLSSVISGNENFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL +GES+L+ +  ERA KGIF++FQYPVEIPGI +  F+K A+NE RKA+   ++   
Sbjct: 59  DILLEGESLLEDAPEERAHKGIFMSFQYPVEIPGISVTNFIKTAINESRKAKGLPDMPAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+  A L IN D L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 ELLKKIREKAALLEINPDFLSRSLNQGFSGGEKKRNEIFQMAMLEPKVAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++++ + L+ITHYQRLL+YI PD +HVL +GKI+KTGD ++AL+LE 
Sbjct: 179 DALRIVANGVNKLKNENNAVLVITHYQRLLDYIVPDYVHVLSDGKIVKTGDKNLALELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|268592597|ref|ZP_06126818.1| FeS assembly ATPase SufC [Providencia rettgeri DSM 1131]
 gi|291312011|gb|EFE52464.1| FeS assembly ATPase SufC [Providencia rettgeri DSM 1131]
          Length = 248

 Score =  277 bits (709), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +K+L   +     EI++GL+L+V+P EV AIMGPNGSGKSTLS  L+G ++YEI +G
Sbjct: 1   MLSVKDLHVSV--EGNEILKGLSLEVKPGEVHAIMGPNGSGKSTLSATLAGREEYEIDSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ + +    ERA +G+FLAFQYPVEIPG+    FL+ A+N  R+ R ++ L   
Sbjct: 59  EVTFKGKDLFELDPEERAGEGVFLAFQYPVEIPGVSNQFFLQTAVNAVREYRQQEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEDKIKLLEMPEDLLARSVNVGFSGGEKKRNDILQMAALEPQLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LRS +RSF+I+THYQR+L+Y+KPD +HVL+ GKIIK+GD+S+A  LEE
Sbjct: 179 DALKIVANGVNSLRSPERSFIIVTHYQRILDYVKPDFVHVLYQGKIIKSGDFSLAKKLEE 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 QGYGWLIDQ 247


>gi|238782565|ref|ZP_04626596.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           bercovieri ATCC 43970]
 gi|238716492|gb|EEQ08473.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           bercovieri ATCC 43970]
          Length = 248

 Score =  277 bits (709), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVEFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF+  + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFSDFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR++ R+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNEQRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|288940480|ref|YP_003442720.1| FeS assembly ATPase SufC [Allochromatium vinosum DSM 180]
 gi|288895852|gb|ADC61688.1| FeS assembly ATPase SufC [Allochromatium vinosum DSM 180]
          Length = 250

 Score =  277 bits (709), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 177/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +K LRA +   D EI++GL+L+V P EV AIMGPNGSGKSTLS++LSG   Y +TAG
Sbjct: 1   MLSVKGLRANV--GDKEILKGLDLEVGPGEVHAIMGPNGSGKSTLSHVLSGRDGYSVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G  +L+    ERA  G+FLAFQYPVE+PG+    FLK ALN  RKAR E EL   
Sbjct: 59  SATFAGRDLLELEPEERAQLGLFLAFQYPVELPGVNNTYFLKAALNSIRKARGESELDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F R +++    L ++  +LKR +N GFSGGEKK  EI QM LLEP L ILDETDSGLDI
Sbjct: 119 SFLRLIKEKLKILHLDDSLLKRAVNAGFSGGEKKRNEIFQMALLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVNALRS +RS +++THYQRLL+YI+PD +HVL  G+II++G   +AL+LEE
Sbjct: 179 DALRVVAEGVNALRSPERSMIVVTHYQRLLDYIQPDYVHVLARGRIIRSGGKELALELEE 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 KGYG 242


>gi|329895578|ref|ZP_08271074.1| Iron-sulfur cluster assembly ATPase protein SufC [gamma
           proteobacterium IMCC3088]
 gi|328922257|gb|EGG29607.1| Iron-sulfur cluster assembly ATPase protein SufC [gamma
           proteobacterium IMCC3088]
          Length = 248

 Score =  277 bits (709), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK LRA + D D  I++GL+L V P EV AIMGPNG+GKSTL ++LSG   YE+ +G
Sbjct: 1   MLSIKELRASVEDKD--ILQGLSLDVGPGEVHAIMGPNGAGKSTLGHVLSGRPGYEVVSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G  +      ERA  G+FLAFQYPVEIPG+  M+FLK +++  R+A++ + L   
Sbjct: 59  SVDFDGRDLFAMETEERAQAGLFLAFQYPVEIPGVSNMEFLKASVDAVREAKSLEALDSV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++ R+    + +++D LKR +N GFSGGEKK  E++QM LLEP LCILDETDSGLDI
Sbjct: 119 SFMKRAREACKAVNLSVDFLKRGVNEGFSGGEKKRNELMQMMLLEPKLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVNA+RS DRSF+++THYQRLL+YI+PD +HVL  G+I+++G   +AL+LE 
Sbjct: 179 DALQVVAAGVNAMRSADRSFIVVTHYQRLLDYIEPDFVHVLAGGRIVRSGGKELALELES 238

Query: 241 NGYAEL 246
            GYA L
Sbjct: 239 KGYAWL 244


>gi|256820068|ref|YP_003141347.1| FeS assembly ATPase SufC [Capnocytophaga ochracea DSM 7271]
 gi|256581651|gb|ACU92786.1| FeS assembly ATPase SufC [Capnocytophaga ochracea DSM 7271]
          Length = 246

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 184/243 (75%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G++L+++  EV AIMGPNG+GKSTLS +++G++++E+T G
Sbjct: 1   MLIIKNLHAGV--DGKEILKGIDLEIKAGEVHAIMGPNGAGKSTLSAVIAGNENFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL  GES+L+ +  ERA KGIF++FQYPVEIPGI +  F+K A+NE RKA+   ++   
Sbjct: 59  DILLNGESLLEDAPEERAHKGIFMSFQYPVEIPGISVTNFIKTAINESRKAQGLPDMPAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+    L IN D L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 ELLKKIREKATLLEINPDFLSRSLNQGFSGGEKKRNEIFQMAMLEPKIAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + L+ITHYQRLL+YI PD +HVL +GKI+KTGD ++AL+LE 
Sbjct: 179 DALRIVANGVNKLKSKDNAVLVITHYQRLLDYIVPDYVHVLSDGKIVKTGDKTLALELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|209963827|ref|YP_002296742.1| FeS assembly ATPase SufC [Rhodospirillum centenum SW]
 gi|209957293|gb|ACI97929.1| FeS assembly ATPase SufC [Rhodospirillum centenum SW]
          Length = 252

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 180/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL A +      I++G++L +EP  V AIMGPNGSGKSTLSY+L+G + YE+T G
Sbjct: 3   LLEIKNLHATV--DGKPILKGIDLTIEPGTVHAIMGPNGSGKSTLSYVLAGREGYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +L  GE +L     ERA+ G+FLAFQYPVEIPG+    FLK ALN  RKA+ EKEL   
Sbjct: 61  SVLLDGEDLLAKEAEERAAAGVFLAFQYPVEIPGVSNTTFLKEALNALRKAKGEKELDAM 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + +R+    L +  +M++R +N+GFSGGEKK  E+LQM +LEP L ILDETDSGLDI
Sbjct: 121 QFLKLIRQKAGALNMTDEMIRRAVNVGFSGGEKKRNEVLQMAVLEPKLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR  DRS L+ITHYQRLL+YI PD +HVL +G+I KTG   +AL+LE+
Sbjct: 181 DALKIVADGVNSLRRPDRSMLVITHYQRLLDYIVPDVVHVLAHGRIQKTGGKELALELEQ 240

Query: 241 NGYAEL 246
            GYAE 
Sbjct: 241 KGYAEF 246


>gi|21232198|ref|NP_638115.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767673|ref|YP_242435.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21113954|gb|AAM42039.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573005|gb|AAY48415.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 254

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL A I   D  I++GL+L ++P +V AIMGPNG+GKSTL  +L+G   Y +TAG
Sbjct: 1   MLNIQNLHASIAGKD--ILKGLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYAVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G  +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 59  SVQFEGADLLDLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEEELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL +G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSTERSFLVITHYQRLLDYIKPDVVHVLSDGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|319786704|ref|YP_004146179.1| FeS assembly ATPase SufC [Pseudoxanthomonas suwonensis 11-1]
 gi|317465216|gb|ADV26948.1| FeS assembly ATPase SufC [Pseudoxanthomonas suwonensis 11-1]
          Length = 254

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 140/246 (56%), Positives = 184/246 (74%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A +     EI++GL+L+V+P +V AIMGPNG+GKSTL  +L+G   YE+TAG
Sbjct: 1   MLKIENLHASV--AGKEILKGLSLEVKPGQVHAIMGPNGAGKSTLGNILAGRDGYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++L+    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRK R ++EL   
Sbjct: 59  SVEFDGQALLELEPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKVRGQEELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVREKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS  RSFL+ITHYQRLL+YIKPD +HVL +G+I++TG   +AL+LE+
Sbjct: 179 DALKTVADGVNALRSDGRSFLVITHYQRLLDYIKPDVVHVLADGRIVQTGGPELALELEK 238

Query: 241 NGYAEL 246
           +GYA L
Sbjct: 239 HGYAWL 244


>gi|152970688|ref|YP_001335797.1| cysteine desulfurase ATPase component [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238895189|ref|YP_002919924.1| cysteine desulfurase ATPase component [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262044175|ref|ZP_06017247.1| FeS assembly ATPase SufC [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330012603|ref|ZP_08307438.1| FeS assembly ATPase SufC [Klebsiella sp. MS 92-3]
 gi|150955537|gb|ABR77567.1| putative ATP-binding component of a transport system [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238547506|dbj|BAH63857.1| putative ATP-binding component of a transport system [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259038472|gb|EEW39671.1| FeS assembly ATPase SufC [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328533762|gb|EGF60451.1| FeS assembly ATPase SufC [Klebsiella sp. MS 92-3]
          Length = 248

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I++L   +   D  I+RGLNL+V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIQDLHVAV--EDKAILRGLNLEVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+++L+ +  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  RVEFKGKNLLELAAEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRNYRGQEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIKLLQMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI +QGVNALR   R+F+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSQGVNALRDGKRAFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|238753646|ref|ZP_04615008.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           ruckeri ATCC 29473]
 gi|238708198|gb|EEQ00554.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           ruckeri ATCC 29473]
          Length = 248

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL   +     EI++GL+L ++P EV AIMGPNGSGKSTLS  L+G ++Y++T G
Sbjct: 1   MLSIKNLTVSV--EGNEILKGLDLDIKPGEVHAIMGPNGSGKSTLSATLAGREEYDVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++KG+++LD     RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  EVIFKGKNLLDLDPEARAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRAQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIALLQMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR++ R+F+I+THYQR+L+Y+KPD +HVL+ GKIIK+GD+S+   LEE
Sbjct: 179 DALKIVANGVNSLRNEKRAFIIVTHYQRILDYVKPDFVHVLYQGKIIKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|238757751|ref|ZP_04618934.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           aldovae ATCC 35236]
 gi|238703994|gb|EEP96528.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           aldovae ATCC 35236]
          Length = 248

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL   +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLNVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+++L+ +  +RA +G+FLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVTFKGKNLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR ++R+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRDENRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|190573180|ref|YP_001971025.1| putative ABC transporter ATP-binding protein [Stenotrophomonas
           maltophilia K279a]
 gi|190011102|emb|CAQ44711.1| putative ABC transporter, ATP-binding protein [Stenotrophomonas
           maltophilia K279a]
          Length = 254

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 179/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A+I   D EI++GL+L+V+P +V AIMGPNG+GKSTL  +L+G   YE+T G
Sbjct: 1   MLKIENLHARI--GDKEILKGLSLEVKPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G  +L+     RA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  SVQFDGVGLLEQDPEARAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALR  DRSFL+ITHYQRLL+YIKPD +HVL +G+I+KTG   +AL+LE 
Sbjct: 179 DALKSVADGVNALRGADRSFLVITHYQRLLDYIKPDVVHVLADGRIVKTGGPELALELEA 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|119476387|ref|ZP_01616738.1| Cysteine desulfurase activator ATPase [marine gamma proteobacterium
           HTCC2143]
 gi|119450251|gb|EAW31486.1| Cysteine desulfurase activator ATPase [marine gamma proteobacterium
           HTCC2143]
          Length = 259

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 177/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +   D  I+ GL+L ++P EV AIMGPNG+GKSTL Y++SG + Y +  G
Sbjct: 3   MLSIKNLHASV--EDKTILNGLDLDIKPGEVHAIMGPNGAGKSTLGYVVSGREGYNVEQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             +  G  +L+    ERA  G+FLAFQYPVEIPG+  M+F+K +++ QR+AR E  L   
Sbjct: 61  TAVLDGVELLELDAEERARAGLFLAFQYPVEIPGVSNMEFMKASVDAQREARGEAALSSR 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF    ++  +++ + +  LKR +N GFSGGEKK  EI+QM LLEP LCILDE+DSGLDI
Sbjct: 121 DFLTMAKEACSKVQLPLAFLKRGVNEGFSGGEKKRNEIMQMLLLEPKLCILDESDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+LRS DRSF++ITHYQRLL+YIKPD +HVL  GKIIKTG   +A +LE 
Sbjct: 181 DALQVVADGVNSLRSDDRSFIVITHYQRLLDYIKPDFVHVLSEGKIIKTGGAELAHELEA 240

Query: 241 NGYAEL 246
            GYA L
Sbjct: 241 QGYAWL 246


>gi|283785088|ref|YP_003364953.1| ABC transporter ATP-binding protein [Citrobacter rodentium ICC168]
 gi|282948542|emb|CBG88132.1| ABC transport ATP-binding protein (component of SufBCD complex)
           [Citrobacter rodentium ICC168]
          Length = 248

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGLNL+V P EV AIMGPNGSGKSTLS  L+G +DY++T G
Sbjct: 1   MLNIKDLQISV--EDKAILRGLNLEVRPGEVHAIMGPNGSGKSTLSATLAGREDYDVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  SVEFKGKDLLELAPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|188533954|ref|YP_001907751.1| cysteine desulfurase ATPase component [Erwinia tasmaniensis Et1/99]
 gi|188028996|emb|CAO96864.1| Probable ABC transporter ATP-dependent protein [Erwinia
           tasmaniensis Et1/99]
          Length = 248

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +   D  I+RGL+L+++P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKNLQVSV--EDKAILRGLDLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+    ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVEFKGKDLLELDPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEEKIHLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN LR   RSF+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKIVSNGVNTLRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|241668543|ref|ZP_04756121.1| SufS activator complex, SufC subunit [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254877078|ref|ZP_05249788.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254843099|gb|EET21513.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 249

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 181/246 (73%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   + +   +I++GLNLKV   EV AIMGPNG+GKSTLS +L+G   YEIT G
Sbjct: 2   LLEIKDLHVSVGEQKKQILKGLNLKVNKGEVHAIMGPNGAGKSTLSNVLAGKDGYEITQG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ + D SI ERA+ GIFL+ QYP+EIPG+  +QFLK A+N  RK   E+E+   
Sbjct: 62  SITFNGKDLDDLSISERAAAGIFLSLQYPIEIPGVSNVQFLKTAVNSIRKQNGEEEINAI 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +K++     L I+   + R +N GFSGGEKK  E+LQ+ +LEP L ILDETDSGLDI
Sbjct: 122 DFMKKLKANMQVLKIDQKYMSRGVNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ +QG N +RS +RSFL+ITHYQRLL++I+PD +HVL +GKI+KTG   +AL+LEE
Sbjct: 182 DALQVVSQGANTMRSPERSFLVITHYQRLLDHIQPDFVHVLADGKIVKTGGKELALELEE 241

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 242 KGYSWL 247


>gi|326334711|ref|ZP_08200918.1| FeS assembly ATPase SufC [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325693161|gb|EGD35093.1| FeS assembly ATPase SufC [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 249

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 185/243 (76%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G++L+++  EV AIMGPNG+GKSTLS +++G++++E+T G
Sbjct: 1   MLIIKNLHAGV--DGKEILKGIDLEIKAGEVHAIMGPNGAGKSTLSSVIAGNENFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GES+LD +  ERA KGIF++FQYPVEIPGI +  F+K A+NE RKA+   ++   
Sbjct: 59  EILLNGESLLDDAPEERAHKGIFMSFQYPVEIPGISVTNFIKTAINESRKAQGLPDIPAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+  A L IN D L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 ELLKKIREKAALLEINPDFLSRSLNQGFSGGEKKRNEIFQMAMLEPKIAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL+YI PD +HVL +G+I+KTGD ++AL+LE 
Sbjct: 179 DALRIVANGVNKLKSKDNAVIVITHYQRLLDYIVPDYVHVLSDGRIVKTGDKNLALELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|157370421|ref|YP_001478410.1| cysteine desulfurase ATPase [Serratia proteamaculans 568]
 gi|157322185|gb|ABV41282.1| FeS assembly ATPase SufC [Serratia proteamaculans 568]
          Length = 248

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL  K+     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+TAG
Sbjct: 1   MLSIKNL--KVSAEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+    FL+ ++N  RK R+++ L   
Sbjct: 59  EVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTSVNAVRKYRDQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLNMPPDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL  G+I+K+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLSQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|332878304|ref|ZP_08446030.1| FeS assembly ATPase SufC [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332683755|gb|EGJ56626.1| FeS assembly ATPase SufC [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 245

 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 185/243 (76%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G++L+++  EV AIMGPNG+GKSTLS ++SG++++E+T G
Sbjct: 1   MLIIKNLHAGV--DGKEILKGIDLEIKAGEVHAIMGPNGAGKSTLSSVISGNENFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL  GES+L+ +  ERA KGIF++FQYPVEIPGI +  F+K A+NE RKA+   ++   
Sbjct: 59  DILLNGESLLEDAPEERAHKGIFMSFQYPVEIPGISVTNFIKTAINESRKAQGLPDMPAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+  A L IN D L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 ELLKKIREKAALLEINPDFLSRSLNQGFSGGEKKRNEIFQMAMLEPKVAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++++ + L+ITHYQRLL+YI PD +HVL +GKI+KTGD ++AL+LE 
Sbjct: 179 DALRIVANGVNKLKNENNAVLVITHYQRLLDYIVPDYVHVLSDGKIVKTGDKNLALELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|157145962|ref|YP_001453281.1| cysteine desulfurase ATPase component [Citrobacter koseri ATCC
           BAA-895]
 gi|157083167|gb|ABV12845.1| hypothetical protein CKO_01715 [Citrobacter koseri ATCC BAA-895]
          Length = 248

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+  G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLDLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVVGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  SVEFKGKDLLELSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQESLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVAEGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|228471672|ref|ZP_04056445.1| FeS assembly ATPase SufC [Capnocytophaga gingivalis ATCC 33624]
 gi|228276825|gb|EEK15520.1| FeS assembly ATPase SufC [Capnocytophaga gingivalis ATCC 33624]
          Length = 246

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 186/243 (76%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G++L+++  EV AIMGPNG+GKSTLS +++G++++E+T G
Sbjct: 1   MLIIKNLHAGV--DGKEILKGIDLEIKAGEVHAIMGPNGAGKSTLSSVIAGNENFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL +GES+L+ +  ERA KGIF++FQYPVEIPGI +  F+K A+NE RKA+   ++   
Sbjct: 59  DILLEGESLLEDAPEERAHKGIFMSFQYPVEIPGISVTNFIKTAINESRKAKGLPDMPAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+  A L IN D L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 ELLKKIREKAALLEINPDFLSRSLNQGFSGGEKKRNEIFQMAMLEPKVAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++++ + L+ITHYQRLL+YI PD +HVL +GKI+KTGD ++AL+LE 
Sbjct: 179 DALRIVANGVNKLKNENNAVLVITHYQRLLDYIVPDYVHVLSDGKIVKTGDKNLALELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|259908556|ref|YP_002648912.1| cysteine desulfurase ATPase component [Erwinia pyrifoliae Ep1/96]
 gi|224964178|emb|CAX55685.1| Probable ABC transporter ATP-dependent protein [Erwinia pyrifoliae
           Ep1/96]
 gi|283478521|emb|CAY74437.1| FeS assembly ATPase SufC [Erwinia pyrifoliae DSM 12163]
 gi|310767545|gb|ADP12495.1| cysteine desulfurase ATPase component [Erwinia sp. Ejp617]
          Length = 248

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGLNL+++P EV AIMGPNGSGKSTLS  L+G +DY++T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYQVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R +  L   
Sbjct: 59  SVQFKGKDLLELAPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYRGKDALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFKDFIEEKIHLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|325497141|gb|EGC95000.1| cysteine desulfurase ATPase component [Escherichia fergusonii
           ECD227]
          Length = 248

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLNVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|254515562|ref|ZP_05127622.1| FeS assembly ATPase SufC [gamma proteobacterium NOR5-3]
 gi|219675284|gb|EED31650.1| FeS assembly ATPase SufC [gamma proteobacterium NOR5-3]
          Length = 249

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A++   D  I+RGLNL+V   EV AIMGPNGSGKSTL ++L+G   YE+T G
Sbjct: 1   MLKIENLHARVEGKD--ILRGLNLEVGAGEVHAIMGPNGSGKSTLGHVLAGRPGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + GE++L+    ER+  G+FLAFQYPVEIPG+  M+FLK +++  R+ R  +     
Sbjct: 59  SITFNGENLLELDTEERSRAGLFLAFQYPVEIPGVSNMEFLKASVDAVREHRGLEAQDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++ R+ +    +  D LKR +N GFSGGEKK  E++QM LLEP LC+LDETDSGLDI
Sbjct: 119 SFMKRAREASKAANLPADFLKRGVNEGFSGGEKKRNELIQMMLLEPRLCLLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ AQGVNA+RS DR+F+++THYQRLL++++PD +HVL  G+I+++GD  +AL LE+
Sbjct: 179 DALQVVAQGVNAMRSDDRAFVLVTHYQRLLDFVEPDRVHVLAEGRIVRSGDKELALHLED 238

Query: 241 NGYAELIKE 249
            GYA L  E
Sbjct: 239 KGYAWLEDE 247


>gi|323978181|gb|EGB73267.1| FeS assembly ATPase SufC [Escherichia coli TW10509]
          Length = 248

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+TAG
Sbjct: 1   MLSIKDLHVSV--EDKTILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|238791667|ref|ZP_04635304.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           intermedia ATCC 29909]
 gi|238728771|gb|EEQ20288.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           intermedia ATCC 29909]
          Length = 248

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+++L      RA +GIFLAFQYPVEIPG+    FL+ A+N  RK R ++ L   
Sbjct: 59  SVTFKGKNLLALDPENRAGEGIFLAFQYPVEIPGVSNHFFLQTAVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+++R+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNENRAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|312129603|ref|YP_003996943.1| iroN-regulated abc transporter atpase subunit sufc [Leadbetterella
           byssophila DSM 17132]
 gi|311906149|gb|ADQ16590.1| Iron-regulated ABC transporter ATPase subunit SufC [Leadbetterella
           byssophila DSM 17132]
          Length = 253

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 184/243 (75%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL+A++   + EI++G+NL+++P EV AIMGPNGSGKSTL+ +L+G   +E+T G
Sbjct: 1   MLSISNLQARV--ENKEILKGINLEIKPGEVHAIMGPNGSGKSTLASVLAGRDTFEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ +  ERA++GIFLAFQYP+EIPG+  + FLK ALN+ RK   +  L   
Sbjct: 59  SVEFNGKDLLELAPEERAAEGIFLAFQYPIEIPGVTTINFLKTALNQIRKYHGKDPLDAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++    + I+  +L+R LN GFSGGEKK  EI QM +LEP+L ILDETDSGLDI
Sbjct: 119 EFLKLMKEKAKTVKIDDQLLRRSLNEGFSGGEKKRNEIFQMAMLEPTLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS+DRSF+++THYQRLL+YI PD +HVL+ G+I+K+G   +AL+LEE
Sbjct: 179 DALRIVADGVNQLRSKDRSFVVVTHYQRLLDYIVPDYVHVLYKGRIVKSGTKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|56708065|ref|YP_169961.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670536|ref|YP_667093.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118497444|ref|YP_898494.1| sufS activator complex, sufC subunit [Francisella tularensis subsp.
           novicida U112]
 gi|134301879|ref|YP_001121848.1| FeS assembly ATPase SufC [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|187931695|ref|YP_001891679.1| sufS activator complex, sufC subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|195536135|ref|ZP_03079142.1| FeS assembly ATPase SufC [Francisella tularensis subsp. novicida
           FTE]
 gi|224457153|ref|ZP_03665626.1| sufS activator complex, sufC subunit [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370552|ref|ZP_04986557.1| ABC transporter [Francisella tularensis subsp. tularensis FSC033]
 gi|254372805|ref|ZP_04988294.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. novicida GA99-3549]
 gi|254374265|ref|ZP_04989747.1| vegetative protein 296 [Francisella novicida GA99-3548]
 gi|254874868|ref|ZP_05247578.1| vegetative protein 296 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604557|emb|CAG45605.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320869|emb|CAL08988.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118423350|gb|ABK89740.1| sufS activator complex, sufC subunit [Francisella novicida U112]
 gi|134049656|gb|ABO46727.1| FeS assembly ATPase SufC [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151568795|gb|EDN34449.1| ABC transporter [Francisella tularensis subsp. tularensis FSC033]
 gi|151570532|gb|EDN36186.1| ABC superfamily ATP binding cassette transporter [Francisella
           novicida GA99-3549]
 gi|151571985|gb|EDN37639.1| vegetative protein 296 [Francisella novicida GA99-3548]
 gi|187712604|gb|ACD30901.1| sufS activator complex, sufC subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194372612|gb|EDX27323.1| FeS assembly ATPase SufC [Francisella tularensis subsp. novicida
           FTE]
 gi|254840867|gb|EET19303.1| vegetative protein 296 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159261|gb|ADA78652.1| FeS assembly ATPase SufC [Francisella tularensis subsp. tularensis
           NE061598]
 gi|332183983|gb|AEE26237.1| Iron-sulfur cluster assembly ATPase protein SufC [Francisella cf.
           novicida 3523]
          Length = 249

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 181/246 (73%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   + +   +I++GLNL V+  EV AIMGPNG+GKSTLS +L+G   YEIT G
Sbjct: 2   LLEIKDLHVSVGEQKKQILKGLNLTVKKGEVHAIMGPNGAGKSTLSNVLAGKDGYEITQG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ + D SI ERA+ GIFL+ QYP+EIPG+  +QFLK ALN  RK   E E+   
Sbjct: 62  SITFDGKDLNDLSISERAAAGIFLSLQYPIEIPGVSNVQFLKTALNSIRKQNGEDEIDAI 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+++    L I+   + R +N GFSGGEKK  E+LQ+ +LEP L ILDETDSGLDI
Sbjct: 122 SFMKKLKENMQVLKIDQKYMSRGVNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ +QG N++RS DRSFL+ITHYQRLL++I+PD +HVL +GKI+KTG   +AL+LEE
Sbjct: 182 DALQVVSQGANSMRSADRSFLVITHYQRLLDHIQPDFVHVLADGKIVKTGGKELALELEE 241

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 242 KGYSWL 247


>gi|292488154|ref|YP_003531035.1| FeS assembly ATPase SufC [Erwinia amylovora CFBP1430]
 gi|292899364|ref|YP_003538733.1| ABC transporter [Erwinia amylovora ATCC 49946]
 gi|291199212|emb|CBJ46327.1| ABC transporter ATP-dependent subunit of SufB-SufC-SufD cysteine
           desulfurase activator complex [Erwinia amylovora ATCC
           49946]
 gi|291553582|emb|CBA20627.1| FeS assembly ATPase SufC [Erwinia amylovora CFBP1430]
          Length = 248

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+ GLNL+++P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILSGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  ERA +GIF+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVQFKGKDLLELAPEERAGEGIFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFKDFIEEKIHLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKIVSHGVNSLRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|315225485|ref|ZP_07867298.1| Fe-S cluster assembly ATP-binding protein SufC [Capnocytophaga
           ochracea F0287]
 gi|314944583|gb|EFS96619.1| Fe-S cluster assembly ATP-binding protein SufC [Capnocytophaga
           ochracea F0287]
          Length = 246

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 185/243 (76%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G++L+++  EV AIMGPNG+GKSTLS +++G++++E+T G
Sbjct: 1   MLIIKNLHAGV--DGKEILKGIDLEIKAGEVHAIMGPNGAGKSTLSAVIAGNENFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL  GES+L+ +  ERA KGIF++FQYPVEIPGI +  F+K A+NE RKA+   ++   
Sbjct: 59  DILLNGESLLEDAPEERAHKGIFMSFQYPVEIPGISVTNFIKTAINESRKAQGLPDMPAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+  A L IN D L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 ELLKKIREKAALLEINPDFLSRSLNQGFSGGEKKRNEIFQMAMLEPKIAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++++ + L+ITHYQRLL+YI PD +HVL +GKI+KTGD ++AL+LE 
Sbjct: 179 DALRIVANGVNKLKNENNAVLVITHYQRLLDYIVPDYVHVLSDGKIVKTGDKNLALELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|91210895|ref|YP_540881.1| cysteine desulfurase ATPase [Escherichia coli UTI89]
 gi|117623861|ref|YP_852774.1| cysteine desulfurase ATPase component [Escherichia coli APEC O1]
 gi|218558551|ref|YP_002391464.1| cysteine desulfurase ATPase component [Escherichia coli S88]
 gi|237705628|ref|ZP_04536109.1| cysteine desulfurase ATPase component [Escherichia sp. 3_2_53FAA]
 gi|91072469|gb|ABE07350.1| ATPase component of SufB-SufC-SufD cysteine desulfurase (SufS)
           activator complex [Escherichia coli UTI89]
 gi|115512985|gb|ABJ01060.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli APEC O1]
 gi|218365320|emb|CAR03041.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli S88]
 gi|226900385|gb|EEH86644.1| cysteine desulfurase ATPase component [Escherichia sp. 3_2_53FAA]
 gi|294494081|gb|ADE92837.1| FeS assembly ATPase SufC [Escherichia coli IHE3034]
 gi|307626832|gb|ADN71136.1| cysteine desulfurase ATPase component [Escherichia coli UM146]
 gi|315286392|gb|EFU45828.1| FeS assembly ATPase SufC [Escherichia coli MS 110-3]
 gi|323952189|gb|EGB48062.1| FeS assembly ATPase SufC [Escherichia coli H252]
 gi|323956583|gb|EGB52321.1| FeS assembly ATPase SufC [Escherichia coli H263]
          Length = 248

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T+G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIAPLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|149376033|ref|ZP_01893799.1| FeS assembly ATPase SufC [Marinobacter algicola DG893]
 gi|149359670|gb|EDM48128.1| FeS assembly ATPase SufC [Marinobacter algicola DG893]
          Length = 257

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 184/246 (74%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G+NL+++  EV AIMGPNGSGKSTLS +L+G++ +E+T G
Sbjct: 1   MLSIKNLHASV--EGEEILKGINLEIKAGEVHAIMGPNGSGKSTLSQVLAGNETFEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I   GE++LD    ERA +GIFLAFQYPVEIPG+  +QFL+ A+N  R  R E E+   
Sbjct: 59  EISLNGENLLDLETEERAREGIFLAFQYPVEIPGVSNLQFLRTAVNAMRTHRGEPEMNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++++ ++ ++   LKR +N GFSGGEKK  EILQ  LL+P L ILDETDSGLDI
Sbjct: 119 EFMKLAKEVSKQVDLDPAFLKRGVNEGFSGGEKKRNEILQALLLQPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ ++GVNALR++DR+ L++THYQRLLN+I PD +HVL  G+I+K+G   +AL+LEE
Sbjct: 179 DALQVVSKGVNALRAEDRAILMVTHYQRLLNHIVPDHVHVLAGGRIVKSGGRELALELEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 RGYGWL 244


>gi|148555825|ref|YP_001263407.1| FeS assembly ATPase SufC [Sphingomonas wittichii RW1]
 gi|148501015|gb|ABQ69269.1| FeS assembly ATPase SufC [Sphingomonas wittichii RW1]
          Length = 247

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 182/248 (73%), Gaps = 5/248 (2%)

Query: 1   MLEIKNLRAKIVDTDTE-IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA 59
           ML+I+NL A   D D + I++GL+L + P E+ AIMGPNG+GKSTLSY+L+G   YE+TA
Sbjct: 1   MLKIENLHA---DVDGKAILKGLSLTINPGEIHAIMGPNGAGKSTLSYVLAGRPGYEVTA 57

Query: 60  GDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLI 119
           G + + GE +LD +  ERA+ GIFL FQYPVEIPG+  +QFL+ ALN QR+ R E+ L  
Sbjct: 58  GSVTFNGEDLLDKAPHERAAAGIFLGFQYPVEIPGVSNVQFLREALNAQRRLRGEEPLSG 117

Query: 120 PDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD 179
            DF ++ R     L + MDMLKRP+N+GFSGGEKK  E++QM +++P L ILDETDSGLD
Sbjct: 118 GDFLKRARVQADALDLGMDMLKRPVNVGFSGGEKKRNEMVQMGIIDPMLAILDETDSGLD 177

Query: 180 IDALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDL 238
           IDAL+    G+N  +R  D++ L+ITHYQRLL+Y+KPD +HVL  G+I++TG   +AL+L
Sbjct: 178 IDALRTVGHGINTIMRKPDKAVLLITHYQRLLDYVKPDFVHVLAAGRIVRTGGADLALEL 237

Query: 239 EENGYAEL 246
           E  GY  +
Sbjct: 238 EREGYGAI 245


>gi|238765284|ref|ZP_04626212.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           kristensenii ATCC 33638]
 gi|238696507|gb|EEP89296.1| Iron-regulated ABC transporter, ATP-binding protein [Yersinia
           kristensenii ATCC 33638]
          Length = 248

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+  +     EI+ GL+L+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNLKVSV--EGNEILNGLDLEIKPGEVHAIMGPNGSGKSTLSAALAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+    FL+ A+N  R+ R ++ L   
Sbjct: 59  SVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTAVNAVRRYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEPSLCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLKMPADLLTRSVNVGFSGGEKKRNDILQMAALEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR+++R+F+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+++   LEE
Sbjct: 179 DALKIVANGVNSLRNKERAFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|284035109|ref|YP_003385039.1| FeS assembly ATPase SufC [Spirosoma linguale DSM 74]
 gi|283814402|gb|ADB36240.1| FeS assembly ATPase SufC [Spirosoma linguale DSM 74]
          Length = 251

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I   + EI+RGLNL++ P EV AIMGPNG+GKSTL+ +L+G +DY++T+G
Sbjct: 1   MLSISNLHASI--GEKEILRGLNLEINPGEVHAIMGPNGAGKSTLASVLAGREDYDVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +L+ G+ +LD +  ERA++GIFLAFQYP+EIPG+    FLK ALNE RK R +  L   
Sbjct: 59  SVLFDGKDLLDMAPEERAAEGIFLAFQYPIEIPGVSTTNFLKTALNEIRKYRGQDPLDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + +++    + I+  +L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLMKEKMKLVNIDQSLLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS +R+ +++THYQRLL+YI PD +HVL+ G+I+K+G   +AL+LEE
Sbjct: 179 DALRIVADGVNKLRSPERATIVVTHYQRLLDYIVPDYVHVLYKGRIVKSGPKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|296102714|ref|YP_003612860.1| cysteine desulfurase ATPase component [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057173|gb|ADF61911.1| cysteine desulfurase ATPase component [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 248

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGLN  V+P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLNFDVKPGEVHAIMGPNGSGKSTLSATLAGREDYEVTNG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  RK R  + L   
Sbjct: 59  SVEFNGKDLLEMSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRKYRGLEALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 DFQDLMEEKIKLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|167627989|ref|YP_001678489.1| SufS activator complex subunit SufC [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|167597990|gb|ABZ87988.1| SufS activator complex, SufC subunit [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 249

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 181/246 (73%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   + +   +I++GLNLKV   EV AIMGPNG+GKSTLS +L+G   YEIT G
Sbjct: 2   LLEIKDLHVSVGEQKKQILKGLNLKVNKGEVHAIMGPNGAGKSTLSNVLAGKDGYEITQG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ + D SI +RA+ GIFL+ QYP+EIPG+  +QFLK A+N  RK   E+E+   
Sbjct: 62  SITFNGKDLDDLSISQRAAAGIFLSLQYPIEIPGVSNVQFLKTAVNSIRKQNGEEEINAI 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +K++     L I+   + R +N GFSGGEKK  E+LQ+ +LEP L ILDETDSGLDI
Sbjct: 122 DFMKKLKANMQVLKIDQKYMSRGVNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ +QG N +RS +RSFL+ITHYQRLL++I+PD +HVL +GKI+KTG   +AL+LEE
Sbjct: 182 DALQVVSQGANTMRSPERSFLVITHYQRLLDHIQPDFVHVLADGKIVKTGGKELALELEE 241

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 242 KGYSWL 247


>gi|261343987|ref|ZP_05971632.1| FeS assembly ATPase SufC [Providencia rustigianii DSM 4541]
 gi|282568378|gb|EFB73913.1| FeS assembly ATPase SufC [Providencia rustigianii DSM 4541]
          Length = 248

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +     EI++GL+L+++P EV AIMGPNGSGKSTLS  L+G +DYEI +G
Sbjct: 1   MLSIKDLHVSV--EGNEILKGLSLEIKPGEVHAIMGPNGSGKSTLSATLAGREDYEIDSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++ G+ +L     +RA +GIFLAFQYPVEIPG+    FL+ ++N  R+ R ++ L   
Sbjct: 59  EVIFNGKDLLALDPEDRAGEGIFLAFQYPVEIPGVSNQFFLQTSVNAVREYRQQESLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +    A L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEDKIALLDMPQDLLTRSVNVGFSGGEKKRNDILQMAALEPKLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR+ +RSF+I+THYQR+L+Y+KPD +HVL+ G+IIK+GD+S+A  LEE
Sbjct: 179 DALKIVSNGVNSLRTPERSFIIVTHYQRILDYVKPDFVHVLYQGRIIKSGDFSLAKKLEE 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 QGYGWLIDQ 247


>gi|126668346|ref|ZP_01739304.1| FeS assembly ATPase SufC [Marinobacter sp. ELB17]
 gi|126627162|gb|EAZ97801.1| FeS assembly ATPase SufC [Marinobacter sp. ELB17]
          Length = 254

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 132/246 (53%), Positives = 182/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G+NL+++  E+ AIMGPNGSGKSTLS +L+G + +E+T G
Sbjct: 1   MLNIKNLHASV--GGEEILKGINLEIKAGEIHAIMGPNGSGKSTLSQVLAGSETFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + GE++LD    ERA +G+FLAFQYPVEIPG+  +QFL+ A+N  R  R E E+   
Sbjct: 59  EVTFNGENLLDLKTEERAREGVFLAFQYPVEIPGVSNLQFLRTAVNSMRGHRGEPEMNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R+++ ++ ++   LKR +N GFSGGEKK  EILQ  LL+P L ILDETDSGLDI
Sbjct: 119 EFMKHAREVSMQVDLDPAFLKRGVNEGFSGGEKKRNEILQALLLQPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL + + GVNALR++DR+ L++THYQRLLN+I PD +HVL +GKI+K+G   +A +LEE
Sbjct: 179 DALHVVSDGVNALRAKDRAILMVTHYQRLLNHIVPDYVHVLADGKIVKSGGRELAYELEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 RGYGWL 244


>gi|270261596|ref|ZP_06189869.1| hypothetical protein SOD_a08280 [Serratia odorifera 4Rx13]
 gi|270045080|gb|EFA18171.1| hypothetical protein SOD_a08280 [Serratia odorifera 4Rx13]
          Length = 248

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL  K+     EI++GLNL+++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIKNL--KVSAEGNEILKGLNLEIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+ +L+ +  +RA +G+FLAFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  EVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIELLNMPQDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   R+F+I+THYQR+L+YIKPD +HVL  G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVANGVNSLRDGKRAFIIVTHYQRILDYIKPDYVHVLSQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|119945239|ref|YP_942919.1| FeS assembly ATPase SufC [Psychromonas ingrahamii 37]
 gi|119863843|gb|ABM03320.1| FeS assembly ATPase SufC [Psychromonas ingrahamii 37]
          Length = 264

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 136/252 (53%), Positives = 183/252 (72%), Gaps = 7/252 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A+I      I++GLNL V+  EV AIMGPNGSGKSTL+ +L+GH DY++T G
Sbjct: 1   MLNINNLHAEI--QGNMILKGLNLSVKSGEVHAIMGPNGSGKSTLANVLAGHPDYQVTTG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G  +L  S+ ERA  G+F+AFQYP+EIPG+  +QFLK+ALN QRK R   EL   
Sbjct: 59  EVIFQGRDLLTLSVAERACAGVFVAFQYPLEIPGVSNVQFLKLALNSQRKYRQLSELDAL 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + V+    ++G+   +L R +N GFSGGEKK  EILQM +LEP L ILDETDSGLDI
Sbjct: 119 DFLQLVKTKVQQVGMEEPLLYRSINEGFSGGEKKRNEILQMLVLEPQLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRS-----QDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIA 235
           DALK+ AQG+NA R+     Q    +++THYQRLLN+I PD +H+L +G+I+K+G   +A
Sbjct: 179 DALKLVAQGINAFRNSADSGQKPGIILVTHYQRLLNFINPDFVHILFDGRIVKSGGPELA 238

Query: 236 LDLEENGYAELI 247
           L+LE  GYA+L+
Sbjct: 239 LELERKGYADLL 250


>gi|157161147|ref|YP_001458465.1| cysteine desulfurase ATPase component [Escherichia coli HS]
 gi|170019968|ref|YP_001724922.1| cysteine desulfurase ATPase component [Escherichia coli ATCC 8739]
 gi|157066827|gb|ABV06082.1| FeS assembly ATPase SufC [Escherichia coli HS]
 gi|169754896|gb|ACA77595.1| FeS assembly ATPase SufC [Escherichia coli ATCC 8739]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|227111735|ref|ZP_03825391.1| cysteine desulfurase ATPase component [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL+  +     EII+GLNL ++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIENLKVSV--EGKEIIKGLNLTIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  +RA +G+F+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVNFKGKDLLELSPEDRAGEGVFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKITLLNMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|191167843|ref|ZP_03029648.1| FeS assembly ATPase SufC [Escherichia coli B7A]
 gi|256018124|ref|ZP_05431989.1| cysteine desulfurase ATPase component [Shigella sp. D9]
 gi|307310747|ref|ZP_07590393.1| FeS assembly ATPase SufC [Escherichia coli W]
 gi|332279169|ref|ZP_08391582.1| cysteine desulfurase ATPase component [Shigella sp. D9]
 gi|190902102|gb|EDV61846.1| FeS assembly ATPase SufC [Escherichia coli B7A]
 gi|306908925|gb|EFN39421.1| FeS assembly ATPase SufC [Escherichia coli W]
 gi|315060987|gb|ADT75314.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli W]
 gi|320197866|gb|EFW72474.1| Iron-sulfur cluster assembly ATPase protein SufC [Escherichia coli
           EC4100B]
 gi|323378441|gb|ADX50709.1| FeS assembly ATPase SufC [Escherichia coli KO11]
 gi|332101521|gb|EGJ04867.1| cysteine desulfurase ATPase component [Shigella sp. D9]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R+++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRSQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|283833345|ref|ZP_06353086.1| FeS assembly ATPase SufC [Citrobacter youngae ATCC 29220]
 gi|291070986|gb|EFE09095.1| FeS assembly ATPase SufC [Citrobacter youngae ATCC 29220]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGL+L++ P EV AIMGPNGSGKSTLS  L+G  DYE+T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLSLEIRPGEVHAIMGPNGSGKSTLSATLAGRDDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R E+ L   
Sbjct: 59  TVEFNGKDLLELSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGEESLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPQLCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLSEQ 247


>gi|331647173|ref|ZP_08348267.1| FeS assembly ATPase SufC [Escherichia coli M605]
 gi|331657656|ref|ZP_08358618.1| FeS assembly ATPase SufC [Escherichia coli TA206]
 gi|330911489|gb|EGH39999.1| iron-sulfur cluster assembly ATPase protein SufC [Escherichia coli
           AA86]
 gi|331043956|gb|EGI16092.1| FeS assembly ATPase SufC [Escherichia coli M605]
 gi|331055904|gb|EGI27913.1| FeS assembly ATPase SufC [Escherichia coli TA206]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T+G
Sbjct: 1   MLSIKDLHVSV--EDKTILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|26247932|ref|NP_753972.1| cysteine desulfurase ATPase component [Escherichia coli CFT073]
 gi|110641803|ref|YP_669533.1| cysteine desulfurase ATPase component [Escherichia coli 536]
 gi|191171659|ref|ZP_03033206.1| FeS assembly ATPase SufC [Escherichia coli F11]
 gi|218689624|ref|YP_002397836.1| cysteine desulfurase ATPase [Escherichia coli ED1a]
 gi|227885899|ref|ZP_04003704.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily protein [Escherichia coli 83972]
 gi|300987768|ref|ZP_07178346.1| FeS assembly ATPase SufC [Escherichia coli MS 200-1]
 gi|300994859|ref|ZP_07180972.1| FeS assembly ATPase SufC [Escherichia coli MS 45-1]
 gi|301050987|ref|ZP_07197833.1| FeS assembly ATPase SufC [Escherichia coli MS 185-1]
 gi|306815065|ref|ZP_07449221.1| cysteine desulfurase ATPase component [Escherichia coli NC101]
 gi|331683189|ref|ZP_08383790.1| FeS assembly ATPase SufC [Escherichia coli H299]
 gi|26108335|gb|AAN80537.1|AE016761_112 Probable ATP-dependent transporter sufC [Escherichia coli CFT073]
 gi|110343395|gb|ABG69632.1| probable ATP-dependent transporter SufC [Escherichia coli 536]
 gi|190907989|gb|EDV67581.1| FeS assembly ATPase SufC [Escherichia coli F11]
 gi|218427188|emb|CAR08074.2| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli ED1a]
 gi|227837078|gb|EEJ47544.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily protein [Escherichia coli 83972]
 gi|300297364|gb|EFJ53749.1| FeS assembly ATPase SufC [Escherichia coli MS 185-1]
 gi|300306056|gb|EFJ60576.1| FeS assembly ATPase SufC [Escherichia coli MS 200-1]
 gi|300406199|gb|EFJ89737.1| FeS assembly ATPase SufC [Escherichia coli MS 45-1]
 gi|305851713|gb|EFM52166.1| cysteine desulfurase ATPase component [Escherichia coli NC101]
 gi|307553703|gb|ADN46478.1| FeS assembly ATPase SufC [Escherichia coli ABU 83972]
 gi|315290529|gb|EFU49903.1| FeS assembly ATPase SufC [Escherichia coli MS 153-1]
 gi|315299722|gb|EFU58962.1| FeS assembly ATPase SufC [Escherichia coli MS 16-3]
 gi|320195422|gb|EFW70047.1| Iron-sulfur cluster assembly ATPase protein SufC [Escherichia coli
           WV_060327]
 gi|324011453|gb|EGB80672.1| FeS assembly ATPase SufC [Escherichia coli MS 60-1]
 gi|331079404|gb|EGI50601.1| FeS assembly ATPase SufC [Escherichia coli H299]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T+G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|50120791|ref|YP_049958.1| cysteine desulfurase ATPase [Pectobacterium atrosepticum SCRI1043]
 gi|227327027|ref|ZP_03831051.1| cysteine desulfurase ATPase component [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|49611317|emb|CAG74764.1| probable ABC transporter ATP-dependent protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL+  +     EII+GLNL ++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIENLKVSV--EGKEIIKGLNLTIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  +RA +G+F+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVSFKGKDLLELSPEDRAGEGVFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIKLLNMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 QGYGWLTDE 247


>gi|260061111|ref|YP_003194191.1| ABC transporter ATP-binding protein [Robiginitalea biformata
           HTCC2501]
 gi|88785243|gb|EAR16412.1| ABC transporter, ATP-binding protein [Robiginitalea biformata
           HTCC2501]
          Length = 250

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 182/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +   + +I++G+NL+V P EV AIMGPNGSGKSTL+ +++G +++ ++ G
Sbjct: 1   MLKIKNLHAGV--ENKKILKGINLEVNPGEVHAIMGPNGSGKSTLASVIAGKEEFNVSRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL++GE I + S  ERA  GIFL+FQYPVEIPG+ +  F+K A+NE RKA+ E ++   
Sbjct: 59  KILFEGEDIDEMSPEERAHNGIFLSFQYPVEIPGVSVTNFMKTAINESRKAKGEPDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
              + +R+    L I+   L R LN GFSGGEKK  EI QM +++P L ILDETDSGLDI
Sbjct: 119 QMLKLIREKAELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMMQPKLGILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS+D +F++ITHYQRLL+YI PD +HV+H+GKI+K+GD  +AL+LEE
Sbjct: 179 DALRIVANGVNRLRSEDNAFVVITHYQRLLDYIVPDFVHVIHDGKIVKSGDKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|289664561|ref|ZP_06486142.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289671186|ref|ZP_06492261.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 254

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 179/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I   D  I++GL+L ++P +V AIMGPNG+GKSTL  +L+G   Y++TAG
Sbjct: 1   MLTINNLHASIAGKD--ILKGLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYDVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+ +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  TVQFEGKDLLDLPPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|21243663|ref|NP_643245.1| ABC transporter ATP-binding protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21109241|gb|AAM37781.1| ABC transporter ATP-binding protein [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 254

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I   D  I++GL+L ++P +V AIMGPNG+GKSTL  +L+G   YE++AG
Sbjct: 1   MLTINNLHASIAGKD--ILKGLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  SVQFDGKDLLDLPPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|293414998|ref|ZP_06657641.1| FeS assembly ATPase SufC [Escherichia coli B185]
 gi|291432646|gb|EFF05625.1| FeS assembly ATPase SufC [Escherichia coli B185]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR+  RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRNGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|163753694|ref|ZP_02160817.1| iron-regulated ABC transporter, ATP-binding protein [Kordia
           algicida OT-1]
 gi|161325908|gb|EDP97234.1| iron-regulated ABC transporter, ATP-binding protein [Kordia
           algicida OT-1]
          Length = 250

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 181/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A I   D  I++G+NL+V+  EV AIMGPNGSGKSTLS +++G ++YE+T G
Sbjct: 1   MLHIKNLHAGI--EDKGILKGINLEVKAGEVHAIMGPNGSGKSTLSSVIAGKEEYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I   GE+I +    ERA +G+FL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  EIFLNGENIEELGPEERAHEGVFLSFQYPVEIPGVSVTNFVKTAINETRKAQGLEDMPAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+  A L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKKIREKAALLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS+D + ++ITHYQRLL++I PD +HVLH+GKI+K+G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLRSKDNAVIVITHYQRLLDHIVPDFVHVLHDGKIVKSGTKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|294664775|ref|ZP_06730101.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292605462|gb|EFF48787.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 254

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 179/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A I   D  I++ L+L ++P +V AIMGPNG+GKSTL  +L+G   YE++AG
Sbjct: 1   MLKITNLHASIAGKD--ILKSLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +LD S  ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  SVQFDGKDLLDLSPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|161503532|ref|YP_001570644.1| cysteine desulfurase ATPase component [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864879|gb|ABX21502.1| hypothetical protein SARI_01608 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 248

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L   +   +  I+RGLNL+V P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLNIKGLHVSV--EEKAILRGLNLEVRPGEVHAIMGPNGSGKSTLSATLAGREEYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R +  L   
Sbjct: 59  SVTFNGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRAYRGQASLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALR   R+F+I+THYQR+L+YIKPD +HVL+ G+I+++GD+++   LEE
Sbjct: 179 DALKIVAEGVNALRDDKRAFIIVTHYQRILDYIKPDYVHVLYQGRIVRSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|237731312|ref|ZP_04561793.1| cysteine desulfurase ATPase component [Citrobacter sp. 30_2]
 gi|226906851|gb|EEH92769.1| cysteine desulfurase ATPase component [Citrobacter sp. 30_2]
          Length = 248

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  +   D  I+RGL+L+V P EV AIMGPNGSGKSTLS  L+G +DY++T G
Sbjct: 1   MLSIKDLQVSV--EDKAILRGLSLEVRPGEVHAIMGPNGSGKSTLSATLAGREDYDVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R E+ L   
Sbjct: 59  TVEFNGKDLLELSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGEESLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPQLCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVADGVNSLRDGKRSFIIVTHYQRILDYIKPDFVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLSEQ 247


>gi|120556062|ref|YP_960413.1| FeS assembly ATPase SufC [Marinobacter aquaeolei VT8]
 gi|120325911|gb|ABM20226.1| Iron-regulated ABC transporter ATPase subunit SufC [Marinobacter
           aquaeolei VT8]
 gi|302608220|emb|CBW44459.1| transport protein associated with Fe-S cluster assembly (ABC
           superfamily, atp_bind) [Marinobacter
           hydrocarbonoclasticus]
          Length = 253

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 183/246 (74%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G+NL+++  EV AIMGPNGSGKSTLS +L+G+  +E+T G
Sbjct: 1   MLSIKNLHASV--EGKEILKGINLEIKAGEVHAIMGPNGSGKSTLSQVLAGNDAFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++   G+++LD    ERA +GIFLAFQYPVEIPG+  +QFL+ A+N  RK + + E+   
Sbjct: 59  EVTLNGDNLLDLETEERAREGIFLAFQYPVEIPGVSNLQFLRTAVNAMRKHKGQDEMNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++++ ++ ++   LKR +N GFSGGEKK  EI+Q  LL+P L ILDETDSGLDI
Sbjct: 119 EFMKLAKEVSKQVDLDPAFLKRGVNEGFSGGEKKRNEIMQALLLQPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALRS+DR+ L++THYQRLLN+I PD +HVL  GKIIK+G   +AL+LEE
Sbjct: 179 DALKVVSDGVNALRSEDRAILMVTHYQRLLNHIVPDYVHVLAGGKIIKSGGRELALELEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|16129638|ref|NP_416197.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli str. K-12 substr. MG1655]
 gi|89108522|ref|AP_002302.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli str. K-12 substr. W3110]
 gi|170081342|ref|YP_001730662.1| SufBCD complex ATP-binding protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|238900897|ref|YP_002926693.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli BW2952]
 gi|256022655|ref|ZP_05436520.1| cysteine desulfurase ATPase component [Escherichia sp. 4_1_40B]
 gi|300951274|ref|ZP_07165123.1| FeS assembly ATPase SufC [Escherichia coli MS 116-1]
 gi|301027873|ref|ZP_07191174.1| FeS assembly ATPase SufC [Escherichia coli MS 196-1]
 gi|301647865|ref|ZP_07247647.1| FeS assembly ATPase SufC [Escherichia coli MS 146-1]
 gi|307138341|ref|ZP_07497697.1| cysteine desulfurase ATPase component [Escherichia coli H736]
 gi|331642280|ref|ZP_08343415.1| FeS assembly ATPase SufC [Escherichia coli H736]
 gi|3025252|sp|P77499|SUFC_ECOLI RecName: Full=Probable ATP-dependent transporter SufC
 gi|88192738|pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase
           Compenent Of The Suf Iron-Sulfur Cluster Assembly
           Machinery
 gi|88192739|pdb|2D3W|B Chain B, Crystal Structure Of Escherichia Coli Sufc, An Atpase
           Compenent Of The Suf Iron-Sulfur Cluster Assembly
           Machinery
 gi|88192740|pdb|2D3W|C Chain C, Crystal Structure Of Escherichia Coli Sufc, An Atpase
           Compenent Of The Suf Iron-Sulfur Cluster Assembly
           Machinery
 gi|88192741|pdb|2D3W|D Chain D, Crystal Structure Of Escherichia Coli Sufc, An Atpase
           Compenent Of The Suf Iron-Sulfur Cluster Assembly
           Machinery
 gi|1742764|dbj|BAA15455.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli str. K12 substr. W3110]
 gi|1787972|gb|AAC74752.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli str. K-12 substr. MG1655]
 gi|169889177|gb|ACB02884.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli str. K-12 substr. DH10B]
 gi|238860172|gb|ACR62170.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli BW2952]
 gi|260449195|gb|ACX39617.1| FeS assembly ATPase SufC [Escherichia coli DH1]
 gi|299879029|gb|EFI87240.1| FeS assembly ATPase SufC [Escherichia coli MS 196-1]
 gi|300449455|gb|EFK13075.1| FeS assembly ATPase SufC [Escherichia coli MS 116-1]
 gi|301074006|gb|EFK88812.1| FeS assembly ATPase SufC [Escherichia coli MS 146-1]
 gi|309701907|emb|CBJ01219.1| ABC transport ATP-binding protein (component of SufBCD complex)
           [Escherichia coli ETEC H10407]
 gi|315136323|dbj|BAJ43482.1| cysteine desulfurase ATPase component [Escherichia coli DH1]
 gi|315618877|gb|EFU99460.1| feS assembly ATPase SufC [Escherichia coli 3431]
 gi|323937285|gb|EGB33564.1| FeS assembly ATPase SufC [Escherichia coli E1520]
 gi|323940651|gb|EGB36842.1| FeS assembly ATPase SufC [Escherichia coli E482]
 gi|331039078|gb|EGI11298.1| FeS assembly ATPase SufC [Escherichia coli H736]
 gi|332343401|gb|AEE56735.1| feS assembly ATPase SufC [Escherichia coli UMNK88]
          Length = 248

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|300904533|ref|ZP_07122372.1| FeS assembly ATPase SufC [Escherichia coli MS 84-1]
 gi|301303197|ref|ZP_07209323.1| FeS assembly ATPase SufC [Escherichia coli MS 124-1]
 gi|300403527|gb|EFJ87065.1| FeS assembly ATPase SufC [Escherichia coli MS 84-1]
 gi|300841606|gb|EFK69366.1| FeS assembly ATPase SufC [Escherichia coli MS 124-1]
 gi|315257515|gb|EFU37483.1| FeS assembly ATPase SufC [Escherichia coli MS 85-1]
          Length = 248

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLAVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPGLCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|224983403|pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The
           Iron- Sulfur Cluster Biosynthesis
 gi|224983404|pdb|2ZU0|D Chain D, Crystal Structure Of Sufc-Sufd Complex Involved In The
           Iron- Sulfur Cluster Biosynthesis
          Length = 267

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 20  MLSIKDLHVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 77

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 78  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 137

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 138 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 197

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 198 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 257

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 258 QGYGWLTEQ 266


>gi|300918052|ref|ZP_07134673.1| FeS assembly ATPase SufC [Escherichia coli MS 115-1]
 gi|331653082|ref|ZP_08354087.1| FeS assembly ATPase SufC [Escherichia coli M718]
 gi|300414743|gb|EFJ98053.1| FeS assembly ATPase SufC [Escherichia coli MS 115-1]
 gi|331049180|gb|EGI21252.1| FeS assembly ATPase SufC [Escherichia coli M718]
          Length = 248

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPGLCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|82543948|ref|YP_407895.1| cysteine desulfurase ATPase component [Shigella boydii Sb227]
 gi|157159125|ref|YP_001462976.1| cysteine desulfurase ATPase component [Escherichia coli E24377A]
 gi|187731454|ref|YP_001880442.1| cysteine desulfurase ATPase [Shigella boydii CDC 3083-94]
 gi|193068983|ref|ZP_03049942.1| FeS assembly ATPase SufC [Escherichia coli E110019]
 gi|209918996|ref|YP_002293080.1| cysteine desulfurase ATPase component [Escherichia coli SE11]
 gi|218695243|ref|YP_002402910.1| cysteine desulfurase ATPase component [Escherichia coli 55989]
 gi|260868173|ref|YP_003234575.1| component of SufBCD complex [Escherichia coli O111:H- str. 11128]
 gi|300820073|ref|ZP_07100249.1| FeS assembly ATPase SufC [Escherichia coli MS 107-1]
 gi|300924717|ref|ZP_07140663.1| FeS assembly ATPase SufC [Escherichia coli MS 182-1]
 gi|301326554|ref|ZP_07219895.1| FeS assembly ATPase SufC [Escherichia coli MS 78-1]
 gi|81245359|gb|ABB66067.1| putative ATP-binding component of a transport system [Shigella
           boydii Sb227]
 gi|157081155|gb|ABV20863.1| FeS assembly ATPase SufC [Escherichia coli E24377A]
 gi|187428446|gb|ACD07720.1| FeS assembly ATPase SufC [Shigella boydii CDC 3083-94]
 gi|192957778|gb|EDV88222.1| FeS assembly ATPase SufC [Escherichia coli E110019]
 gi|209912255|dbj|BAG77329.1| putative ABC transport ATP-binding component [Escherichia coli
           SE11]
 gi|218351975|emb|CAU97707.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli 55989]
 gi|257764529|dbj|BAI36024.1| component of SufBCD complex [Escherichia coli O111:H- str. 11128]
 gi|300419095|gb|EFK02406.1| FeS assembly ATPase SufC [Escherichia coli MS 182-1]
 gi|300527378|gb|EFK48440.1| FeS assembly ATPase SufC [Escherichia coli MS 107-1]
 gi|300846774|gb|EFK74534.1| FeS assembly ATPase SufC [Escherichia coli MS 78-1]
 gi|320175143|gb|EFW50254.1| Iron-sulfur cluster assembly ATPase protein SufC [Shigella
           dysenteriae CDC 74-1112]
 gi|320184433|gb|EFW59241.1| Iron-sulfur cluster assembly ATPase protein SufC [Shigella flexneri
           CDC 796-83]
 gi|323169995|gb|EFZ55651.1| feS assembly ATPase SufC [Escherichia coli LT-68]
 gi|323180998|gb|EFZ66536.1| feS assembly ATPase SufC [Escherichia coli 1180]
 gi|323186045|gb|EFZ71401.1| feS assembly ATPase SufC [Escherichia coli 1357]
 gi|324016512|gb|EGB85731.1| FeS assembly ATPase SufC [Escherichia coli MS 117-3]
 gi|332095989|gb|EGJ00994.1| feS assembly ATPase SufC [Shigella boydii 3594-74]
          Length = 248

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLAVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|218548732|ref|YP_002382523.1| cysteine desulfurase ATPase [Escherichia fergusonii ATCC 35469]
 gi|218356273|emb|CAQ88891.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia fergusonii ATCC 35469]
          Length = 248

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKTILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|15802094|ref|NP_288116.1| cysteine desulfurase ATPase component [Escherichia coli O157:H7
           EDL933]
 gi|15831643|ref|NP_310416.1| cysteine desulfurase ATPase component [Escherichia coli O157:H7
           str. Sakai]
 gi|30063196|ref|NP_837367.1| cysteine desulfurase ATPase component [Shigella flexneri 2a str.
           2457T]
 gi|74311993|ref|YP_310412.1| cysteine desulfurase ATPase component [Shigella sonnei Ss046]
 gi|110805659|ref|YP_689179.1| cysteine desulfurase ATPase component [Shigella flexneri 5 str.
           8401]
 gi|168751907|ref|ZP_02776929.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4113]
 gi|168756680|ref|ZP_02781687.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4401]
 gi|168762257|ref|ZP_02787264.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4501]
 gi|168770441|ref|ZP_02795448.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4486]
 gi|168775021|ref|ZP_02800028.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4196]
 gi|168782094|ref|ZP_02807101.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4076]
 gi|168800140|ref|ZP_02825147.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC508]
 gi|170683761|ref|YP_001743572.1| cysteine desulfurase ATPase component [Escherichia coli SMS-3-5]
 gi|188492785|ref|ZP_03000055.1| FeS assembly ATPase SufC [Escherichia coli 53638]
 gi|194434801|ref|ZP_03067051.1| FeS assembly ATPase SufC [Shigella dysenteriae 1012]
 gi|195937366|ref|ZP_03082748.1| cysteine desulfurase ATPase component [Escherichia coli O157:H7
           str. EC4024]
 gi|208810769|ref|ZP_03252645.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4206]
 gi|208816748|ref|ZP_03257868.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4045]
 gi|208818311|ref|ZP_03258631.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4042]
 gi|209396355|ref|YP_002270751.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4115]
 gi|217328640|ref|ZP_03444721.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. TW14588]
 gi|218554248|ref|YP_002387161.1| cysteine desulfurase ATPase [Escherichia coli IAI1]
 gi|218699753|ref|YP_002407382.1| cysteine desulfurase ATPase [Escherichia coli IAI39]
 gi|254793299|ref|YP_003078136.1| cysteine desulfurase ATPase [Escherichia coli O157:H7 str. TW14359]
 gi|291282812|ref|YP_003499630.1| FeS assembly ATPase SufC [Escherichia coli O55:H7 str. CB9615]
 gi|293446056|ref|ZP_06662478.1| FeS assembly ATPase SufC [Escherichia coli B088]
 gi|300821445|ref|ZP_07101592.1| FeS assembly ATPase SufC [Escherichia coli MS 119-7]
 gi|300938995|ref|ZP_07153693.1| FeS assembly ATPase SufC [Escherichia coli MS 21-1]
 gi|309793448|ref|ZP_07687875.1| FeS assembly ATPase SufC [Escherichia coli MS 145-7]
 gi|312969707|ref|ZP_07783890.1| feS assembly ATPase SufC [Escherichia coli 1827-70]
 gi|331663160|ref|ZP_08364070.1| FeS assembly ATPase SufC [Escherichia coli TA143]
 gi|331668366|ref|ZP_08369214.1| FeS assembly ATPase SufC [Escherichia coli TA271]
 gi|12515684|gb|AAG56669.1|AE005391_6 putative ATP-binding component of a transport system [Escherichia
           coli O157:H7 str. EDL933]
 gi|13361856|dbj|BAB35812.1| putative ATP-binding component of a transport system [Escherichia
           coli O157:H7 str. Sakai]
 gi|30041448|gb|AAP17176.1| putative ATP-binding component of a transport system [Shigella
           flexneri 2a str. 2457T]
 gi|73855470|gb|AAZ88177.1| putative ATP-binding component of a transport system [Shigella
           sonnei Ss046]
 gi|110615207|gb|ABF03874.1| putative ATP-binding component of a transport system [Shigella
           flexneri 5 str. 8401]
 gi|170521479|gb|ACB19657.1| FeS assembly ATPase SufC [Escherichia coli SMS-3-5]
 gi|187769484|gb|EDU33328.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4196]
 gi|188014130|gb|EDU52252.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4113]
 gi|188487984|gb|EDU63087.1| FeS assembly ATPase SufC [Escherichia coli 53638]
 gi|189000330|gb|EDU69316.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4076]
 gi|189356143|gb|EDU74562.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4401]
 gi|189360594|gb|EDU79013.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4486]
 gi|189367428|gb|EDU85844.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4501]
 gi|189377536|gb|EDU95952.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC508]
 gi|194416970|gb|EDX33089.1| FeS assembly ATPase SufC [Shigella dysenteriae 1012]
 gi|208725285|gb|EDZ74992.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4206]
 gi|208731091|gb|EDZ79780.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4045]
 gi|208738434|gb|EDZ86116.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4042]
 gi|209157755|gb|ACI35188.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC4115]
 gi|209769168|gb|ACI82896.1| putative ATP-binding component of a transport system [Escherichia
           coli]
 gi|209769170|gb|ACI82897.1| putative ATP-binding component of a transport system [Escherichia
           coli]
 gi|209769172|gb|ACI82898.1| putative ATP-binding component of a transport system [Escherichia
           coli]
 gi|209769174|gb|ACI82899.1| putative ATP-binding component of a transport system [Escherichia
           coli]
 gi|209769176|gb|ACI82900.1| putative ATP-binding component of a transport system [Escherichia
           coli]
 gi|217317987|gb|EEC26414.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. TW14588]
 gi|218361016|emb|CAQ98591.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli IAI1]
 gi|218369739|emb|CAR17510.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli IAI39]
 gi|254592699|gb|ACT72060.1| transport protein associated with Fe-S cluster assembly
           [Escherichia coli O157:H7 str. TW14359]
 gi|281601119|gb|ADA74103.1| putative ATP-binding component of a transport system [Shigella
           flexneri 2002017]
 gi|290762685|gb|ADD56646.1| FeS assembly ATPase SufC [Escherichia coli O55:H7 str. CB9615]
 gi|291322886|gb|EFE62314.1| FeS assembly ATPase SufC [Escherichia coli B088]
 gi|300456098|gb|EFK19591.1| FeS assembly ATPase SufC [Escherichia coli MS 21-1]
 gi|300525948|gb|EFK47017.1| FeS assembly ATPase SufC [Escherichia coli MS 119-7]
 gi|308123035|gb|EFO60297.1| FeS assembly ATPase SufC [Escherichia coli MS 145-7]
 gi|310337992|gb|EFQ03081.1| feS assembly ATPase SufC [Escherichia coli 1827-70]
 gi|313648964|gb|EFS13401.1| feS assembly ATPase SufC [Shigella flexneri 2a str. 2457T]
 gi|320181292|gb|EFW56211.1| Iron-sulfur cluster assembly ATPase protein SufC [Shigella boydii
           ATCC 9905]
 gi|320188370|gb|EFW63032.1| Iron-sulfur cluster assembly ATPase protein SufC [Escherichia coli
           O157:H7 str. EC1212]
 gi|320641897|gb|EFX11265.1| cysteine desulfurase ATPase component [Escherichia coli O157:H7
           str. G5101]
 gi|320647353|gb|EFX16161.1| cysteine desulfurase ATPase component [Escherichia coli O157:H-
           str. 493-89]
 gi|320652647|gb|EFX20916.1| cysteine desulfurase ATPase component [Escherichia coli O157:H-
           str. H 2687]
 gi|320653032|gb|EFX21228.1| cysteine desulfurase ATPase component [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658716|gb|EFX26393.1| cysteine desulfurase ATPase component [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668706|gb|EFX35511.1| cysteine desulfurase ATPase component [Escherichia coli O157:H7
           str. LSU-61]
 gi|323169250|gb|EFZ54926.1| feS assembly ATPase SufC [Shigella sonnei 53G]
 gi|323948023|gb|EGB44015.1| FeS assembly ATPase SufC [Escherichia coli H120]
 gi|324007048|gb|EGB76267.1| FeS assembly ATPase SufC [Escherichia coli MS 57-2]
 gi|324119166|gb|EGC13054.1| FeS assembly ATPase SufC [Escherichia coli E1167]
 gi|326342049|gb|EGD65830.1| Iron-sulfur cluster assembly ATPase protein SufC [Escherichia coli
           O157:H7 str. 1044]
 gi|326343601|gb|EGD67363.1| Iron-sulfur cluster assembly ATPase protein SufC [Escherichia coli
           O157:H7 str. 1125]
 gi|331058959|gb|EGI30936.1| FeS assembly ATPase SufC [Escherichia coli TA143]
 gi|331063560|gb|EGI35471.1| FeS assembly ATPase SufC [Escherichia coli TA271]
 gi|332093916|gb|EGI98969.1| feS assembly ATPase SufC [Shigella dysenteriae 155-74]
 gi|332757002|gb|EGJ87345.1| feS assembly ATPase SufC [Shigella flexneri 4343-70]
 gi|332757768|gb|EGJ88097.1| feS assembly ATPase SufC [Shigella flexneri 2747-71]
 gi|332758523|gb|EGJ88844.1| feS assembly ATPase SufC [Shigella flexneri K-671]
 gi|332766888|gb|EGJ97088.1| feS assembly ATPase SufC [Shigella flexneri 2930-71]
 gi|333003947|gb|EGK23482.1| feS assembly ATPase SufC [Shigella flexneri K-218]
 gi|333005924|gb|EGK25440.1| feS assembly ATPase SufC [Shigella flexneri K-272]
 gi|333017890|gb|EGK37195.1| feS assembly ATPase SufC [Shigella flexneri K-304]
 gi|333018831|gb|EGK38124.1| feS assembly ATPase SufC [Shigella flexneri K-227]
          Length = 248

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|260855506|ref|YP_003229397.1| component of SufBCD complex [Escherichia coli O26:H11 str. 11368]
 gi|257754155|dbj|BAI25657.1| component of SufBCD complex [Escherichia coli O26:H11 str. 11368]
 gi|323152811|gb|EFZ39081.1| feS assembly ATPase SufC [Escherichia coli EPECa14]
          Length = 248

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLAVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYRGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|77165947|ref|YP_344472.1| FeS assembly ATPase SufC [Nitrosococcus oceani ATCC 19707]
 gi|254433095|ref|ZP_05046603.1| FeS assembly ATPase SufC [Nitrosococcus oceani AFC27]
 gi|76884261|gb|ABA58942.1| Iron-regulated ABC transporter ATPase subunit SufC [Nitrosococcus
           oceani ATCC 19707]
 gi|207089428|gb|EDZ66699.1| FeS assembly ATPase SufC [Nitrosococcus oceani AFC27]
          Length = 258

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 182/244 (74%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL  ++   D  I+RG++L+V P EV AIMGPNGSGKSTL+ +L+G + YE+TAG
Sbjct: 1   MLTIRNLHTQV--DDKPILRGIDLQVNPGEVHAIMGPNGSGKSTLANVLAGREGYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++LY+G+++L+ +  ERA  G+FLAFQYPVEIPG+  +  LK ALN  RK R   EL   
Sbjct: 59  EVLYQGQNLLNLAPEERACAGVFLAFQYPVEIPGVSNVYLLKTALNAVRKHRGLPELDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L+R +N GFSGGEKK  EILQM +LEP+L ILDETDSGLDI
Sbjct: 119 DFLTLVREKMKLVKMDESFLQRAVNEGFSGGEKKRNEILQMAVLEPALAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNALRS +R  +++THYQRLL+YI PD +HVL  G+I+K+GD ++AL+LE+
Sbjct: 179 DALKIVADGVNALRSSERGLILVTHYQRLLDYIVPDYVHVLSLGRIVKSGDKTLALELEK 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 EGYG 242


>gi|325925548|ref|ZP_08186936.1| Iron-regulated ABC transporter ATPase subunit SufC [Xanthomonas
           perforans 91-118]
 gi|325544052|gb|EGD15447.1| Iron-regulated ABC transporter ATPase subunit SufC [Xanthomonas
           perforans 91-118]
          Length = 254

 Score =  274 bits (701), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL A I   D  I++GL+L ++P +V AIMGPNG+GKSTL  +L+G   YE+ AG
Sbjct: 1   MLNIQNLHASIAGKD--ILKGLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVGAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  SVQFDGKDLLDLPPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|222033438|emb|CAP76179.1| ATP-dependent transporter sufC [Escherichia coli LF82]
 gi|312946282|gb|ADR27109.1| cysteine desulfurase ATPase component [Escherichia coli O83:H1 str.
           NRG 857C]
          Length = 248

 Score =  274 bits (701), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL L V P EV AIMGPNGSGKSTLS  L+G +DYE+T+G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLGLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|300716481|ref|YP_003741284.1| ABC transporter [Erwinia billingiae Eb661]
 gi|299062317|emb|CAX59434.1| Probable ABC transporter ATP-dependent protein [Erwinia billingiae
           Eb661]
          Length = 248

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+  I   D EI+RGL+L+V+  EV AIMGPNGSGKSTLS  L+G ++YEIT G
Sbjct: 1   MLSIKDLQVSI--EDKEILRGLDLEVKAGEVHAIMGPNGSGKSTLSATLAGREEYEITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  +RA +GIF+AFQYPVEIPG+    FL+ A+N  RK R++  L   
Sbjct: 59  SVSFKGKDLLELSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTAVNSVRKYRDQDALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEDKIQLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVN LR   R+F+I+THYQR+L+YIKPD +HVL+ GKI+K+GD+S+   LEE
Sbjct: 179 DALKTVANGVNTLRDGKRAFIIVTHYQRILDYIKPDFVHVLYQGKIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|281178752|dbj|BAI55082.1| putative ABC transport ATP-binding component [Escherichia coli
           SE15]
 gi|323187106|gb|EFZ72422.1| feS assembly ATPase SufC [Escherichia coli RN587/1]
          Length = 248

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T+G
Sbjct: 1   MLSIKELHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|82777161|ref|YP_403510.1| cysteine desulfurase ATPase component [Shigella dysenteriae Sd197]
 gi|309788335|ref|ZP_07682939.1| feS assembly ATPase SufC [Shigella dysenteriae 1617]
 gi|81241309|gb|ABB62019.1| putative ATP-binding component of a transport system [Shigella
           dysenteriae Sd197]
 gi|308923717|gb|EFP69220.1| feS assembly ATPase SufC [Shigella dysenteriae 1617]
          Length = 248

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +    A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEDKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPGLCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|194438577|ref|ZP_03070666.1| FeS assembly ATPase SufC [Escherichia coli 101-1]
 gi|218705180|ref|YP_002412699.1| cysteine desulfurase ATPase [Escherichia coli UMN026]
 gi|253773361|ref|YP_003036192.1| cysteine desulfurase ATPase component [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161743|ref|YP_003044851.1| cysteine desulfurase ATPase component [Escherichia coli B str.
           REL606]
 gi|293405180|ref|ZP_06649172.1| ycf16 [Escherichia coli FVEC1412]
 gi|293409995|ref|ZP_06653571.1| FeS assembly ATPase SufC [Escherichia coli B354]
 gi|297517142|ref|ZP_06935528.1| cysteine desulfurase ATPase component [Escherichia coli OP50]
 gi|298380823|ref|ZP_06990422.1| Fe-S cluster assembly ATP-binding protein [Escherichia coli
           FVEC1302]
 gi|300898537|ref|ZP_07116870.1| FeS assembly ATPase SufC [Escherichia coli MS 198-1]
 gi|300930848|ref|ZP_07146218.1| FeS assembly ATPase SufC [Escherichia coli MS 187-1]
 gi|301026912|ref|ZP_07190308.1| FeS assembly ATPase SufC [Escherichia coli MS 69-1]
 gi|194422587|gb|EDX38585.1| FeS assembly ATPase SufC [Escherichia coli 101-1]
 gi|218432277|emb|CAR13167.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli UMN026]
 gi|242377409|emb|CAQ32158.1| SufC component of SufBCD Fe-S cluster scaffold complex, subunit of
           SufBCD Fe-S cluster scaffold complex [Escherichia coli
           BL21(DE3)]
 gi|253324405|gb|ACT29007.1| FeS assembly ATPase SufC [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253973644|gb|ACT39315.1| cysteine desulfurase ATPase component [Escherichia coli B str.
           REL606]
 gi|253977839|gb|ACT43509.1| cysteine desulfurase ATPase component [Escherichia coli BL21(DE3)]
 gi|291427388|gb|EFF00415.1| ycf16 [Escherichia coli FVEC1412]
 gi|291470463|gb|EFF12947.1| FeS assembly ATPase SufC [Escherichia coli B354]
 gi|298278265|gb|EFI19779.1| Fe-S cluster assembly ATP-binding protein [Escherichia coli
           FVEC1302]
 gi|300357801|gb|EFJ73671.1| FeS assembly ATPase SufC [Escherichia coli MS 198-1]
 gi|300395259|gb|EFJ78797.1| FeS assembly ATPase SufC [Escherichia coli MS 69-1]
 gi|300461323|gb|EFK24816.1| FeS assembly ATPase SufC [Escherichia coli MS 187-1]
 gi|323962173|gb|EGB57768.1| FeS assembly ATPase SufC [Escherichia coli H489]
 gi|323973939|gb|EGB69111.1| FeS assembly ATPase SufC [Escherichia coli TA007]
          Length = 248

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  AVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|86148046|ref|ZP_01066348.1| putative ABC superfamily (atp_bind) transport protein [Vibrio sp.
           MED222]
 gi|85834179|gb|EAQ52335.1| putative ABC superfamily (atp_bind) transport protein [Vibrio sp.
           MED222]
          Length = 248

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL   +   +  I++G+NL V+P EV AIMGPNGSGKSTLS  L+G  DYE+ +G
Sbjct: 1   MLEIKNLHVSV--EENTILKGINLTVKPGEVHAIMGPNGSGKSTLSATLAGKDDYEVVSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I++KG+ + +    ERA +G+FLAFQYPVEIPG+    FL  ALNE R+ R  + +   
Sbjct: 59  EIVFKGQDLTELDPEERAGEGVFLAFQYPVEIPGVSNKLFLNTALNEVREYRGLEPIDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  ++L+R +N GFSGGEKK  +ILQM +L P LCILDETDSGLDI
Sbjct: 119 DFEDLLEEKAQLLKMPANLLQRSVNEGFSGGEKKRNDILQMAVLSPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++GVNAL+++ R+F+++THYQR+LNYIKPD +HVL+ GKI+K+GD+++A +LEE
Sbjct: 179 DALKAVSEGVNALQNEQRAFILVTHYQRILNYIKPDFVHVLYQGKIVKSGDHTLAQELEE 238

Query: 241 NGYAELIKE 249
            GY  +I E
Sbjct: 239 KGYGWIIDE 247


>gi|208779238|ref|ZP_03246584.1| FeS assembly ATPase SufC [Francisella novicida FTG]
 gi|208745038|gb|EDZ91336.1| FeS assembly ATPase SufC [Francisella novicida FTG]
          Length = 249

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 181/246 (73%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   + +   +I++GLNL V+  EV AIMGPNG+GKSTLS +L+G   YEIT G
Sbjct: 2   LLEIKDLHVSVGEQKKQILKGLNLTVKKGEVHAIMGPNGAGKSTLSNVLAGKDGYEITQG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ + D SI ERA+ GIFL+ QYP+EIPG+  +QFLK ALN  RK   E E+   
Sbjct: 62  LITFDGKDLNDLSISERAAAGIFLSLQYPIEIPGVSNVQFLKTALNSIRKQNGEDEIDAI 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+++    L I+   + R +N GFSGGEKK  E+LQ+ +LEP L ILDETDSGLDI
Sbjct: 122 SFMKKLKENMQVLKIDQKYMSRGVNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ +QG N++RS DRSFL+ITHYQRLL++I+PD +HVL +GKI+KTG   +AL+LEE
Sbjct: 182 DALQVVSQGANSMRSADRSFLVITHYQRLLDHIQPDFVHVLADGKIVKTGGKELALELEE 241

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 242 KGYSWL 247


>gi|114327988|ref|YP_745145.1| ATP-dependent transporter sufC [Granulibacter bethesdensis CGDNIH1]
 gi|114316162|gb|ABI62222.1| ATP-dependent transporter sufC [Granulibacter bethesdensis CGDNIH1]
          Length = 249

 Score =  274 bits (701), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL AKI   D  I++G++L+V   EV AIMGPNGSGKSTLSY+L+GH+ YE+T G
Sbjct: 1   MLKIENLHAKI--EDKPILKGIDLQVPQGEVHAIMGPNGSGKSTLSYVLAGHEGYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             L++G  +L+    ERA+ G+FLAFQ P+E+PG+  M FL+ ALN  R+AR E+EL   
Sbjct: 59  SALFEGRELLEMEPEERAAAGVFLAFQSPIELPGVNNMNFLRTALNAVRRARGEEELDAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R     L +  DMLKR +N+GFSGGEKK  E+LQM +L P L ILDETDSGLDI
Sbjct: 119 AFLKLARAEAKRLSMPDDMLKRNVNVGFSGGEKKRNEVLQMSILRPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI   GVNALR  + S LIITH+QRLL++I PD +HVL  G++I++G   +A  LE 
Sbjct: 179 DALKIVGDGVNALRGPNFSALIITHHQRLLDHIVPDHVHVLFGGRVIRSGGPELARQLER 238

Query: 241 NGYAELIKE 249
            GYA +IKE
Sbjct: 239 EGYAAVIKE 247


>gi|284921603|emb|CBG34675.1| ABC transport ATP-binding protein (component of SufBCD complex)
           [Escherichia coli 042]
          Length = 247

 Score =  274 bits (701), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|91762134|ref|ZP_01264099.1| FeS assembly ATPase SufC [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717936|gb|EAS84586.1| FeS assembly ATPase SufC [Candidatus Pelagibacter ubique HTCC1002]
          Length = 244

 Score =  274 bits (700), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 187/246 (76%), Gaps = 3/246 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+A I   + EI++GLNL+++P EV AIMGPNGSGKSTLS +LSG K Y +T G
Sbjct: 1   MLTIKNLKANI--DNKEILKGLNLEIKPGEVHAIMGPNGSGKSTLSNVLSGKKGYTVT-G 57

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ Y  E++L+  I ERA KGIFLAFQYP+EIPG+    FLK +LN  +KA+ +KEL   
Sbjct: 58  EVKYFNENLLELEIEERAHKGIFLAFQYPLEIPGVNTNIFLKTSLNAIKKAKGKKELDAI 117

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++   EL  +  +L R LN+GFSGGEKK  EILQM +L P L ILDETDSGLDI
Sbjct: 118 EFLKLVKQKAGELKFDEKILSRQLNVGFSGGEKKKNEILQMSILNPKLSILDETDSGLDI 177

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS+D SFLIITHYQRLL+YIKPD +HVL NG+I+K+G   +A++LE 
Sbjct: 178 DALKIVSEGVNALRSKDSSFLIITHYQRLLDYIKPDFVHVLINGQIVKSGGSELAMELES 237

Query: 241 NGYAEL 246
            GY  L
Sbjct: 238 KGYETL 243


>gi|218709890|ref|YP_002417511.1| cysteine desulfurase ATPase [Vibrio splendidus LGP32]
 gi|218322909|emb|CAV19086.1| Probable ATP-dependent transporter sufC [Vibrio splendidus LGP32]
          Length = 248

 Score =  274 bits (700), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL   +   +  I++G+NL V+P EV AIMGPNGSGKSTLS  L+G  DYE+ +G
Sbjct: 1   MLEIKNLHVSV--EENTILKGINLTVKPGEVHAIMGPNGSGKSTLSATLAGKDDYEVVSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I++KG+ + +    ERA +G+FLAFQYPVEIPG+    FL  ALNE R+ R  + +   
Sbjct: 59  EIVFKGQDLTELDPEERAGEGVFLAFQYPVEIPGVSNKLFLNTALNEVREYRGLEPIDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  ++L+R +N GFSGGEKK  +ILQM +L P LCILDETDSGLDI
Sbjct: 119 DFEDLLEEKAQLLKMPANLLQRSVNEGFSGGEKKRNDILQMAVLSPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++GVNAL+++ R+F+++THYQR+LNYIKPD +HVL+ GKI+K+GD+++A +LEE
Sbjct: 179 DALKAVSEGVNALQNEKRAFILVTHYQRILNYIKPDFVHVLYQGKIVKSGDHTLAQELEE 238

Query: 241 NGYAELIKE 249
            GY  +I E
Sbjct: 239 KGYGWIIDE 247


>gi|332520188|ref|ZP_08396652.1| FeS assembly ATPase SufC [Lacinutrix algicola 5H-3-7-4]
 gi|332044747|gb|EGI80941.1| FeS assembly ATPase SufC [Lacinutrix algicola 5H-3-7-4]
          Length = 250

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 185/249 (74%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IK+L A +   D  I++G+NL+V+P EV AIMGPNGSGKSTL+ +++G ++YE+  G
Sbjct: 1   MLQIKDLHASV--EDKSILKGINLEVKPGEVHAIMGPNGSGKSTLASVIAGKEEYEVEKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GE + D +  ERA KGIFL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  EILLDGEDLEDLAADERAHKGIFLSFQYPVEIPGVSVTNFMKTAINETRKAKGLEDMPAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DMLKMIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL+YI PD +HVL+NG+I+K+G   +A +LEE
Sbjct: 179 DALRIVANGVNKLKSKDNAVVVITHYQRLLDYIVPDFVHVLYNGRIVKSGGKELAHELEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|58038584|ref|YP_190548.1| ABC transporter ATP-binding protein [Gluconobacter oxydans 621H]
 gi|58000998|gb|AAW59892.1| ABC transporter ATP-binding protein [Gluconobacter oxydans 621H]
          Length = 256

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 183/251 (72%), Gaps = 4/251 (1%)

Query: 1   MLEIKNLRAKIVDTD---TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
            L+I+ L+A+I D D    +I++GL+L+V   EV AIMGPNGSGKSTLSY+L+G  DYE+
Sbjct: 4   FLKIQGLQARI-DADGTPKDILKGLDLEVPKGEVHAIMGPNGSGKSTLSYVLAGRDDYEV 62

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T G   +KG+ +L     ERA+ G+FLAFQ PVE+PG+    FL+ A+N  R+AR E EL
Sbjct: 63  TGGSATFKGQDLLALEPEERAALGLFLAFQSPVELPGVNNANFLRTAVNAVRRARGEAEL 122

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
               F + VR  T  L ++ DMLKR +N+GFSGGEKK  E+LQMRLL+PS  ILDETDSG
Sbjct: 123 DAVAFLKAVRAETKHLSMSDDMLKRAVNVGFSGGEKKRNEVLQMRLLQPSFAILDETDSG 182

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL+I A+GVN+LRS D S L+ITH+QRLL+YI PD +HV+ +G+II +G   IA  
Sbjct: 183 LDIDALRIVAEGVNSLRSPDFSALVITHHQRLLDYIVPDRVHVMAHGRIIHSGGPDIAKT 242

Query: 238 LEENGYAELIK 248
           LE+ GY + ++
Sbjct: 243 LEKQGYTQFLE 253


>gi|148261258|ref|YP_001235385.1| FeS assembly ATPase SufC [Acidiphilium cryptum JF-5]
 gi|326404672|ref|YP_004284754.1| FeS assembly ATPase SufC [Acidiphilium multivorum AIU301]
 gi|146402939|gb|ABQ31466.1| FeS assembly ATPase SufC [Acidiphilium cryptum JF-5]
 gi|325051534|dbj|BAJ81872.1| FeS assembly ATPase SufC [Acidiphilium multivorum AIU301]
          Length = 247

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/246 (56%), Positives = 175/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK L A I     EI+RG++L V   EV AIMGPNG+GKSTLSY+LSG + YE+T G
Sbjct: 1   MLEIKGLTATI--DGKEILRGIDLTVPEGEVHAIMGPNGAGKSTLSYVLSGREGYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y G  +L     ERA+ G+FLAFQYPVE+PG+    F++ ALN  R+AR E EL   
Sbjct: 59  SVTYNGADLLAMEPEERAAAGVFLAFQYPVELPGVGNANFIRTALNAIRRARGEAELDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++ R     L +  DMLKR +N+GFSGGEKK  E+LQM LL+P+L +LDETDSGLDI
Sbjct: 119 QFLKEARAAVKALKMPDDMLKRNVNVGFSGGEKKRNEVLQMALLKPTLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVNALR    S L+ITHYQRLL++I PD +HVL  GKI+++G   +A +LE 
Sbjct: 179 DALKIVAEGVNALRGPSFSALVITHYQRLLDHIVPDRVHVLAAGKIVRSGGPELARELEA 238

Query: 241 NGYAEL 246
           NGYA L
Sbjct: 239 NGYAGL 244


>gi|261822005|ref|YP_003260111.1| cysteine desulfurase ATPase component [Pectobacterium wasabiae
           WPP163]
 gi|261606018|gb|ACX88504.1| FeS assembly ATPase SufC [Pectobacterium wasabiae WPP163]
          Length = 248

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL+  +     EII+GLNL ++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIENLKVSV--EGKEIIKGLNLTIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  +RA +G+F+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVSFKGKDLLELSPEDRAGEGVFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIKLLNMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 QGYGWL 244


>gi|92113360|ref|YP_573288.1| FeS assembly ATPase SufC [Chromohalobacter salexigens DSM 3043]
 gi|91796450|gb|ABE58589.1| Iron-regulated ABC transporter ATPase subunit SufC
           [Chromohalobacter salexigens DSM 3043]
          Length = 250

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 187/249 (75%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+K+L   +    +EI++GL+L + P EV A+MGPNG+GKSTLS +++G   YE+T+G
Sbjct: 1   MLEVKDLHVTV--EGSEILKGLSLTINPGEVHALMGPNGAGKSTLSAVIAGKDGYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL++G+ +L+  I ERA  GI L FQYPVEIPG+  +  LK ALN QR+AR EKEL  P
Sbjct: 59  QILFEGQDLLEMEIEERALAGILLGFQYPVEIPGVKNIYLLKAALNAQREARGEKELPAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR+  + + ++   L+R +N GFSGGEKK  EILQM +L+P L +LDE DSGLDI
Sbjct: 119 EFMKLVREKLSFMKMDGSFLQRAVNEGFSGGEKKRNEILQMLVLQPKLAMLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+KI A+GVN+LRSQDR+ L++THYQRLL +I PD +HVL +G+I+K+GD ++A +LE 
Sbjct: 179 DAMKIVAEGVNSLRSQDRAILMVTHYQRLLEHIVPDHVHVLVDGRIVKSGDKNLAHELET 238

Query: 241 NGYAELIKE 249
            GY  +++E
Sbjct: 239 RGYEWVLEE 247


>gi|86134638|ref|ZP_01053220.1| FeS assembly ATPase SufC [Polaribacter sp. MED152]
 gi|85821501|gb|EAQ42648.1| FeS assembly ATPase SufC [Polaribacter sp. MED152]
          Length = 249

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A I   +  I++GLNL+V+  EV AIMGPNG+GKSTL+ +++G +DYE+T G
Sbjct: 1   MLKINNLHAAI--EEKSILKGLNLEVKAGEVHAIMGPNGAGKSTLANIVAGKEDYEVTNG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I   GE + + +  ERA  G+FL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  SIELDGEDLSELAPEERAHNGVFLSFQYPVEIPGVSVTNFIKTAINETRKAKGLEDMPAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  +K+R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DMLKKIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S++ + ++ITHYQRLL+YI PD +HVLH+GKI+KTGD S+AL+LE 
Sbjct: 179 DALRIVANGVNKLKSKNNAVIVITHYQRLLDYIVPDFVHVLHDGKIVKTGDASLALELEA 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|24113071|ref|NP_707581.1| cysteine desulfurase ATPase component [Shigella flexneri 2a str.
           301]
 gi|24052044|gb|AAN43288.1| putative ATP-binding component of a transport system [Shigella
           flexneri 2a str. 301]
          Length = 248

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+D+GLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDTGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|71083443|ref|YP_266162.1| FeS assembly ATPase SufC [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062556|gb|AAZ21559.1| FeS assembly ATPase SufC [Candidatus Pelagibacter ubique HTCC1062]
          Length = 244

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 187/246 (76%), Gaps = 3/246 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L+A I   + EI++GLNL+++P EV AIMGPNGSGKSTLS +LSG K Y +T G
Sbjct: 1   MLTIKDLKANI--DNKEILKGLNLEIKPGEVHAIMGPNGSGKSTLSNVLSGKKGYTVT-G 57

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ Y  E++L+  I ERA KGIFLAFQYP+EIPG+    FLK +LN  +KA+ EKEL   
Sbjct: 58  EVKYFNENLLELEIEERAHKGIFLAFQYPLEIPGVNTNIFLKTSLNAIKKAKGEKELDAI 117

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++   EL  +  +L R LN+GFSGGEKK  EILQM +L P L ILDETDSGLDI
Sbjct: 118 EFLKLVKQKAGELKFDEKILSRQLNVGFSGGEKKKNEILQMSILNPKLSILDETDSGLDI 177

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNALRS+D SFLIITHYQRLL+YIKPD +HVL NG+I+K+G   +A++LE 
Sbjct: 178 DALKIVSEGVNALRSKDSSFLIITHYQRLLDYIKPDFVHVLINGQIVKSGGSELAMELES 237

Query: 241 NGYAEL 246
            GY  L
Sbjct: 238 KGYETL 243


>gi|328676940|gb|AEB27810.1| Iron-sulfur cluster assembly ATPase protein SufC [Francisella cf.
           novicida Fx1]
          Length = 249

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 180/246 (73%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   + +   +I++GLNL V+  EV AIMGPNG+GKSTLS +L+G   YEI  G
Sbjct: 2   LLEIKDLHVSVGEQKKQILKGLNLTVKKGEVHAIMGPNGAGKSTLSNVLAGKDGYEIIQG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ + D SI ERA+ GIFL+ QYP+EIPG+  +QFLK ALN  RK   E E+   
Sbjct: 62  SITFDGKDLNDLSISERAAAGIFLSLQYPIEIPGVSNVQFLKTALNSIRKQNGEDEIDAI 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+++    L I+   + R +N GFSGGEKK  E+LQ+ +LEP L ILDETDSGLDI
Sbjct: 122 SFMKKLKENMQVLKIDQKYMSRGVNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ +QG N++RS DRSFL+ITHYQRLL++I+PD +HVL +GKI+KTG   +AL+LEE
Sbjct: 182 DALQVVSQGANSMRSADRSFLVITHYQRLLDHIQPDFVHVLADGKIVKTGGKELALELEE 241

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 242 KGYSWL 247


>gi|89256548|ref|YP_513910.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314979|ref|YP_763702.1| ABC transporter ATP-binding protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156502667|ref|YP_001428732.1| FeS assembly ATPase SufC [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010973|ref|ZP_02275904.1| FeS assembly ATPase SufC [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254367872|ref|ZP_04983892.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica 257]
 gi|254369466|ref|ZP_04985478.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. holarctica FSC022]
 gi|290952913|ref|ZP_06557534.1| sufS activator complex, sufC subunit [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313913|ref|ZP_06804479.1| sufS activator complex, sufC subunit [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144379|emb|CAJ79668.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129878|gb|ABI83065.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Francisella tularensis subsp. holarctica OSU18]
 gi|134253682|gb|EBA52776.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica 257]
 gi|156253270|gb|ABU61776.1| FeS assembly ATPase SufC [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|157122416|gb|EDO66556.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. holarctica FSC022]
          Length = 249

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 180/246 (73%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   + +   +I++GLNL V+  EV AIMGPNG+GKSTLS +L+G   YEIT G
Sbjct: 2   LLEIKDLHVSVGEQKKQILKGLNLTVKKGEVHAIMGPNGAGKSTLSNVLAGKDGYEITQG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ + D SI ERA+ GIFL+ QYP+EIPG+  +QFLK ALN  RK   E E+   
Sbjct: 62  SITFDGKDLNDLSISERAAAGIFLSLQYPIEIPGVSNVQFLKTALNSIRKQNGEDEIDAI 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+++    L I+   + R +N GFSGGEKK  E+LQ+ +LEP L ILDETDSGLDI
Sbjct: 122 SFMKKLKENMQVLKIDQKYMSRGVNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ +QG N++RS DRSFL+ITHYQRLL++I+PD +HVL +GKI+K G   +AL+LEE
Sbjct: 182 DALQVVSQGANSMRSADRSFLVITHYQRLLDHIQPDFVHVLADGKIVKIGGKELALELEE 241

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 242 KGYSWL 247


>gi|88811718|ref|ZP_01126972.1| probable ABC transporter ATP-binding protein [Nitrococcus mobilis
           Nb-231]
 gi|88791109|gb|EAR22222.1| probable ABC transporter ATP-binding protein [Nitrococcus mobilis
           Nb-231]
          Length = 251

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 134/244 (54%), Positives = 182/244 (74%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI+NL AKI     EI++G+NLK+E  E  AIMGPNGSGKSTL+ +L+G   YE+T G
Sbjct: 3   LLEIRNLHAKI--QGVEILKGINLKIERGETHAIMGPNGSGKSTLAKVLAGDPSYEVTDG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ ++  ++L+ S  +RA +G+FL FQYPVEIPG+    FLK ALN  RK R E+EL   
Sbjct: 61  EVFFQDRNLLELSPEDRAREGVFLGFQYPVEIPGVSNTYFLKAALNAIRKYRGEQELDAM 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++    + ++  +L+RP+N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 121 EFLQLIKERAKSVNLDESLLRRPVNEGFSGGEKKRNEIFQLAVLEPYLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A+GVN+LR+++R FL+ITHYQRLLNYI PD +HVL  G+I+KTG   +A +LEE
Sbjct: 181 DALRTVAEGVNSLRNEERGFLVITHYQRLLNYIVPDEVHVLLRGRIVKTGGKELAEELEE 240

Query: 241 NGYA 244
           +GYA
Sbjct: 241 SGYA 244


>gi|160872225|ref|ZP_02062357.1| FeS assembly ATPase SufC [Rickettsiella grylli]
 gi|159121024|gb|EDP46362.1| FeS assembly ATPase SufC [Rickettsiella grylli]
          Length = 252

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 184/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+ +I   + +I+RG+NL ++P E+ AIMGPNGSGKSTL+ +++G   Y IT G
Sbjct: 1   MLIIKNLQVEI--DNKKILRGINLHIKPGEIHAIMGPNGSGKSTLANIIAGRFHYTITQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I Y GE +   +  +RA  G+FLAFQYP+EIPG+  +  LK ALN  RKAR E EL   
Sbjct: 59  EIRYLGEDLTRLAPEQRAHAGLFLAFQYPIEIPGVSNIYLLKAALNAIRKARGETELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++V++    + ++ D L R +N GFSGGEKK  EILQM LLEP L +LDETDSGLDI
Sbjct: 119 DFLKRVKEKLNVVEMDHDFLYRAVNAGFSGGEKKRNEILQMALLEPQLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVN LRS +R+ ++ITHYQRLL+YIKPD +H+L  GKII++GD+S+A  LE+
Sbjct: 179 DALKIVAKGVNTLRSPERAMMLITHYQRLLDYIKPDYVHILAGGKIIRSGDFSLAQTLEK 238

Query: 241 NGYAELIKE 249
            GYA  +++
Sbjct: 239 EGYATFLQQ 247


>gi|253688825|ref|YP_003018015.1| FeS assembly ATPase SufC [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755403|gb|ACT13479.1| FeS assembly ATPase SufC [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 248

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL+  +     EII+GLNL ++P EV AIMGPNGSGKSTLS  L+G ++YE+T G
Sbjct: 1   MLSIENLKVSV--EGKEIIKGLNLTIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  +RA +G+F+AFQYPVEIPG+    FL+ ++N  RK R ++ L   
Sbjct: 59  SVDFKGKDLLELSPEDRAGEGVFMAFQYPVEIPGVSNQFFLQTSVNAVRKYREQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIKLLNMPEDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSNGVNSLRDGKRSFIIVTHYQRILDYIKPDHVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 QGYGWL 244


>gi|283856255|ref|YP_162160.2| FeS assembly ATPase SufC [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775250|gb|AAV89049.2| FeS assembly ATPase SufC [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 250

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 181/248 (72%), Gaps = 3/248 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NLRA++   + +I++GLNL++   E+ AIMGPNG+GKSTLSY+LSG   Y +T G
Sbjct: 4   MLEIRNLRAEV--DNKQILKGLNLEIGAGEIHAIMGPNGAGKSTLSYVLSGKPGYTVTDG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G+ +L     ERA+ G+FL FQYPVEI G+  + FL+ A N QRK R E+EL   
Sbjct: 62  SACFMGKDLLAMEPHERAAAGLFLGFQYPVEIAGVSNLHFLRAAANAQRKTRGEEELSAG 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +   K    LGIN +MLKRP+N+GFSGGEKK  E++QM +L+P L ILDETDSGLDI
Sbjct: 122 EFIKIASKEAKALGINPEMLKRPVNVGFSGGEKKRNEMMQMAVLQPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVN-ALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL+I ++ +N  +R  DRS L+ITHYQRLL+++KPD +HVL  G+I+++G   +AL+LE
Sbjct: 182 DALRIVSESINRVMRQPDRSVLLITHYQRLLDHVKPDFVHVLVKGQIVRSGGAELALELE 241

Query: 240 ENGYAELI 247
             GY EL+
Sbjct: 242 REGYGELV 249


>gi|88799895|ref|ZP_01115467.1| Cysteine desulfurase activator ATPase [Reinekea sp. MED297]
 gi|88777326|gb|EAR08529.1| Cysteine desulfurase activator ATPase [Reinekea sp. MED297]
          Length = 249

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L A +   +  I++GL+L ++P EV AIMGPNG+GKSTL  +L+G + Y +T G
Sbjct: 1   MLSIKDLHANV--EEKSILKGLSLDIKPGEVHAIMGPNGAGKSTLGNVLAGREGYSVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +  E++LD    ERA KG+FLAFQYPVEIPG+  M+FLK +++  R+A  ++     
Sbjct: 59  SVQFNNEALLDLDAEERARKGLFLAFQYPVEIPGVSNMEFLKASVDAVREANGQEPYSSV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +  R+    + +  D LKR +N GFSGGEKK  E+LQM LLEP+LCILDETDSGLDI
Sbjct: 119 DFIKLAREKCKAVNLPADFLKRGVNEGFSGGEKKRNELLQMMLLEPTLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVNALRS +RSF+++THYQRLL+YI PD +HVL +GKI+K+G   +AL+LE+
Sbjct: 179 DALQVVADGVNALRSPERSFIVVTHYQRLLDYIVPDYVHVLADGKIVKSGGKELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 DGY 241


>gi|294626270|ref|ZP_06704873.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292599416|gb|EFF43550.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 254

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A I   D  I++ L+L ++P +V AIMGPNG+GKSTL  +L+G   YE++AG
Sbjct: 1   MLKITNLHASIAGKD--ILKSLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  SVQFDGKDLLDLPPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|331673239|ref|ZP_08374007.1| FeS assembly ATPase SufC [Escherichia coli TA280]
 gi|331069437|gb|EGI40824.1| FeS assembly ATPase SufC [Escherichia coli TA280]
          Length = 248

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I +L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSINDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|170768686|ref|ZP_02903139.1| FeS assembly ATPase SufC [Escherichia albertii TW07627]
 gi|170122234|gb|EDS91165.1| FeS assembly ATPase SufC [Escherichia albertii TW07627]
          Length = 248

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I++L   +   D  I+RGL+L V P EV  IMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIRDLHVSV--EDKAILRGLSLDVRPGEVHVIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +KG+ +L+ S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R +  L   
Sbjct: 59  TIEFKGKDLLELSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQDALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|330994036|ref|ZP_08317966.1| putative ATP-dependent transporter [Gluconacetobacter sp. SXCC-1]
 gi|329758982|gb|EGG75496.1| putative ATP-dependent transporter [Gluconacetobacter sp. SXCC-1]
          Length = 257

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 180/251 (71%), Gaps = 2/251 (0%)

Query: 1   MLEIKNLRAKIVDTDT--EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEIT 58
            + I  L A+I D  T  EI+RG++L++   EV AIMGPNGSGKSTLSY+L+G +DYE+T
Sbjct: 5   FVSINGLCARISDEGTPKEILRGVDLEIPAGEVHAIMGPNGSGKSTLSYVLAGREDYEVT 64

Query: 59  AGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELL 118
            G   ++G+ +L     ERA+ G+FLAFQ PVE+PG+    FL+ A+N  R+AR   EL 
Sbjct: 65  GGSATFRGQDLLALEPEERAALGLFLAFQTPVELPGVNNANFLRTAVNAVRRARGMDELD 124

Query: 119 IPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGL 178
              F + VRK T  L ++ +MLKR +N+GFSGGEKK  E+LQMR+L+PS  ILDETDSGL
Sbjct: 125 AVAFLKAVRKETKHLSMSDEMLKRNVNVGFSGGEKKRNEVLQMRMLQPSFAILDETDSGL 184

Query: 179 DIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDL 238
           DIDAL+I A+GVN+LRS D S L+ITH+QRLL+YI PD IHV+  G+II +G   +A  L
Sbjct: 185 DIDALRIVAEGVNSLRSPDFSALVITHHQRLLDYIVPDRIHVMAKGRIIHSGGPELARQL 244

Query: 239 EENGYAELIKE 249
           E  GYA+ + E
Sbjct: 245 EAQGYAQFLSE 255


>gi|29468208|gb|AAO85447.1| putative ATP-dependent transporter Ycf16 [Neoceratium horridum]
          Length = 263

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 184/249 (73%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A+I   + EI+RG+NL+V+P E+ AIMGPNGSGKSTL+ +L+G +DYE+T+G
Sbjct: 1   MLSIKNLEARI--EEKEILRGINLEVKPGEIHAIMGPNGSGKSTLASVLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+ + G+ +LD    ERA +GIFLA QYPVEIPG+    F+K A+N+ R+   EK L   
Sbjct: 59  DVDFLGKDLLDMDADERAREGIFLACQYPVEIPGVSTTNFMKTAINQVREHHGEKPLDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + +++    + I+  +L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 SFLKLMKEKMKLVEIDQSLLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNAL+S+D + +++THYQRLL+YI PD +HVL+ G+I+K+G   +AL+LE 
Sbjct: 179 DALKIVANGVNALKSKDNATIVVTHYQRLLDYIVPDYVHVLYKGRIVKSGTKDLALELEA 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|311695876|gb|ADP98749.1| FeS assembly ATPase SufC [marine bacterium HP15]
          Length = 257

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 184/246 (74%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     EI++G+NL+++  EV AIMGPNGSGKSTLS +L+G++ +E+T G
Sbjct: 1   MLSIKNLHASV--EGKEILKGINLEIKAGEVHAIMGPNGSGKSTLSQVLAGNEAFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I   G+++L+    ERA +GIFLAFQYPVEIPG+  +QFL+ A+N  R+ + + E+   
Sbjct: 59  EITLNGDNLLELETEERAREGIFLAFQYPVEIPGVSNLQFLRTAVNAMRQHKGQDEMNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++I+ ++ ++   LKR +N GFSGGEKK  EI+Q  LL+P L ILDETDSGLDI
Sbjct: 119 EFMKLAKEISKQVDLDPAFLKRGVNEGFSGGEKKRNEIMQALLLQPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALR++DR+ L++THYQRLLN+I PD +HVL  GKIIK+G   +AL+LEE
Sbjct: 179 DALKVVSDGVNALRAEDRAILMVTHYQRLLNHIVPDYVHVLAGGKIIKSGGRELALELEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 RGYGWL 244


>gi|332292134|ref|YP_004430743.1| FeS assembly ATPase SufC [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170220|gb|AEE19475.1| FeS assembly ATPase SufC [Krokinobacter diaphorus 4H-3-7-5]
          Length = 250

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +K+L A+I + D  I++G+NL+++  EV AIMGPNGSGKSTL+ +++G ++YE++ G
Sbjct: 1   MLSVKDLHARIEEKD--ILKGINLEIKAGEVHAIMGPNGSGKSTLASVIAGKEEYEVSGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI  +GESIL+    ERA +G+FL+FQYPVEIPG+ +  F+K A+NE RKA+  + +   
Sbjct: 59  DIELEGESILEMDPEERAHEGVFLSFQYPVEIPGVSVTNFIKTAINETRKAKGLENMPAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+++    L ++   L R LN+GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKKIKEKAELLEMDRKFLSRSLNVGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + L+ITHYQRLL YI PD +HVL NGKI+++G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLKSKDNAVLVITHYQRLLEYIVPDFVHVLMNGKIVRSGGKELALELEE 238

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 239 KGYDWLKEE 247


>gi|71274755|ref|ZP_00651043.1| FeS assembly ATPase SufC [Xylella fastidiosa Dixon]
 gi|71901189|ref|ZP_00683292.1| FeS assembly ATPase SufC [Xylella fastidiosa Ann-1]
 gi|71164487|gb|EAO14201.1| FeS assembly ATPase SufC [Xylella fastidiosa Dixon]
 gi|71729033|gb|EAO31161.1| FeS assembly ATPase SufC [Xylella fastidiosa Ann-1]
          Length = 280

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I  L A +     EI++GL+L + P +V AIMGPNG+GKSTL ++L+G   Y++TAG
Sbjct: 3   MLKIDTLHASVAGK--EILKGLSLDIAPGQVHAIMGPNGAGKSTLGHILAGRDGYDVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +    +L     ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 61  QVTFDNRPLLTLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEEELDSI 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 121 QFLKRVREKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I++TG   +AL+LEE
Sbjct: 181 DALKTVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVETGGPELALELEE 240

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 241 HGYTWL 246


>gi|209545423|ref|YP_002277652.1| FeS assembly ATPase SufC [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533100|gb|ACI53037.1| FeS assembly ATPase SufC [Gluconacetobacter diazotrophicus PAl 5]
          Length = 257

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 179/251 (71%), Gaps = 2/251 (0%)

Query: 1   MLEIKNLRAKIVD--TDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEIT 58
            + I  L A+I D   + EI+RG++L +   EV AIMGPNGSGKSTLSY+L+G +DYE+T
Sbjct: 5   FVRIAGLCARISDGGVEKEILRGVDLDIPAGEVHAIMGPNGSGKSTLSYVLAGREDYEVT 64

Query: 59  AGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELL 118
           AG   +KG+ +L      RA+ G+FLAFQ PVE+PG+    FL+ A+N  R+AR + EL 
Sbjct: 65  AGTATFKGQDLLALDPEARAALGLFLAFQAPVELPGVNNANFLRTAVNAVRRARGQDELD 124

Query: 119 IPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGL 178
              F + VRK T  L ++ DMLKR +N+GFSGGEKK  E+LQMR+L+PS  ILDETDSGL
Sbjct: 125 AVAFLKAVRKETKHLSMSDDMLKRNVNVGFSGGEKKRNEVLQMRMLQPSFAILDETDSGL 184

Query: 179 DIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDL 238
           DIDAL+I A+GVN+LR+ D S L+ITH+QRLL+YI PD IHV+  G+II +G   +A  L
Sbjct: 185 DIDALRIVAEGVNSLRAPDFSALVITHHQRLLDYIVPDRIHVMARGRIIHSGGPELAKQL 244

Query: 239 EENGYAELIKE 249
           E  GYA  + E
Sbjct: 245 EAQGYARFLAE 255


>gi|254491644|ref|ZP_05104823.1| FeS assembly ATPase SufC [Methylophaga thiooxidans DMS010]
 gi|224463122|gb|EEF79392.1| FeS assembly ATPase SufC [Methylophaga thiooxydans DMS010]
          Length = 253

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 181/244 (74%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A +     EI+RG+N+ V P EV AIMGPNG+GKSTLS +L+G   YE+T G
Sbjct: 1   MLEIKNLHASV--DGKEILRGINMTVNPGEVHAIMGPNGAGKSTLSNVLAGRDGYEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++YKG+++L+    ERA +G+FLAFQYPVEIPG+  +  LK ALN  RK +  +E+   
Sbjct: 59  EVIYKGQNLLELEPEERAQRGVFLAFQYPVEIPGVSNIYLLKAALNAVRKYQGLEEVDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR     + ++   L R +N GFSGGEKK  EILQM +LEP+L ILDETDSGLDI
Sbjct: 119 DFLTLVRDRMKLVKMDEQFLHRNVNEGFSGGEKKRNEILQMAVLEPALAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A+GVNALR++DRS ++ITHYQRLL++I PD +HVL  GKI+K+GD  +A +LE+
Sbjct: 179 DALKTVAEGVNALRAEDRSIVMITHYQRLLDHIVPDFVHVLSEGKIVKSGDKELAKELEK 238

Query: 241 NGYA 244
           +GY+
Sbjct: 239 SGYS 242


>gi|56459264|ref|YP_154545.1| cysteine desulfurase activator ATPase [Idiomarina loihiensis L2TR]
 gi|56178274|gb|AAV80996.1| Cysteine desulfurase activator ATPase [Idiomarina loihiensis L2TR]
          Length = 252

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 182/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L A++   +T I++GLNL+++P EV AIMGPNG+GKSTL Y+LSG   YE+ +G
Sbjct: 1   MLSIKDLHARV--EETTILKGLNLEIKPGEVHAIMGPNGAGKSTLGYVLSGRDGYEVESG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +   G+ +LD  + ERA  GIFLAFQYPVEIPG+  M+F+K ++N  R+A  E  L   
Sbjct: 59  SVEMDGKDLLDMEVEERAQAGIFLAFQYPVEIPGVSNMEFMKESVNAMREAHGESALSSA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +K ++   ++ + +D LKR +N GFSGGEKK  EI+QM +LEP + ILDE+DSGLD+
Sbjct: 119 EFLKKAKEACKQVELPLDFLKRGVNEGFSGGEKKRNEIMQMIMLEPKIAILDESDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVN+ R   RSF+++THYQRLL+YI+PD +H+L  GKI+K+G   +A ++E 
Sbjct: 179 DALQVVAKGVNSQRDGKRSFIVVTHYQRLLDYIEPDYVHILSKGKIVKSGGPELAKEVEA 238

Query: 241 NGYAEL 246
           +GYA L
Sbjct: 239 SGYAWL 244


>gi|293396326|ref|ZP_06640604.1| FeS assembly ATPase SufC [Serratia odorifera DSM 4582]
 gi|291421115|gb|EFE94366.1| FeS assembly ATPase SufC [Serratia odorifera DSM 4582]
          Length = 248

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 180/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L  K+    +EI++GL+L ++P EV AIMGPNGSGKSTLS  L+G ++YE+TAG
Sbjct: 1   MLSIKEL--KVSAEGSEILKGLSLDIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++KG+ +L     +RA +G+FLAFQYPVEIPG+    FL+ ++N  RK R  + L   
Sbjct: 59  EVMFKGKDLLALDPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTSVNAVRKYRGLEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFADFIEEKIALLNMPADLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   R+F+I+THYQR+L+YIKPD +HVL  G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVANGVNSLRDGKRAFIIVTHYQRILDYIKPDYVHVLSQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 QGYGWL 244


>gi|110834727|ref|YP_693586.1| ATP-binding protein of ABC-transporter [Alcanivorax borkumensis
           SK2]
 gi|110647838|emb|CAL17314.1| ATP-binding protein of ABC-transporter [Alcanivorax borkumensis
           SK2]
          Length = 251

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI++L A + D    I++GLNL V+P EV AIMGPNGSGKSTL+ +L+G  +Y IT G
Sbjct: 1   MLEIRDLHATVADKP--ILKGLNLTVKPGEVHAIMGPNGSGKSTLANVLAGRDNYAITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           + L++G+S+ D    ERA  G+FLAFQYPVEIPG+  M+FLK AL   R A+ ++E    
Sbjct: 59  EALFEGKSLADLEPEERAQAGLFLAFQYPVEIPGVSNMEFLKAALESVRGAQGKEEWDSV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
              R+ R    ++ ++   LKR +N GFSGGEKK  EI+QM L+EP L +LDETDSGLDI
Sbjct: 119 TLLRQARAACKQVNLDASFLKRGVNEGFSGGEKKRNEIMQMLLMEPKLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A+GVN+LRS +R  +++THYQRLL+YI PD +HVL NG+IIK+G   +AL+LEE
Sbjct: 179 DALQTVAKGVNSLRSPERGIVLVTHYQRLLDYIVPDFVHVLSNGQIIKSGGKELALELEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 KGYGWLTGE 247


>gi|241760974|ref|ZP_04759063.1| FeS assembly ATPase SufC [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753060|ref|YP_003225953.1| FeS assembly ATPase SufC [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|241374593|gb|EER64054.1| FeS assembly ATPase SufC [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552423|gb|ACV75369.1| FeS assembly ATPase SufC [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 250

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 181/248 (72%), Gaps = 3/248 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NLRA++   + +I++GLNL++   E+ AIMGPNG+GKSTLSY+LSG   Y +T G
Sbjct: 4   MLEIRNLRAEV--DNKQILKGLNLEIGAGEIHAIMGPNGAGKSTLSYVLSGKPGYTVTDG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G+ +L     ERA+ G+FL FQYPVEI G+  + FL+ A N QRK R E+EL   
Sbjct: 62  SARFMGKDLLAMEPHERAAAGLFLGFQYPVEIAGVSNLHFLRAAANAQRKTRGEEELSAG 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +   K    LGIN +MLKRP+N+GFSGGEKK  E++QM +L+P L ILDETDSGLDI
Sbjct: 122 EFIKIASKEAKALGINPEMLKRPVNVGFSGGEKKRNEMMQMAVLQPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVN-ALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL+I ++ +N  +R  DRS L+ITHYQRLL+++KPD +HVL  G+I+++G   +AL+LE
Sbjct: 182 DALRIVSESINRVMRQPDRSVLLITHYQRLLDHVKPDFVHVLVKGQIVRSGGAELALELE 241

Query: 240 ENGYAELI 247
             GY EL+
Sbjct: 242 REGYGELV 249


>gi|300958563|ref|ZP_07170693.1| FeS assembly ATPase SufC [Escherichia coli MS 175-1]
 gi|300314772|gb|EFJ64556.1| FeS assembly ATPase SufC [Escherichia coli MS 175-1]
          Length = 248

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+ D+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSDDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|193065284|ref|ZP_03046356.1| FeS assembly ATPase SufC [Escherichia coli E22]
 gi|260843988|ref|YP_003221766.1| component of SufBCD complex [Escherichia coli O103:H2 str. 12009]
 gi|192927078|gb|EDV81700.1| FeS assembly ATPase SufC [Escherichia coli E22]
 gi|257759135|dbj|BAI30632.1| component of SufBCD complex [Escherichia coli O103:H2 str. 12009]
 gi|323163468|gb|EFZ49294.1| feS assembly ATPase SufC [Escherichia coli E128010]
          Length = 248

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +      I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EGKAILRGLSLAVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|215486857|ref|YP_002329288.1| cysteine desulfurase ATPase component [Escherichia coli O127:H6
           str. E2348/69]
 gi|312966835|ref|ZP_07781053.1| feS assembly ATPase SufC [Escherichia coli 2362-75]
 gi|215264929|emb|CAS09315.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Escherichia coli O127:H6 str. E2348/69]
 gi|312288299|gb|EFR16201.1| feS assembly ATPase SufC [Escherichia coli 2362-75]
          Length = 248

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T+G
Sbjct: 1   MLSIKELHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+ D+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSSDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|166711247|ref|ZP_02242454.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 254

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I   D  I++GL+L ++  +V AIMGPNG+GKSTL  +L+G   YE++AG
Sbjct: 1   MLTINNLHASIAGKD--ILKGLSLDIQAGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+++LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  TVQFEGKNLLDLPPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
            GY
Sbjct: 239 QGY 241


>gi|307294774|ref|ZP_07574616.1| FeS assembly ATPase SufC [Sphingobium chlorophenolicum L-1]
 gi|306879248|gb|EFN10466.1| FeS assembly ATPase SufC [Sphingobium chlorophenolicum L-1]
          Length = 248

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 181/248 (72%), Gaps = 3/248 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL  +I      I++GL+L +   E+ AIMGPNG+GKSTL+Y L G   Y++T G
Sbjct: 1   MLTIDNLTNEI--DGKAILKGLSLSINAGEIHAIMGPNGAGKSTLAYTLGGRPGYQVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D  + G ++      ERA+ G+FL FQYPVEIPG+  +QFL+ +LN QRKAR E+ L   
Sbjct: 59  DASFNGVNLFSLDPHERAAAGLFLGFQYPVEIPGVSNLQFLRESLNSQRKARGEEPLSGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++  A LG++M+MLKRP+N+GFSGGEKK AE++QM +L+P L ILDETDSGLDI
Sbjct: 119 EFIKLAKEKAALLGLDMEMLKRPVNVGFSGGEKKRAEMVQMGILDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DALKI   G+NA +R  D++ L+ITHYQRLL+Y+KPD +HVL  G+I+K+G   +AL+LE
Sbjct: 179 DALKIVGAGINAIMRKPDKAVLLITHYQRLLDYVKPDYVHVLAGGRIVKSGGPELALELE 238

Query: 240 ENGYAELI 247
             GYAE++
Sbjct: 239 REGYAEVV 246


>gi|333003807|gb|EGK23343.1| feS assembly ATPase SufC [Shigella flexneri VA-6]
          Length = 248

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++     
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETHDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|206577153|ref|YP_002238018.1| FeS assembly ATPase SufC [Klebsiella pneumoniae 342]
 gi|288935006|ref|YP_003439065.1| FeS assembly ATPase SufC [Klebsiella variicola At-22]
 gi|290509067|ref|ZP_06548438.1| FeS assembly ATPase SufC [Klebsiella sp. 1_1_55]
 gi|206566211|gb|ACI07987.1| FeS assembly ATPase SufC [Klebsiella pneumoniae 342]
 gi|288889715|gb|ADC58033.1| FeS assembly ATPase SufC [Klebsiella variicola At-22]
 gi|289778461|gb|EFD86458.1| FeS assembly ATPase SufC [Klebsiella sp. 1_1_55]
          Length = 248

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I++L   +   D  I+RGLNL+V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIQDLHVAV--EDKAILRGLNLEVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ +  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  RVEFKGKDLLELAPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRNYRGQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIRLLQMPADLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVN+LR   R+F+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVSEGVNSLRDGKRAFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|146298942|ref|YP_001193533.1| FeS assembly ATPase SufC [Flavobacterium johnsoniae UW101]
 gi|146153360|gb|ABQ04214.1| FeS assembly ATPase SufC [Flavobacterium johnsoniae UW101]
          Length = 248

 Score =  271 bits (694), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 133/243 (54%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A I   D EI++G+N++V+  EV AIMGPNGSGKSTLS +++G+++YE+T G
Sbjct: 1   MLSIKNLHAAI--GDKEILKGINIEVKAGEVHAIMGPNGSGKSTLSAVIAGNENYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++  GE + D +  ERA KG+FL+FQYPVEIPG+ +  F+K A+NE RKA  ++E+   
Sbjct: 59  EVILDGEDLADLAPEERAHKGVFLSFQYPVEIPGVSVTNFMKTAINETRKANGQEEMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKVIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S   + ++ITHYQRLL+YI PD +HVL+NG+I+K+G   +A +LEE
Sbjct: 179 DALRIVANGVNKLKSDKNAIIVITHYQRLLDYIVPDFVHVLYNGRIVKSGGKELAYELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|71897638|ref|ZP_00679883.1| FeS assembly ATPase SufC [Xylella fastidiosa Ann-1]
 gi|71732541|gb|EAO34594.1| FeS assembly ATPase SufC [Xylella fastidiosa Ann-1]
          Length = 280

 Score =  271 bits (694), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I  L A +     EI++GL+L + P +V AIMGPNG+GKSTL ++L+G   Y++TAG
Sbjct: 3   MLKIDTLHASVAGK--EILKGLSLDIAPGQVHAIMGPNGAGKSTLGHILAGRDGYDVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +    +L     ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 61  QVTFDNRPLLTLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEEELDSI 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 121 QFLKRVREKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I++TG   +AL+LE+
Sbjct: 181 DALKTVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVETGGPELALELEQ 240

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 241 HGYTWL 246


>gi|15838076|ref|NP_298764.1| ABC transporter ATP-binding protein [Xylella fastidiosa 9a5c]
 gi|9106499|gb|AAF84284.1|AE003977_7 ABC transporter ATP-binding protein [Xylella fastidiosa 9a5c]
          Length = 278

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I  L A +     EI++GL+L + P +V AIMGPNG+GKSTL ++L+G   Y+ITAG
Sbjct: 1   MLKIDTLHASVAGK--EILKGLSLDIAPGQVHAIMGPNGAGKSTLGHILAGRDGYDITAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +    +L     ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 59  QVTFDNRPLLTLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEEELDSI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKRVREKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I++TG   +AL+LE+
Sbjct: 179 DALKTVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVETGGPELALELEQ 238

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 239 HGYTWL 244


>gi|94496621|ref|ZP_01303197.1| FeS assembly ATPase SufC [Sphingomonas sp. SKA58]
 gi|94423981|gb|EAT09006.1| FeS assembly ATPase SufC [Sphingomonas sp. SKA58]
          Length = 248

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 181/248 (72%), Gaps = 3/248 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL  +I      I++GL+L ++  E+ AIMGPNG+GKSTL+Y L G   YE+T G
Sbjct: 1   MLTIDNLTNEI--DGKPILKGLSLAIKAGEIHAIMGPNGAGKSTLAYTLGGRPGYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D  + G ++      ERA+ G+FL FQYPVEIPG+  +QFL+ +LN Q++AR E EL   
Sbjct: 59  DASFDGVNLFSLDPHERAAAGLFLGFQYPVEIPGVSNLQFLRESLNSQKRARGEAELNGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R  ++  A LG++MDMLKR +N+GFSGGEKK AE++QM +L+P L ILDETDSGLDI
Sbjct: 119 EFIRLAKEKAALLGLDMDMLKRSVNVGFSGGEKKRAEMVQMGILDPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DALKI   G+NA +R  D++ L+ITHYQRLL+Y+KPD +HVL  G+I+K+G   +AL+LE
Sbjct: 179 DALKIVGAGINAIMRKPDKAVLLITHYQRLLDYVKPDFVHVLAGGRIVKSGGPELALELE 238

Query: 240 ENGYAELI 247
             GYAE++
Sbjct: 239 REGYAEVV 246


>gi|78048636|ref|YP_364811.1| ABC transporter ATPase involved in Fe-S cluster assembly
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|78037066|emb|CAJ24811.1| ABC transporter ATPase involved in Fe-S cluster assembly
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
          Length = 254

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 177/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL A I   D  I++GL+L ++P +V AIMGPNG+GKSTL  +L+G   YE+ AG
Sbjct: 1   MLNIQNLHASIAGKD--ILKGLSLDIQPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVGAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  SVQFDGKDLLDLPPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEDELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALR  +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRLPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|170730002|ref|YP_001775435.1| ABC transporter ATP-binding protein [Xylella fastidiosa M12]
 gi|167964795|gb|ACA11805.1| ABC transporter ATP-binding protein [Xylella fastidiosa M12]
          Length = 280

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I  L A +     EI++GL+L + P +V AIMGPNG+GKSTL ++L+G   Y++TAG
Sbjct: 3   MLKIDTLHASVAGK--EILKGLSLDIAPGQVHAIMGPNGAGKSTLGHILAGRDGYDVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +    +L     ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 61  QVTFDNRPLLTLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEEELDSI 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 121 QFLKRVREKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I++TG   +AL+LE+
Sbjct: 181 DALKTVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVETGGPELALELEQ 240

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 241 HGYTWL 246


>gi|85710907|ref|ZP_01041968.1| Cysteine desulfurase activator ATPase [Idiomarina baltica OS145]
 gi|85695311|gb|EAQ33248.1| Cysteine desulfurase activator ATPase [Idiomarina baltica OS145]
          Length = 253

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 183/246 (74%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L A++   +  II+GLNL+++P EV AIMGPNG+GKSTL Y+LSG   YE+  G
Sbjct: 1   MLTIKDLHARV--EEKTIIKGLNLEIKPGEVHAIMGPNGAGKSTLGYVLSGRDGYEVEQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G ++LD  + ERA  G+FLAFQYPVEIPG+  M+F+K ++N  RKAR E EL   
Sbjct: 59  EVNFNGANLLDMEVEERAQAGLFLAFQYPVEIPGVSNMEFMKESVNAMRKARGEDELSSA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++   ++ + +D LKR +N GFSGGEKK  EI+Q+ +L+P L ILDE+DSGLD+
Sbjct: 119 EFLKMAKEACKQVNLPLDFLKRGVNEGFSGGEKKRNEIMQLIMLKPKLAILDESDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+ R  +RSF+++THYQRLL++I+PD +H+L  GKI+K+G   +A ++E 
Sbjct: 179 DALQVVANGVNSQRDGERSFIVVTHYQRLLDFIEPDYVHILAQGKIVKSGGPELAKEVEA 238

Query: 241 NGYAEL 246
           +GYA L
Sbjct: 239 SGYAWL 244


>gi|307131459|ref|YP_003883475.1| SufC protein [Dickeya dadantii 3937]
 gi|11342547|emb|CAC17126.1| SufC protein [Erwinia chrysanthemi]
 gi|306528988|gb|ADM98918.1| SufC protein [Dickeya dadantii 3937]
          Length = 248

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 176/249 (70%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL   +   D  II GLNL+V P EV AIMGPNGSGKSTLS  L+G +DYE+  G
Sbjct: 1   MLTIENLNVSV--EDKPIINGLNLQVNPGEVHAIMGPNGSGKSTLSATLAGREDYEVIGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L+ S  ERA +GIF+AFQYPVEIPG+    FL+ ALN  R  R +  L   
Sbjct: 59  SLRFKGKDLLELSPEERAGEGIFMAFQYPVEIPGVSNRFFLQTALNAVRAYRQQPTLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 DFEDFIDDKIRLLNMPDDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNALR   R+F+I+THYQR+L+YI+PD +HVL+ G+I+K+GD+S+   LEE
Sbjct: 179 DALKIVSGGVNALRDGKRAFIIVTHYQRILDYIRPDYVHVLYQGRIVKSGDFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|84622944|ref|YP_450316.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188577997|ref|YP_001914926.1| FeS assembly ATPase SufC [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84366884|dbj|BAE68042.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188522449|gb|ACD60394.1| FeS assembly ATPase SufC [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 254

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I   D  I++GL+L ++  +V AIMGPNG+GKSTL  +L+G   YE++AG
Sbjct: 1   MLTINNLHASIAGKD--ILKGLSLDIQAGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+++LD +  ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E +L   
Sbjct: 59  TVQFEGKNLLDLTPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEDKLDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|168789816|ref|ZP_02814823.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC869]
 gi|261227873|ref|ZP_05942154.1| transport protein associated with Fe-S cluster assembly
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258393|ref|ZP_05950926.1| transport protein associated with Fe-S cluster assembly
           [Escherichia coli O157:H7 str. FRIK966]
 gi|189370599|gb|EDU89015.1| FeS assembly ATPase SufC [Escherichia coli O157:H7 str. EC869]
          Length = 248

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G + YE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGREYYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|325286419|ref|YP_004262209.1| FeS assembly ATPase SufC [Cellulophaga lytica DSM 7489]
 gi|324321873|gb|ADY29338.1| FeS assembly ATPase SufC [Cellulophaga lytica DSM 7489]
          Length = 250

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IK+L A +     EI++G+NL+V   EV AIMGPNGSGKSTL+ +++G++ YE+TAG
Sbjct: 1   MLKIKDLHANV--DGKEILKGINLEVGSGEVHAIMGPNGSGKSTLASVIAGNETYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI    E+I D S  ERA  G+FL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  DIFLNEENIEDLSPEERAHNGVFLSFQYPVEIPGVSVTNFMKTAINESRKAKGLEDMPAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  + +R  +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DMLKLIRDKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL YI PD +HVL+NGKI+K+G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLKSKDNAIVVITHYQRLLEYIVPDYVHVLYNGKIVKSGTKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|87198223|ref|YP_495480.1| FeS assembly ATPase SufC [Novosphingobium aromaticivorans DSM
           12444]
 gi|87133904|gb|ABD24646.1| FeS assembly ATPase SufC [Novosphingobium aromaticivorans DSM
           12444]
          Length = 247

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 178/244 (72%), Gaps = 3/244 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL+A +   D  I++GL+L +   E+ AIMGPNG+GKSTL Y L G   YE+T G
Sbjct: 1   MLTIENLQANV--ADKPILKGLSLTINAGEIHAIMGPNGAGKSTLGYTLGGRPGYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
                G  +L     ERA+ G+FL FQYPVEIPG+  +QFL+ A N QRKAR E  L   
Sbjct: 59  SATLDGADMLGMEPHERAAAGLFLGFQYPVEIPGVSFVQFLREAANAQRKARGEAPLSGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++  A L ++MDMLKRP+N+GFSGGEKK AE++QM +L+P + ILDETDSGLDI
Sbjct: 119 EFLKLAKEKAALLRMDMDMLKRPVNVGFSGGEKKRAEMVQMGILDPRIAILDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL+I  +G+NA +R  D++ L+ITHYQRLL+Y+KPD +HVL +G+I+K+G   +AL+LE
Sbjct: 179 DALRICGEGINAIMRKPDKAVLLITHYQRLLDYVKPDFVHVLASGRIVKSGGPELALELE 238

Query: 240 ENGY 243
           E+GY
Sbjct: 239 EHGY 242


>gi|86132482|ref|ZP_01051076.1| FeS assembly ATPase SufC [Dokdonia donghaensis MED134]
 gi|85817043|gb|EAQ38227.1| FeS assembly ATPase SufC [Dokdonia donghaensis MED134]
          Length = 250

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +KNL A I + D  I++G+NL+++  EV AIMGPNGSGKSTL+ +++G ++YE++ G
Sbjct: 1   MLSVKNLHAGIEEKD--ILKGINLEMKAGEVHAIMGPNGSGKSTLASVIAGKEEYEVSNG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI   GES+L+    ERA +G+FL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  DIDLNGESLLEMDPEERAHEGVFLSFQYPVEIPGVSVTNFIKTAINETRKAKGLEDMPAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+++    L ++   L R LN+GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKKIKEKAELLEMDRKFLSRSLNVGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + L+ITHYQRLL+YI PD +HVL NGKI+++G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLKSEDNAVLVITHYQRLLDYIVPDFVHVLMNGKIVRSGGKELALELEE 238

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 239 KGYDWLKEE 247


>gi|325919610|ref|ZP_08181622.1| Iron-regulated ABC transporter ATPase subunit SufC [Xanthomonas
           gardneri ATCC 19865]
 gi|325549946|gb|EGD20788.1| Iron-regulated ABC transporter ATPase subunit SufC [Xanthomonas
           gardneri ATCC 19865]
          Length = 254

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 179/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A I     EI++GL+L ++P +V AIMGPNG+GKSTL  +L+G   YE++AG
Sbjct: 1   MLKINNLHASI--AGKEILKGLSLDIKPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+ +LD    ERA+ G+FLAFQYPVEI G+    FL+ ALN QRKAR E+EL   
Sbjct: 59  SVQFEGKDLLDLPPEERAAAGLFLAFQYPVEIAGVNNTYFLRAALNAQRKARGEEELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YI PD +HVL  G+I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYITPDVVHVLAEGRIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|332090822|gb|EGI95914.1| feS assembly ATPase SufC [Shigella boydii 5216-82]
          Length = 248

 Score =  270 bits (691), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +   D  I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EDKAILRGLSLDVRPREVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+L    RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLCDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|298207476|ref|YP_003715655.1| ABC transporter, ATP-binding protein [Croceibacter atlanticus
           HTCC2559]
 gi|83850112|gb|EAP87980.1| ABC transporter, ATP-binding protein [Croceibacter atlanticus
           HTCC2559]
          Length = 250

 Score =  270 bits (691), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +     EI++G+NL ++  E+ AIMGPNGSGKSTL+ ++SG ++YE+T G
Sbjct: 1   MLKIKNLHASV--DGKEILKGINLDIKAGEIHAIMGPNGSGKSTLASVISGKEEYEMTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+   E I +    ERA KG+FL+FQYPVEIPG+ +  F+K A+NE RKAR  +++   
Sbjct: 59  EIILHDEEISEMEADERAHKGVFLSFQYPVEIPGVSVTNFMKTAINESRKARGLEDMPAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DMLKLIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LRS+D + ++ITHYQRLL+YI PD +HVL NGKI+K+G   +A +LEE
Sbjct: 179 DALKIVANGVNKLRSKDNAVIVITHYQRLLDYIVPDYVHVLLNGKIVKSGTKELAYELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|285017821|ref|YP_003375532.1| ABC transporter ATP-binding protein [Xanthomonas albilineans GPE
           PC73]
 gi|283473039|emb|CBA15544.1| probable abc transporter atp-binding protein [Xanthomonas
           albilineans]
          Length = 255

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A+I   D  I++GL+L V+P +V AIMGPNG+GKSTL  +L+G   YE++ G
Sbjct: 1   MLKIDNLHARIGGND--ILKGLSLDVQPGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G  +L      RA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E EL   
Sbjct: 59  SVRFDGADLLALEPEARAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEAELDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +R+F++ITHYQRLL+YIKPD +HVL +G+I++TG   +AL+LE 
Sbjct: 179 DALKTVAAGVNALRSPERAFVVITHYQRLLDYIKPDVVHVLADGRIVQTGGPELALELEA 238

Query: 241 NGYAEL 246
           +GYA L
Sbjct: 239 HGYAWL 244


>gi|182681283|ref|YP_001829443.1| FeS assembly ATPase SufC [Xylella fastidiosa M23]
 gi|182631393|gb|ACB92169.1| FeS assembly ATPase SufC [Xylella fastidiosa M23]
          Length = 280

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I  L A +     EI++GL+L + P +V AIMGPNG+GKSTL ++L+G   Y++TAG
Sbjct: 3   MLKIDTLHASVAGK--EILKGLSLDIAPGQVHAIMGPNGAGKSTLGHILAGRDGYDVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +    +L     ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 61  QVTFDNRPLLTLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEEELDSI 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 121 QFLKRVREKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +R+FL+ITHYQRLL+YIKPD +HVL  G+I++TG   +AL+LE+
Sbjct: 181 DALKTVADGVNALRSPERAFLVITHYQRLLDYIKPDVVHVLAEGRIVETGGPELALELEQ 240

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 241 HGYTWL 246


>gi|37520940|ref|NP_924317.1| ABC transporter ATP-binding protein [Gloeobacter violaceus PCC
           7421]
 gi|35211935|dbj|BAC89312.1| glr1371 [Gloeobacter violaceus PCC 7421]
          Length = 252

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI NL+A++      I++G++L V P EV AIMGPNGSGKSTL+ +L+G ++YE+T G
Sbjct: 1   MLEITNLQARV--EGKAILKGIDLTVRPGEVHAIMGPNGSGKSTLAGVLAGREEYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y  + +L+ +  ERA  G+ LAFQYPVEIPG+  + FLK ALN  RK R E EL   
Sbjct: 59  AVRYLDQDLLELAPEERARAGLLLAFQYPVEIPGVSNVYFLKAALNALRKHRGEGELDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR     + +    L+R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 119 EFLALVRGKLKTVQMAESFLRRSVNEGFSGGEKKRNEILQMALLEPCLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN LRS +RSFL+ITHYQRLL+YI PD +HVL NG+I+++G   +AL+LEE
Sbjct: 179 DALKIVADGVNGLRSPERSFLVITHYQRLLDYIVPDFVHVLMNGRIVRSGGRELALELEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 KGYGWLEAE 247


>gi|325916457|ref|ZP_08178729.1| Iron-regulated ABC transporter ATPase subunit SufC [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325537377|gb|EGD09101.1| Iron-regulated ABC transporter ATPase subunit SufC [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 268

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 177/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I   D  I++GL+L ++P +V A+MGPNG+GKSTL  +L+G   Y ++ G
Sbjct: 15  MLTITNLHASIAGKD--ILKGLSLDIQPGQVHALMGPNGAGKSTLGNVLAGRDGYAVSEG 72

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +LD    ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 73  SVQFDGKDLLDLPPEERAAAGLFLAFQYPVEIPGVNNTYFLRAALNAQRKARGEEELDSM 132

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 133 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 192

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G+I+++G   +AL+LE+
Sbjct: 193 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLSEGRIVQSGGPELALELEK 252

Query: 241 NGY 243
           +GY
Sbjct: 253 HGY 255


>gi|28198600|ref|NP_778914.1| ABC transporter ATP-binding protein [Xylella fastidiosa Temecula1]
 gi|28056684|gb|AAO28563.1| ABC transporter ATP-binding protein [Xylella fastidiosa Temecula1]
 gi|307579734|gb|ADN63703.1| FeS assembly ATPase SufC [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 278

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I  L A +     EI++GL+L + P +V AIMGPNG+GKSTL ++L+G   Y++TAG
Sbjct: 1   MLKIDTLHASVAGK--EILKGLSLDIAPGQVHAIMGPNGAGKSTLGHILAGRDGYDVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +    +L     ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E+EL   
Sbjct: 59  QVTFDNRPLLTLQPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEEELDSI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKRVREKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +R+FL+ITHYQRLL+YIKPD +HVL  G+I++TG   +AL+LE+
Sbjct: 179 DALKTVADGVNALRSPERAFLVITHYQRLLDYIKPDVVHVLAEGRIVETGGPELALELEQ 238

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 239 HGYTWL 244


>gi|194429485|ref|ZP_03062007.1| FeS assembly ATPase SufC [Escherichia coli B171]
 gi|194412449|gb|EDX28749.1| FeS assembly ATPase SufC [Escherichia coli B171]
          Length = 248

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +      I+RGL+L V P EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLSIKDLHVSV--EGKAILRGLSLAVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +L  S  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  TVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +  A L +  D+L R +++GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVSVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|126662698|ref|ZP_01733697.1| iron-regulated ABC transporter, ATP-binding protein [Flavobacteria
           bacterium BAL38]
 gi|126626077|gb|EAZ96766.1| iron-regulated ABC transporter, ATP-binding protein [Flavobacteria
           bacterium BAL38]
          Length = 249

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 183/243 (75%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +   D EI++G+NL+++  EV AIMGPNG+GKSTLS +++G+++YE++ G
Sbjct: 1   MLQIKNLHASV--EDKEILKGINLEIKAGEVHAIMGPNGAGKSTLSSIIAGNENYEVSQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I   GE I +++  ERA KG+FL+FQYPVEIPG+ +  F+K A+NE RKA  ++E+   
Sbjct: 59  EIFLDGEEISEFAPEERAHKGVFLSFQYPVEIPGVSVTNFIKTAINESRKANGKEEMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+    L ++   L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 EMLKLIREKAELLEMDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKIAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++++ + L+ITHYQRLL+YI PD +HVL +GKI+K+G  ++AL+LEE
Sbjct: 179 DALRIVANGVNKLKNENNAVLVITHYQRLLDYIVPDFVHVLMDGKIVKSGTAALALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|52840839|ref|YP_094638.1| ATP transporter, ABC binding component, ATP-binding protein
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54296622|ref|YP_122991.1| hypothetical protein lpp0653 [Legionella pneumophila str. Paris]
 gi|52627950|gb|AAU26691.1| ATP transporter, ABC binding component, ATP-binding protein
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|53750407|emb|CAH11801.1| hypothetical protein lpp0653 [Legionella pneumophila str. Paris]
          Length = 250

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L   +      I++G+NL+V+P EV AIMGPNGSGKSTLS +L+GH  YE+T G
Sbjct: 1   MLNIKELNVAV--NGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSKVLAGHPSYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI Y G+ +L  S  ERA  GIF++FQYPVEIPG+  + FLK ++N  RK + +  L   
Sbjct: 59  DISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVNAVRKGQGKNTLDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    L ++   L R +N GFSGGEKK  EILQM  LEP L ILDETDSGLDI
Sbjct: 119 EFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I +QGVNA+RS +RS +++THYQRLL+YI+PD IHVL NG+II +GD S+AL+LE+
Sbjct: 179 DALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLANGRIITSGDKSLALELEK 238

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 239 KGYSWL 244


>gi|103486164|ref|YP_615725.1| FeS assembly ATPase SufC [Sphingopyxis alaskensis RB2256]
 gi|98976241|gb|ABF52392.1| FeS assembly ATPase SufC [Sphingopyxis alaskensis RB2256]
          Length = 247

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 183/247 (74%), Gaps = 3/247 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A +   D  I++GL+L +   E+ AIMGPNG+GKSTLSY+L G   YE+T G
Sbjct: 1   MLKIENLHATV--ADKPILKGLSLAINAGEIHAIMGPNGAGKSTLSYVLGGRPGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+ +LD    ERA+ G+FL FQYPVEIPG+  +QFL+ +LN QRKAR  + L   
Sbjct: 59  SVTFEGQDLLDMEPHERAAAGLFLGFQYPVEIPGVSNVQFLRESLNAQRKARGLEPLSGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R+  A L ++MDMLKRP+N+GFSGGEKK  E++QM +L+P L ILDETDSGLDI
Sbjct: 119 EFLKLAREKAALLKMDMDMLKRPVNVGFSGGEKKRNEMVQMGILDPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL+    G+N  +R  D++ L+ITHYQRLL+Y++PD +HVL +G+I+K+G   +A +LE
Sbjct: 179 DALRTVGDGINTIMRRPDKAVLLITHYQRLLDYVQPDFVHVLADGRIVKSGGPELARELE 238

Query: 240 ENGYAEL 246
            +GYAE+
Sbjct: 239 AHGYAEI 245


>gi|120437457|ref|YP_863143.1| FeS assembly ATPase SufC [Gramella forsetii KT0803]
 gi|117579607|emb|CAL68076.1| FeS assembly ATPase SufC [Gramella forsetii KT0803]
          Length = 250

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 181/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A I   D EI++G++L++ P EV AIMGPNGSGKSTLS +++G ++YE+T G
Sbjct: 1   MLKIKNLHASI--EDKEILKGIDLEINPGEVHAIMGPNGSGKSTLSSVIAGREEYEMTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G  + +    ERA KGIFL+FQYPVEIPG+ +  F+K A+N QRKA+ ++++   
Sbjct: 59  EMIFEGADLQELDPEERAHKGIFLSFQYPVEIPGVSVTNFIKTAINAQRKAQGKEDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 119 EMLKMIREKSEMLEIDRKFLSRSLNQGFSGGEKKRNEIFQMAVLNPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN LRS+D + L+ITHYQRLL+YI PD +HV+ +GKI+K+G   +A +LEE
Sbjct: 179 DALKVVANGVNKLRSEDNAVLLITHYQRLLDYIVPDVVHVMVDGKIVKSGGKELAHELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|294013382|ref|YP_003546842.1| Fe-S cluster assembly ATP-binding protein SufC [Sphingobium
           japonicum UT26S]
 gi|292676712|dbj|BAI98230.1| Fe-S cluster assembly ATP-binding protein SufC [Sphingobium
           japonicum UT26S]
          Length = 248

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 181/248 (72%), Gaps = 3/248 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL  +I      I++GL+L ++  E+ AIMGPNG+GKSTL+Y L G   Y++T G
Sbjct: 1   MLTIDNLTNEI--DGKAILKGLSLSIKAGEIHAIMGPNGAGKSTLAYTLGGRPGYQVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G ++      ERA+ G+FL FQYPVEIPG+  +QFL+ +LN QRKAR E+ L   
Sbjct: 59  TASFNGVNLFSLDPHERAAAGLFLGFQYPVEIPGVSNLQFLRESLNSQRKARGEEPLSGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++  A LG++M+MLKRP+N+GFSGGEKK AE++QM +L+P L ILDETDSGLDI
Sbjct: 119 EFIKLAKEKAALLGLDMEMLKRPVNVGFSGGEKKRAEMVQMGILDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DALKI   G+NA +R  D++ L+ITHYQRLL+Y+KPD +HVL  G+I+K+G   +AL+LE
Sbjct: 179 DALKIVGAGINAIMRRPDKAVLLITHYQRLLDYVKPDYVHVLAGGRIVKSGGPELALELE 238

Query: 240 ENGYAELI 247
             GYAE++
Sbjct: 239 REGYAEVV 246


>gi|89889829|ref|ZP_01201340.1| FeS assembly ATPase SufC [Flavobacteria bacterium BBFL7]
 gi|89518102|gb|EAS20758.1| FeS assembly ATPase SufC [Flavobacteria bacterium BBFL7]
          Length = 250

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 184/249 (73%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IK+L A I   D EI++G+NL+V+  EV AIMGPNGSGKSTL+ +++G ++YE+T G
Sbjct: 1   MLKIKDLHASI--EDKEILKGINLEVKAGEVHAIMGPNGSGKSTLANVIAGREEYEMTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I  + E I +    ERA KG+FL+FQYP+EIPG+ +  F+K A+NE RKA+ ++E+   
Sbjct: 59  SIELEKEEISELDPEERAHKGVFLSFQYPIEIPGVSVTNFMKTAINETRKAQGKEEMKAG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP + ILDETDSGLDI
Sbjct: 119 DMLKMIREKSEMLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKVSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS+D + ++ITHYQRLL+YI PD +HVL+ G+I+K+G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLRSKDNATIVITHYQRLLDYIVPDYVHVLYKGRIVKSGGKELALELEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|148360748|ref|YP_001251955.1| ATP transporter ATP- binding protein [Legionella pneumophila str.
           Corby]
 gi|296106187|ref|YP_003617887.1| Fe-S cluster assembly ATP-binding protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|148282521|gb|ABQ56609.1| ATP transporter, ABC binding component, ATP- binding protein
           [Legionella pneumophila str. Corby]
 gi|295648088|gb|ADG23935.1| Fe-S cluster assembly ATP-binding protein [Legionella pneumophila
           2300/99 Alcoy]
          Length = 250

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 177/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L   +      I++G+NL+V+P EV AIMGPNGSGKSTLS +L+GH  YE+T G
Sbjct: 1   MLNIKELNVAV--NGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSKVLAGHPSYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI Y G+ +L  S  ERA  GIF++FQYPVEIPG+  + FLK ++N  RK +    L   
Sbjct: 59  DISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVNAVRKGQGRNTLDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    L ++   L R +N GFSGGEKK  EILQM  LEP L ILDETDSGLDI
Sbjct: 119 EFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALEPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I +QGVNA+RS +RS +++THYQRLL+YI+PD IHVL NG+II +GD S+AL+LE+
Sbjct: 179 DALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLANGRIITSGDKSLALELEK 238

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 239 KGYSWL 244


>gi|212712081|ref|ZP_03320209.1| hypothetical protein PROVALCAL_03160 [Providencia alcalifaciens DSM
           30120]
 gi|212685603|gb|EEB45131.1| hypothetical protein PROVALCAL_03160 [Providencia alcalifaciens DSM
           30120]
          Length = 248

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L   +     EI++GL+L+++  EV AIMGPNGSGKSTLS  L+G +DY++ +G
Sbjct: 1   MLSIKDLHVSV--EGNEILKGLSLEIKSGEVHAIMGPNGSGKSTLSATLAGREDYQVDSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+ +L     ERA +GIFLAFQYPVEIPG+    FL+ ++N  R+ R ++ L   
Sbjct: 59  EVTFNGKDLLALDPEERAGEGIFLAFQYPVEIPGVSNQFFLQTSVNAVREYRQQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFQDFIEDKIELLDMPQDLLTRSVNVGFSGGEKKRNDILQMAALEPKLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR+ +RSF+I+THYQR+L+Y+KPD +HVL+ GKIIK+GD+S+A  LEE
Sbjct: 179 DALKIVSNGVNSLRTPERSFIIVTHYQRILDYVKPDFVHVLYQGKIIKSGDFSLAKKLEE 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 QGYGWLIDQ 247


>gi|94501136|ref|ZP_01307659.1| Cysteine desulfurase activator ATPase [Oceanobacter sp. RED65]
 gi|94426712|gb|EAT11697.1| Cysteine desulfurase activator ATPase [Oceanobacter sp. RED65]
          Length = 249

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 179/244 (73%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK+L AK+ + D  I++GLNL+V+P EV AIMGPNG+GKSTL  +LSG ++YE T+G
Sbjct: 1   MLNIKDLHAKVEEKD--ILKGLNLEVKPGEVHAIMGPNGAGKSTLGNVLSGRENYEATSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +LD    ERA +G+FLAFQYPVEIPG+  ++FLK +++  R  R  +     
Sbjct: 59  TVDFDGKDLLDMDTEERAREGLFLAFQYPVEIPGVSNLEFLKASVDAVRAHRGLEPYDSV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R+    + +N + LKR +N GFSGGEKK  EI+QM LLEP LCILDETDSGLDI
Sbjct: 119 TFLKLAREKCKAVDLNQNFLKRGVNEGFSGGEKKRNEIMQMMLLEPKLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+ R  +RSF+++THYQRLL+YI PD +HVL +GKI+K+G   +AL+LEE
Sbjct: 179 DALQVVANGVNSQRDPNRSFIVVTHYQRLLDYIVPDYVHVLADGKIVKSGGKELALELEE 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 KGYG 242


>gi|254427283|ref|ZP_05040990.1| FeS assembly ATPase SufC [Alcanivorax sp. DG881]
 gi|196193452|gb|EDX88411.1| FeS assembly ATPase SufC [Alcanivorax sp. DG881]
          Length = 251

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI++L A + D    I++GLNL V+P EV AIMGPNGSGKSTL+ +L+G  +Y IT G
Sbjct: 1   MLEIRDLHATVADKP--ILKGLNLTVKPGEVHAIMGPNGSGKSTLANVLAGRDNYAITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           + L++G S+ D    ERA  G+FLAFQYPVEIPG+  M+FLK AL   R A+ ++E    
Sbjct: 59  EALFEGNSLADLEPEERAQAGLFLAFQYPVEIPGVSNMEFLKAALESVRGAQGKEEWDSV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
              R+ R    ++ ++   LKR +N GFSGGEKK  EI+QM L+EP L +LDETDSGLDI
Sbjct: 119 TLLRQARAACKQVNLDASFLKRGVNEGFSGGEKKRNEIMQMLLMEPKLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A+GVN+LRS +R  +++THYQRLL+YI PD +HVL NG+IIK+G   +A +LEE
Sbjct: 179 DALQTVAKGVNSLRSPERGIVLVTHYQRLLDYIVPDFVHVLSNGQIIKSGGKELAHELEE 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 KGYGWLTGE 247


>gi|162148829|ref|YP_001603290.1| FeS assembly protein SufC [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787406|emb|CAP57001.1| FeS assembly protein SufC [Gluconacetobacter diazotrophicus PAl 5]
          Length = 238

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 172/235 (73%)

Query: 15  DTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSI 74
           + EI+RG++L +   EV AIMGPNGSGKSTLSY+L+G +DYE+TAG   +KG+ +L    
Sbjct: 2   EKEILRGVDLDIPAGEVHAIMGPNGSGKSTLSYVLAGREDYEVTAGTATFKGQDLLALDP 61

Query: 75  VERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELG 134
             RA+ G+FLAFQ PVE+PG+    FL+ A+N  R+AR + EL    F + VRK T  L 
Sbjct: 62  EARAALGLFLAFQAPVELPGVNNANFLRTAVNAVRRARGQDELDAVAFLKAVRKETKHLS 121

Query: 135 INMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALR 194
           ++ DMLKR +N+GFSGGEKK  E+LQMR+L+PS  ILDETDSGLDIDAL+I A+GVN+LR
Sbjct: 122 MSDDMLKRNVNVGFSGGEKKRNEVLQMRMLQPSFAILDETDSGLDIDALRIVAEGVNSLR 181

Query: 195 SQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELIKE 249
           + D S L+ITH+QRLL+YI PD IHV+  G+II +G   +A  LE  GYA  + E
Sbjct: 182 APDFSALVITHHQRLLDYIVPDRIHVMARGRIIHSGGPELAKQLEAQGYARFLAE 236


>gi|312881814|ref|ZP_07741588.1| cysteine desulfurase ATPase component [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370565|gb|EFP98043.1| cysteine desulfurase ATPase component [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 248

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 181/248 (72%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+A+I   DT I+ G++L+++P EV AIMGPNGSGKSTL+  L+G +DYEIT G
Sbjct: 1   MLTIKNLKAQI--DDTPILNGIDLEIKPGEVHAIMGPNGSGKSTLASTLAGREDYEITEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++  G+ +L     ERA +G+FLAFQYPVEIPG+    FL+ ++N  R  R   EL   
Sbjct: 59  EVMLNGKDLLALDPDERAGEGVFLAFQYPVEIPGVSNHLFLQASVNAVRSYRGLPELERF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +    + +    L +  D+L R +N+GFSGGEKK  +ILQM +L+P LCILDETDSGLDI
Sbjct: 119 ELADLIEEKIELLNMPEDLLSRSVNVGFSGGEKKRNDILQMAVLDPKLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  + GVN+LR   RSF+I+THYQR+L+YIKPD +HVL+ GKIIK+GD+S+  +LEE
Sbjct: 179 DALKEVSNGVNSLRDGTRSFIIVTHYQRILDYIKPDFVHVLYQGKIIKSGDFSMVAELEE 238

Query: 241 NGYAELIK 248
           NGY  L +
Sbjct: 239 NGYGWLTE 246


>gi|58581027|ref|YP_200043.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425621|gb|AAW74658.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 254

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 179/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I   D  I++GL+L ++  +V AIMGPNG+GKSTL  +L+G   YE++AG
Sbjct: 1   MLTINNLHASIAGKD--ILKGLSLDIQAGQVHAIMGPNGAGKSTLGNVLAGRDGYEVSAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+++LD +  ERA+ G+FLAFQYPVEIPG+    FL+ ALN QRKAR E +L   
Sbjct: 59  TVQFEGKNLLDLTPEERAAAGLFLAFQYPVEIPGVNNTYFLRSALNAQRKARGEDKLDSM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + VR+  A L +  ++L R +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 QFLKLVRQKLAVLHLKDELLHRGVNEGFSGGEKKRNEIFQLAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVNALRS +RSFL+ITHYQRLL+YIKPD +HVL  G I+++G   +AL+LE+
Sbjct: 179 DALKSVADGVNALRSPERSFLVITHYQRLLDYIKPDVVHVLAEGCIVQSGGPELALELEK 238

Query: 241 NGY 243
           +GY
Sbjct: 239 HGY 241


>gi|305665683|ref|YP_003861970.1| ABC transporter ATP-binding protein [Maribacter sp. HTCC2170]
 gi|88710441|gb|EAR02673.1| ABC transporter, ATP-binding protein [Maribacter sp. HTCC2170]
          Length = 250

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A I D D  I++G+NL+V   EV AIMGPNGSGKSTL+ +++G ++YE+T G
Sbjct: 1   MLKISNLHAGIEDND--ILKGINLEVNAGEVHAIMGPNGSGKSTLAAVIAGKEEYEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++  GE + D +  ERA KGIFL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  NVVLDGEDLEDDAPEERAHKGIFLSFQYPVEIPGVSVTNFMKTAINESRKAKGLEDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
              + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 QMLKLIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL+YI PD +HVLH GKI+K+G   +A +LEE
Sbjct: 179 DALRIVANGVNKLKSKDNAVIVITHYQRLLDYIVPDFVHVLHEGKIVKSGTKELAHELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|254447136|ref|ZP_05060603.1| FeS assembly ATPase SufC [gamma proteobacterium HTCC5015]
 gi|198263275|gb|EDY87553.1| FeS assembly ATPase SufC [gamma proteobacterium HTCC5015]
          Length = 253

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 181/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     +I++G++L+++  EV AIMGPNGSGKSTLS +L+G++ +EIT G
Sbjct: 1   MLSIKNLHASV--EGKQILKGIDLEIKAGEVHAIMGPNGSGKSTLSQVLAGNEAFEITEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I ++G+ + +  I ERA +GIFLAFQYPVEIPG+  +QFLK A+N  R  R   E+  P
Sbjct: 59  SIDFEGQDLSELEIEERAREGIFLAFQYPVEIPGVSNIQFLKTAVNAMRTQRGLDEISAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R+   ++ ++   LKR +N GFSGGEKK  EI+Q  LLEP L ILDETDSGLDI
Sbjct: 119 EFMKLAREKAEQVDLDASFLKRGVNEGFSGGEKKRNEIMQALLLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNALR+ DR+ +++THYQRLL++I PD +HVL  G+IIK+G   +AL+LEE
Sbjct: 179 DALKIVSDGVNALRASDRAIVMVTHYQRLLDHIVPDFVHVLAGGRIIKSGGRELALELEE 238

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 239 HGYGWL 244


>gi|163786783|ref|ZP_02181231.1| hypothetical protein FBALC1_16397 [Flavobacteriales bacterium
           ALC-1]
 gi|159878643|gb|EDP72699.1| hypothetical protein FBALC1_16397 [Flavobacteriales bacterium
           ALC-1]
          Length = 250

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 182/249 (73%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A +   D  I+RG+NL+V+  EV AIMGPNGSGKSTL+ +++G ++YE+T G
Sbjct: 1   MLKINNLHASV--EDKGILRGINLEVKAGEVHAIMGPNGSGKSTLASVIAGKEEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL   E I + +  ERA KG+FL+FQYPVEIPG+ +  F+K A+NE RKA+  +++   
Sbjct: 59  NILLDNEDIEELAAEERAHKGVFLSFQYPVEIPGVSVTNFMKTAINETRKAKGLEDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKLIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL+YI PD +HVLHNGKI+K+G   +A +LE 
Sbjct: 179 DALRIVANGVNKLKSKDNAVIVITHYQRLLDYIVPDFVHVLHNGKIVKSGGKELAHELEA 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|268317573|ref|YP_003291292.1| FeS assembly ATPase SufC [Rhodothermus marinus DSM 4252]
 gi|262335107|gb|ACY48904.1| FeS assembly ATPase SufC [Rhodothermus marinus DSM 4252]
          Length = 254

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 187/249 (75%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI+NL A++   + EI++G+NL V   EV AIMGPNGSGKSTL+ +L+G +DYE+T G
Sbjct: 3   LLEIRNLHARV--EEKEILKGVNLTVNAGEVHAIMGPNGSGKSTLASVLAGREDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++LY G+++L+    ERA +G+FLAFQYPVE+PG+ M  FL+ AL   R+ R    L   
Sbjct: 61  EVLYDGKNLLEMEPDERAREGVFLAFQYPVELPGVNMATFLREALKAVREHRGLPPLSPA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++    +G++  + +R +N GFSGGEKK +EI Q+ LLEP L ILDETDSGLDI
Sbjct: 121 EFMQLLKEKAELVGLDPSLKQRSVNEGFSGGEKKRSEIFQLALLEPRLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVN LR+ DR+F+IITHYQRLLNYI PD +HV+ +G+I+++GD ++AL+LEE
Sbjct: 181 DALRAVADGVNKLRAPDRAFVIITHYQRLLNYIVPDYVHVMVDGRIVRSGDKNLALELEE 240

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 241 KGY-DWIKE 248


>gi|54293585|ref|YP_126000.1| hypothetical protein lpl0637 [Legionella pneumophila str. Lens]
 gi|53753417|emb|CAH14870.1| hypothetical protein lpl0637 [Legionella pneumophila str. Lens]
          Length = 250

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 176/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L   +      I++G+NL+V+P EV AIMGPNGSGKSTLS +L+GH  YEIT G
Sbjct: 1   MLNIKELNVAV--NGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSKVLAGHPSYEITRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI Y G+ +L  S  ERA  GIF++FQYPVEIPG+  + FLK ++N  RK +    L   
Sbjct: 59  DISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVNAVRKGQGRNTLDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    L ++   L R +N GFSGGEKK  EILQM  LEP L ILDETDSGLDI
Sbjct: 119 EFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALEPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I +QGVNA+RS  RS +++THYQRLL+YI+PD IHVL NG+II +GD S+AL+LE+
Sbjct: 179 DALRIISQGVNAMRSPGRSIILVTHYQRLLDYIEPDFIHVLANGRIITSGDKSLALELEK 238

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 239 KGYSWL 244


>gi|126661119|ref|ZP_01732199.1| ABC transporter subunit [Cyanothece sp. CCY0110]
 gi|126617595|gb|EAZ88384.1| ABC transporter subunit [Cyanothece sp. CCY0110]
          Length = 266

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 179/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A +    T I++G+NL+++  EV AIMG NGSGKSTLS +L+GH DYEIT G
Sbjct: 15  ILSVKNLTANV--EGTPILKGVNLEIKAGEVHAIMGRNGSGKSTLSKVLAGHPDYEITGG 72

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ YKGE+ILD S  ERA +GIFLAFQYP+EIPG+  + FL++A N +RK    +E+   
Sbjct: 73  EVFYKGENILDKSPDERALEGIFLAFQYPLEIPGVSNLDFLRVAYNTRRKHLGLEEIDTF 132

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 133 DFEDLVEEKLEVVKMNAAFLDRSLNEGFSGGEKKRNEILQMALLEPTLGILDEIDSGLDI 192

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L + D +FL+ITHYQRLLNYI+P  +HV+++G+I+ +G   +AL+LEE
Sbjct: 193 DALKIVANGVNQLSTPDNAFLLITHYQRLLNYIEPHHVHVMYDGQIVTSGGKELALELEE 252

Query: 241 NGY 243
           +GY
Sbjct: 253 SGY 255


>gi|332284499|ref|YP_004416410.1| branched-chain amino acid ABC transporter ATP-binding protein
           [Pusillimonas sp. T7-7]
 gi|330428452|gb|AEC19786.1| branched-chain amino acid ABC transporter ATP-binding protein
           [Pusillimonas sp. T7-7]
          Length = 256

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 176/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +   +  I+RGLNL+V   EV AIMGPNGSGKSTLS +L+G +DY+I +G
Sbjct: 1   MLSIKNLHASV--EEKSILRGLNLEVNAGEVHAIMGPNGSGKSTLSQVLAGREDYKIESG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+ +L  SI +RA  G+FLAFQYP+EIPG+    FLK A+N  R+ +   EL   
Sbjct: 59  EVDWMGQDLLSMSIEDRARSGLFLAFQYPIEIPGVSNAYFLKAAVNATRRHQGLPELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF ++V+     +G+  + L R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 119 DFLKRVKAEMKAVGMREEFLYRSVNEGFSGGEKKRNEILQMTLLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVN LRS +R+ ++ITHYQRLL+YI PD +HVL  G+I+++G   +AL+LEE
Sbjct: 179 DALKVVADGVNRLRSPERALVVITHYQRLLDYIVPDFVHVLAGGRIVRSGGRELALELEE 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 RGYG 242


>gi|53804902|ref|YP_113469.1| FeS assembly ATPase SufC [Methylococcus capsulatus str. Bath]
 gi|53758663|gb|AAU92954.1| FeS assembly ATPase SufC [Methylococcus capsulatus str. Bath]
          Length = 254

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 180/244 (73%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L I+NL A++      I++G++L V+P EV AIMGPNGSGKSTLS +L+G   YE+T G
Sbjct: 4   LLRIENLHARV--DGKAILKGIDLTVKPGEVHAIMGPNGSGKSTLSNVLAGRSGYEVTEG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G ++L+    +RA +G+FLAFQYPVEIPG+  +  LK A N  R+ R   E+   
Sbjct: 62  TVTYRGRNLLELPPEQRAREGVFLAFQYPVEIPGVSNIYLLKAAYNAIRRHRGLNEVDAL 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + V++ T  + ++   L R +N GFSGGEKK  EILQM +LEP+LCILDETDSGLDI
Sbjct: 122 DFLKLVKEKTRMVDLDEQFLYRGVNEGFSGGEKKRNEILQMAILEPTLCILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A GVNALRS +R+F+++THYQRLL+YIKPD +HVL +G+I+++GD S+A +LE 
Sbjct: 182 DALKVVANGVNALRSPERAFILVTHYQRLLDYIKPDHVHVLAHGRIVRSGDASLAHELER 241

Query: 241 NGYA 244
            GY 
Sbjct: 242 KGYG 245


>gi|110637387|ref|YP_677594.1| iron-regulated ABC transporter ATP-binding protein [Cytophaga
           hutchinsonii ATCC 33406]
 gi|110280068|gb|ABG58254.1| Iron-regulated ABC transporter ATPase subunit SufC [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 253

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 181/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A+I   + EI+RG+NL+V+  EV AIMGPNGSGKSTL+ +L+G  DYE+T+G
Sbjct: 1   MLSIKNLHARI--EEKEILRGINLEVKAGEVHAIMGPNGSGKSTLASVLAGRSDYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +   G+ +LD S  +RA +G+FLAFQYP+EIPG+  + F+K A+NE R+ R ++ +   
Sbjct: 59  SVTLNGKDLLDLSPEDRAREGVFLAFQYPIEIPGVSTINFMKTAVNEIREYRGQETMDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + +++    + I+  +LKR LN GFSGGEKK  EI QM +LEPSL ILDETDSGLDI
Sbjct: 119 SFLKLMKEKMKLVEIDESLLKRALNEGFSGGEKKRNEIFQMAMLEPSLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++ + + +++THYQRLL+YI PD +HVL+ G+I+K+G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLKTPNNATIVVTHYQRLLDYIVPDFVHVLYKGRIVKSGTKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|311279428|ref|YP_003941659.1| FeS assembly ATPase SufC [Enterobacter cloacae SCF1]
 gi|308748623|gb|ADO48375.1| FeS assembly ATPase SufC [Enterobacter cloacae SCF1]
          Length = 248

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L+  +   D  I+RGL+L+V P EV AIMGPNGSGKSTLS  L+G +DY +T G
Sbjct: 1   MLSIKELQVAV--EDNAILRGLSLEVRPGEVHAIMGPNGSGKSTLSATLAGREDYTVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ + + +  +RA +GIF+AFQYPVEIPG+    FL+ ALN  R  R ++ L   
Sbjct: 59  SVTFKGKDLFELAPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRGYRGQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDE+DSGLDI
Sbjct: 119 DFQDLMEEKIKLLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   R+F+I+THYQR+L+YI+PD +HVL+ G+I+K+GD+++   LEE
Sbjct: 179 DALKIVADGVNSLRDGRRAFIIVTHYQRILDYIRPDYVHVLYQGRIVKSGDFTLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L ++
Sbjct: 239 QGYGWLTEQ 247


>gi|53711558|ref|YP_097550.1| ABC transporter ATP-binding protein [Bacteroides fragilis YCH46]
 gi|60679817|ref|YP_209961.1| putative ABC transporter, ATP-binding protein [Bacteroides fragilis
           NCTC 9343]
 gi|253564381|ref|ZP_04841838.1| ABC transporter ATP-binding protein [Bacteroides sp. 3_2_5]
 gi|265764950|ref|ZP_06093225.1| FeS assembly ATPase SufC [Bacteroides sp. 2_1_16]
 gi|52214423|dbj|BAD47016.1| ABC transporter ATP-binding protein [Bacteroides fragilis YCH46]
 gi|60491251|emb|CAH05999.1| putative ABC transporter, ATP-binding protein [Bacteroides fragilis
           NCTC 9343]
 gi|251948157|gb|EES88439.1| ABC transporter ATP-binding protein [Bacteroides sp. 3_2_5]
 gi|263254334|gb|EEZ25768.1| FeS assembly ATPase SufC [Bacteroides sp. 2_1_16]
 gi|301161340|emb|CBW20880.1| putative ABC transporter ATP-binding protein sufC [Bacteroides
           fragilis 638R]
          Length = 250

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V+P EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVKPGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+++L+ S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SITFYGKNLLELSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ D S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPDTSCIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|172035602|ref|YP_001802103.1| iron-sulfur assembly ATPase [Cyanothece sp. ATCC 51142]
 gi|171697056|gb|ACB50037.1| iron-sulfur assembly ATPase [Cyanothece sp. ATCC 51142]
          Length = 266

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A +    T I++G+NL+++  EV AIMG NGSGKSTLS +L+GH DYE+T G
Sbjct: 15  ILSVKNLTANV--EGTPILKGVNLEIKAGEVHAIMGRNGSGKSTLSKVLAGHPDYEVTGG 72

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++YKGE+ILD S  ERA +GIFLAFQYP+EIPG+  + FL++A N +RK    +E+   
Sbjct: 73  EVVYKGENILDKSPDERALEGIFLAFQYPLEIPGVSNLDFLRVAYNTRRKHLGLEEIDTF 132

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 133 DFEDLVEEKLEVVKMNAAFLDRSLNEGFSGGEKKRNEILQMALLEPTLGILDEIDSGLDI 192

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L + D +FL+ITHYQRLLNYI+P  +HV+++G+++ +G   +AL+LEE
Sbjct: 193 DALKIVANGVNQLSTPDNAFLLITHYQRLLNYIEPHHVHVMYDGQLVTSGGKELALELEE 252

Query: 241 NGY 243
           +GY
Sbjct: 253 SGY 255


>gi|154491951|ref|ZP_02031577.1| hypothetical protein PARMER_01581 [Parabacteroides merdae ATCC
           43184]
 gi|154088192|gb|EDN87237.1| hypothetical protein PARMER_01581 [Parabacteroides merdae ATCC
           43184]
          Length = 251

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A I     EI++G+NL V+  EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKNLHANI--NGKEILKGINLSVKAGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++ G+S+LD    +R+ +GIFL+FQYPVEIPG+ M+ F++ ALNE RK +  + +   
Sbjct: 59  EVIFNGKSLLDLEPEDRSREGIFLSFQYPVEIPGVSMVNFMRAALNEHRKYKGLEPVSAT 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DFLKLMREKRAIVELDNKLASRSVNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LR+ + + ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVANGVNQLRTPENAAIVITHYQRLLDYIKPDVVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|251789307|ref|YP_003004028.1| cysteine desulfurase ATPase component [Dickeya zeae Ech1591]
 gi|247537928|gb|ACT06549.1| FeS assembly ATPase SufC [Dickeya zeae Ech1591]
          Length = 248

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL   +   D  II GLNL+V P EV AIMGPNGSGKSTLS  L+G +DY +T G
Sbjct: 1   MLTIENLNVSV--EDKPIINGLNLQVNPGEVHAIMGPNGSGKSTLSATLAGREDYTVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG  +L  S  ERA +GIF+AFQYPVEIPG+    FL+ +LN  R  R +  L   
Sbjct: 59  TLRFKGNDLLALSPEERAGEGIFMAFQYPVEIPGVSNRFFLQTSLNAVRAYRQQPALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +     +L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 DFEDFIEDKIRQLNMPDDLLTRSVNVGFSGGEKKRNDILQMAVLEPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVNALR   R+F+I+THYQR+L+YI+PD +HVL+ G+I+++G +S+   LEE
Sbjct: 179 DALKIVSGGVNALRDGKRAFIIVTHYQRILDYIRPDYVHVLYQGRIVRSGGFSLVKQLEE 238

Query: 241 NGYAELIKE 249
            GY  L  +
Sbjct: 239 QGYGWLTDQ 247


>gi|149278438|ref|ZP_01884575.1| iron-regulated ABC transporter, ATP-binding protein [Pedobacter sp.
           BAL39]
 gi|149230808|gb|EDM36190.1| iron-regulated ABC transporter, ATP-binding protein [Pedobacter sp.
           BAL39]
          Length = 253

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKN+ A I     +I++G+NL+++  EV AIMGPNGSGKSTLS +L+G ++YE+T G
Sbjct: 1   MLSIKNIHANI--DGKQILKGINLEIKAGEVHAIMGPNGSGKSTLSSVLAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+ +L     +RA +G+FLAFQYPVEIPG+    F+K A+NE+RK   +  L   
Sbjct: 59  EVKFLGKDLLSLPAEDRAREGLFLAFQYPVEIPGVSTTNFIKAAVNEKRKYLGQDPLDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + +++  A + IN  +L R +N GFSGGEKK  E+ QM +LEP L ILDETDSGLDI
Sbjct: 119 SFLKMMKEKMAMVEINQSLLSRSINEGFSGGEKKRNEVFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+N LRS DR+ L+ITHYQRLL+YI+PD +HVL+ GKI+K+G   +AL+LEE
Sbjct: 179 DALRIVANGINKLRSSDRAILLITHYQRLLDYIQPDFVHVLYKGKIVKSGTKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|255010114|ref|ZP_05282240.1| putative ABC transporter, ATP-binding protein [Bacteroides fragilis
           3_1_12]
 gi|313147912|ref|ZP_07810105.1| ABC transporter ATP-binding protein [Bacteroides fragilis 3_1_12]
 gi|313136679|gb|EFR54039.1| ABC transporter ATP-binding protein [Bacteroides fragilis 3_1_12]
          Length = 250

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V P EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVNPGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+++L+ S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SITFYGKNLLELSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ D S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPDTSCIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|197285273|ref|YP_002151145.1| cysteine desulfurase ATPase [Proteus mirabilis HI4320]
 gi|227355703|ref|ZP_03840096.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Proteus mirabilis ATCC 29906]
 gi|194682760|emb|CAR42982.1| probable ATP-binding component of cysteine desulfurase (putative
           ATP-dependent transporter) [Proteus mirabilis HI4320]
 gi|227164022|gb|EEI48919.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Proteus mirabilis ATCC 29906]
          Length = 248

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 177/247 (71%), Gaps = 2/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL   +     EI++GL+L+V   EV AIMGPNGSGKSTLS  L+G ++YE+  G
Sbjct: 1   MLDIKNLHVSV--EGNEILKGLDLQVRAGEVHAIMGPNGSGKSTLSATLAGREEYEVDEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +K + +L+    ERA +GIF+AFQYPVEIPG+    FL+ ++N  R+ R ++ L   
Sbjct: 59  SVTFKNKDLLELEPEERAGEGIFMAFQYPVEIPGVSNQFFLQSSVNAVREYRGQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFEDFIEDKIKLLDMPQDLLTRSVNVGFSGGEKKRNDILQMAALEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN+LR   R+F+++THYQR+L+YIKPD +HVL+ GKIIK+GD+S+A  LEE
Sbjct: 179 DALKIVANGVNSLRDGKRAFIVVTHYQRILDYIKPDYVHVLYQGKIIKSGDFSLAQKLEE 238

Query: 241 NGYAELI 247
            GY  LI
Sbjct: 239 QGYGWLI 245


>gi|333029424|ref|ZP_08457485.1| FeS assembly ATPase SufC [Bacteroides coprosuis DSM 18011]
 gi|332740021|gb|EGJ70503.1| FeS assembly ATPase SufC [Bacteroides coprosuis DSM 18011]
          Length = 250

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 185/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IK+L A I     EI++G+NL+V+P EV AIMGPNGSGKSTLS +L G+ ++E+T G
Sbjct: 1   MLKIKDLHASI--NGKEILKGINLEVKPGEVHAIMGPNGSGKSTLSSVLVGNPNFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++LD +  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK RN   L   
Sbjct: 59  SVEFMGKNLLDLAPEDRSHEGIFLSFQYPVEIPGVSMVNFMRSAVNEQRKYRNLPPLTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAIVELDNKLTNRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVADGVNKLKTPENSCILITHYQRLLDYIKPDIVHVLYKGQIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 RGYDWIKKE 247


>gi|307609398|emb|CBW98887.1| hypothetical protein LPW_06741 [Legionella pneumophila 130b]
          Length = 250

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 176/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L   +      I++G+NL+V+P EV AIMGPNGSGKSTLS +L+GH  YEIT G
Sbjct: 1   MLNIKELNVAV--NGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSKVLAGHPSYEITRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI Y G+ +L  S  ERA  GIF++FQYPVEIPG+  + FLK ++N  RK +    L   
Sbjct: 59  DISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVNAVRKGQGRNTLDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    L ++   L R +N GFSGGEKK  EILQM  LEP L ILDETDSGLDI
Sbjct: 119 EFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALEPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I +QGVNA+RS +RS +++THYQRLL+YI+P  IHVL NG+II +GD S+AL+LE+
Sbjct: 179 DALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPXFIHVLANGRIITSGDKSLALELEK 238

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 239 KGYSWL 244


>gi|150010117|ref|YP_001304860.1| ABC transporter ATP-binding protein [Parabacteroides distasonis
           ATCC 8503]
 gi|255012623|ref|ZP_05284749.1| ABC transporter, ATP-binding protein [Bacteroides sp. 2_1_7]
 gi|256838940|ref|ZP_05544450.1| FeS assembly ATPase SufC [Parabacteroides sp. D13]
 gi|262382596|ref|ZP_06075733.1| FeS assembly ATPase SufC [Bacteroides sp. 2_1_33B]
 gi|298374487|ref|ZP_06984445.1| FeS assembly ATPase SufC [Bacteroides sp. 3_1_19]
 gi|301308167|ref|ZP_07214121.1| FeS assembly ATPase SufC [Bacteroides sp. 20_3]
 gi|149938541|gb|ABR45238.1| ABC transporter, ATP-binding protein [Parabacteroides distasonis
           ATCC 8503]
 gi|256739859|gb|EEU53183.1| FeS assembly ATPase SufC [Parabacteroides sp. D13]
 gi|262295474|gb|EEY83405.1| FeS assembly ATPase SufC [Bacteroides sp. 2_1_33B]
 gi|298268855|gb|EFI10510.1| FeS assembly ATPase SufC [Bacteroides sp. 3_1_19]
 gi|300833637|gb|EFK64253.1| FeS assembly ATPase SufC [Bacteroides sp. 20_3]
          Length = 251

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL A +     EI++G+NL V+  EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEVKNLHANV--NGKEILKGINLSVKAGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++ G+++LD S  +R+ +GIFL+FQYPVEIPG+ M+ F++ ALNE RK    + +   
Sbjct: 59  EVIFNGKNLLDLSPEDRSREGIFLSFQYPVEIPGVSMVNFMRAALNEHRKYNGLEPVSAT 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DFLKLMREKRAIVELDNKLASRSVNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LR+ + + ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAHGVNQLRTPENAAIVITHYQRLLDYIKPDVVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|124005858|ref|ZP_01690696.1| FeS assembly ATPase SufC [Microscilla marina ATCC 23134]
 gi|123988541|gb|EAY28182.1| FeS assembly ATPase SufC [Microscilla marina ATCC 23134]
          Length = 252

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 184/249 (73%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I +L A I     +I++G+NL+V+  E+ AIMGPNGSGKSTL+ +L+G +DYE+  G
Sbjct: 1   MLKINDLHASI--EGKKILKGINLEVKAGEIHAIMGPNGSGKSTLASVLAGREDYEVEQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ +L+ +  ERA +G+FLAFQYPVEIPG+  + FLK A NE RK R E+ L   
Sbjct: 59  SIEFTGKDLLELAPEERAGEGVFLAFQYPVEIPGVTTINFLKTATNEIRKYRGEEPLDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +++++ T+ + I+ D+LKR LN GFSGGEKK  E+ QM +LEP L ILDETDSGLDI
Sbjct: 119 QFLKRMKEKTSLVNISQDLLKRSLNEGFSGGEKKRNEVFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L+S + + +++THYQRLL YI PD +HVL +G+I+K+G   +AL+LE 
Sbjct: 179 DALRIVAEGVNQLKSNENATIVVTHYQRLLEYIVPDFVHVLFDGRIVKSGTKDLALELEA 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|304414758|ref|ZP_07395740.1| cysteine desulfurase ATPase component [Candidatus Regiella
           insecticola LSR1]
 gi|304283156|gb|EFL91568.1| cysteine desulfurase ATPase component [Candidatus Regiella
           insecticola LSR1]
          Length = 254

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 178/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IK L+  +   +  I++GLNL+V P EV AIMGPNGSGKSTLS +L+G ++Y+IT G
Sbjct: 9   MLRIKQLKVNVEGKN--ILKGLNLEVNPGEVHAIMGPNGSGKSTLSAVLAGREEYQITEG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I +  E +L     +RA +GIFLAFQYPVEIPG+    FL+ A+N  RK R +      
Sbjct: 67  EIRFNDEDLLALEPEQRAGEGIFLAFQYPVEIPGVSNRFFLQTAVNAVRKYRGKSAFDRF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   + +  A L +  D+L R +N+GFSGGEKK  EILQM  LEP L ILDETDSGLDI
Sbjct: 127 QFADFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNEILQMAALEPKLGILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVN+LR  +R+F+++THYQR+LNY++PD +HVLH+G+II++GD+++A  LEE
Sbjct: 187 DALKVVAEGVNSLRDSERAFIVVTHYQRILNYLQPDKVHVLHDGRIIESGDFTLAKKLEE 246

Query: 241 NGYAEL 246
            GY  L
Sbjct: 247 QGYGWL 252


>gi|323495957|ref|ZP_08101023.1| cysteine desulfurase ATPase component [Vibrio sinaloensis DSM
           21326]
 gi|323318992|gb|EGA71937.1| cysteine desulfurase ATPase component [Vibrio sinaloensis DSM
           21326]
          Length = 248

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 178/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L   +   D  I++G++L V+P EV AIMGPNGSGKSTLS  L+G  DYE+ AG
Sbjct: 1   MLEIKDLHVSV--EDNPILKGISLTVKPGEVHAIMGPNGSGKSTLSATLAGKDDYEVDAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+KG+ + +    ERA +G+FLAFQYPVEIPG+    FL  ALNE R  R ++ L   
Sbjct: 59  EMLFKGKDLTELDPEERAGEGVFLAFQYPVEIPGVSNKLFLNTALNEIRNYRCQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +   +L R +N GFSGGEKK  +ILQM +L P LCILDETDSGLDI
Sbjct: 119 DFEDLLEEKANLLKMPTTLLNRSVNEGFSGGEKKRNDILQMAVLSPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  + GVNAL+   R+F+++THYQR+LNYIKPD +HVL+ GKI+++GD+++A +LEE
Sbjct: 179 DALKAVSSGVNALQDGQRAFILVTHYQRILNYIKPDYVHVLYKGKIVRSGDHTLAHELEE 238

Query: 241 NGYAELIKE 249
            GY  +  E
Sbjct: 239 KGYGWITGE 247


>gi|218441629|ref|YP_002379958.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 7424]
 gi|218174357|gb|ACK73090.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 7424]
          Length = 256

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A +    + I++G+NL+++  EV AIMG NGSGKSTLS +L+GH  YE+T G
Sbjct: 5   ILSVRNLTANV--DGSPILKGVNLEIKAGEVHAIMGRNGSGKSTLSKVLTGHPSYEVTGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++LYKGES+LD    ERA  GIFLAFQYP+EIPG+  + FL++A N ++K    +E+   
Sbjct: 63  EVLYKGESLLDKEPDERALNGIFLAFQYPLEIPGVSNIDFLRVAYNARQKHLGLEEIDTF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L+R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 123 DFEDLVEEKLEVVKMNSSFLERSLNEGFSGGEKKRNEILQMALLEPTLAILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L   D +FL+ITHYQRLLNYI+PD IHV+++G+I+K+G   +AL+LEE
Sbjct: 183 DALKIVANGVNQLAKPDNAFLLITHYQRLLNYIEPDFIHVMYDGRIVKSGTKELALELEE 242

Query: 241 NGY 243
            GY
Sbjct: 243 KGY 245


>gi|256422369|ref|YP_003123022.1| FeS assembly ATPase SufC [Chitinophaga pinensis DSM 2588]
 gi|256037277|gb|ACU60821.1| FeS assembly ATPase SufC [Chitinophaga pinensis DSM 2588]
          Length = 254

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A++     +I++G+NL++   E+ AIMGPNGSGKS+LS +L+G ++Y +T G
Sbjct: 1   MLTIKNLHAEV--DGKKILKGINLEIRKGEMHAIMGPNGSGKSSLSSVLAGRENYTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G+++LD S  +RA +G+FLAFQYPVEIPG+  + FLK ALNE R   N   L   
Sbjct: 59  EVIFEGKNLLDLSPEDRAREGLFLAFQYPVEIPGVSNLHFLKTALNEIRTYHNLPPLESK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++    +  N +++ R LN GFSGGEKK  E+ Q+ +L+P L ILDETDSGLDI
Sbjct: 119 EFLKLTKEKQQLVDFNANLMNRSLNEGFSGGEKKRNEVFQLAMLDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS D++F++ITHYQRLL YI PD +HVL+NG+I+KTG   +AL+LEE
Sbjct: 179 DALRIVAAGVNKLRSADKAFMVITHYQRLLEYIVPDFVHVLYNGQIVKTGTKELALELEE 238

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 239 KGYDWLKEE 247


>gi|226330347|ref|ZP_03805865.1| hypothetical protein PROPEN_04264 [Proteus penneri ATCC 35198]
 gi|225201142|gb|EEG83496.1| hypothetical protein PROPEN_04264 [Proteus penneri ATCC 35198]
          Length = 248

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 177/247 (71%), Gaps = 2/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL   +     EI++GL+L+V   EV AIMGPNGSGKSTLS  L+G ++YE+  G
Sbjct: 1   MLDIKNLHVSV--EGNEILKGLDLQVRAGEVHAIMGPNGSGKSTLSATLAGREEYEVDEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +K + +L+    ERA +GIF+AFQYPVEIPG+    FL+ ++N  R+ R ++ L   
Sbjct: 59  SITFKNKDLLELEPEERAGEGIFMAFQYPVEIPGVSNQFFLQSSVNAVREYRRQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +      L +  D+L R +N+GFSGGEKK  +ILQM  LEP LCILDETDSGLDI
Sbjct: 119 DFEDFIEDKIKLLDMPQDLLTRSVNVGFSGGEKKRNDILQMAALEPELCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN+LR   R+F+++THYQR+L+YIKPD +HVL+ GKIIK+GD+S+A  LEE
Sbjct: 179 DALKIVSNGVNSLRDGKRAFIVVTHYQRILDYIKPDFVHVLYQGKIIKSGDFSLAQKLEE 238

Query: 241 NGYAELI 247
            GY  LI
Sbjct: 239 QGYGWLI 245


>gi|29348816|ref|NP_812319.1| ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253568839|ref|ZP_04846249.1| ABC transporter ATP-binding protein [Bacteroides sp. 1_1_6]
 gi|298387896|ref|ZP_06997445.1| FeS assembly ATPase SufC [Bacteroides sp. 1_1_14]
 gi|29340722|gb|AAO78513.1| ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251840858|gb|EES68939.1| ABC transporter ATP-binding protein [Bacteroides sp. 1_1_6]
 gi|298259303|gb|EFI02178.1| FeS assembly ATPase SufC [Bacteroides sp. 1_1_14]
          Length = 250

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V+P EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVKPGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++L+ S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFYGKNLLELSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSTIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|114776743|ref|ZP_01451786.1| FeS assembly ATPase SufC [Mariprofundus ferrooxydans PV-1]
 gi|114552829|gb|EAU55260.1| FeS assembly ATPase SufC [Mariprofundus ferrooxydans PV-1]
          Length = 250

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/243 (54%), Positives = 176/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M++I+NL   +      I++G+NL++   EV AIMGPNGSGKSTLS +++G   YE+T G
Sbjct: 1   MIKIENLHVSV--AGKTILKGINLEIGEGEVHAIMGPNGSGKSTLSNVIAGRDGYEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I YKG  +L  +  ERA +G+FLAFQYPVEIPG+     LK  +N  R+ R E+EL   
Sbjct: 59  SITYKGRDLLAMAPEERAWEGVFLAFQYPVEIPGVNNTYLLKAGVNAARRHRGEQELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + VR+    + ++   L R +N GFSGGEKK  EI QM +LEPSL +LDETDSGLDI
Sbjct: 119 DFMQLVREKAKLVELDQSFLSRGVNEGFSGGEKKRNEIFQMAVLEPSLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN LR+ +RS ++ITHYQRLL+YI+PD +HVL +GKI+KTGD ++AL+LEE
Sbjct: 179 DALRIVAKGVNTLRAANRSIIMITHYQRLLDYIQPDVVHVLADGKILKTGDKNLALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|115372510|ref|ZP_01459818.1| FeS assembly ATPase SufC [Stigmatella aurantiaca DW4/3-1]
 gi|310819043|ref|YP_003951401.1| FeS assembly ATPase SufC [Stigmatella aurantiaca DW4/3-1]
 gi|115370472|gb|EAU69399.1| FeS assembly ATPase SufC [Stigmatella aurantiaca DW4/3-1]
 gi|309392115|gb|ADO69574.1| FeS assembly ATPase SufC [Stigmatella aurantiaca DW4/3-1]
          Length = 258

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 180/244 (73%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A+I   D EI++G++L++ P EV AIMGPNGSGKSTLS +L+G + Y++T G
Sbjct: 2   LLSVRNLHARI--GDKEILKGIDLELRPGEVHAIMGPNGSGKSTLSQVLAGRETYQVTQG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G+ +L  S   RA+ G+FLAFQYPVEIPG+  + FL+ ALN QR+++  +EL   
Sbjct: 60  EVLFDGKDLLALSPEARATSGVFLAFQYPVEIPGVGNLHFLRTALNAQRRSQGLEELDAM 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF    ++    + ++   L R +N GFSGGEKK  E+ QM +L+P L ILDETDSGLDI
Sbjct: 120 DFLSLAKERMKLVQMDQSFLNRSVNEGFSGGEKKRNEVFQMAVLQPRLAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN+LRS++R  L+ITHYQRLL+YI PD +HV+  G+I+ +GD ++AL+LE 
Sbjct: 180 DALRIVAGGVNSLRSKERGMLVITHYQRLLDYIVPDRVHVMSGGRIVLSGDKALALELES 239

Query: 241 NGYA 244
            GYA
Sbjct: 240 KGYA 243


>gi|311746539|ref|ZP_07720324.1| FeS assembly ATPase SufC [Algoriphagus sp. PR1]
 gi|126575439|gb|EAZ79771.1| FeS assembly ATPase SufC [Algoriphagus sp. PR1]
          Length = 254

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 182/249 (73%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A I    T I+RG+NL+++  EV AIMGPNGSGKSTL+ +L+G ++YE+T G
Sbjct: 1   MLSIKNLHASI--EGTPILRGINLEIKAGEVHAIMGPNGSGKSTLASVLAGREEYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + +KG+ +LD +  +RA +G+FLAFQYPVEIPG+    FL+ A+N+ R+ R +  L   
Sbjct: 59  SVTFKGKDLLDLAPEDRAREGVFLAFQYPVEIPGVSSTNFLRTAVNQVREYRGQAPLDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   +++    + I+  +L R LN GFSGGEKK  EI QM +LEP+L ILDETDSGLDI
Sbjct: 119 KFLTMMKEKVKLVEIDQKLLSRSLNEGFSGGEKKRNEIFQMAMLEPTLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVN L+S+D + +++THYQRLL+YI PD +HVL+ GKI+K+G   +AL+LEE
Sbjct: 179 DALRIVSNGVNQLKSKDNATIVVTHYQRLLDYIVPDYVHVLYKGKIVKSGTKELALELEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|296536720|ref|ZP_06898780.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Roseomonas cervicalis ATCC 49957]
 gi|296262951|gb|EFH09516.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Roseomonas cervicalis ATCC 49957]
          Length = 247

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 175/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+ LRA++     EI++G++L+V   E+ AIMGPNGSGKSTLSY+L+G + YEIT G
Sbjct: 1   MLKIEGLRAEV--EGKEILKGIDLEVPAGEIHAIMGPNGSGKSTLSYVLAGREGYEITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L     ERA+ G+FLAFQYPVE+PG+    FL+ ALN  R+++ E EL   
Sbjct: 59  SVTFHGQDLLAMEPEERAATGLFLAFQYPVELPGVGNANFLRTALNAIRRSKGEAELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R     L +  DMLKR +N+GFSGGEKK  E+LQM LL PS+ ILDETDSGLDI
Sbjct: 119 QFLKVARARMKALSMPEDMLKRGVNVGFSGGEKKRNEVLQMALLNPSMAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNA+R  + S L+ITHYQRLL+YI PD +HVL  G+I++TG   +A  LE 
Sbjct: 179 DALKIVADGVNAMRGPNFSSLVITHYQRLLDYIVPDKVHVLMGGRIVQTGGPELAHQLEA 238

Query: 241 NGYAEL 246
           +GY  +
Sbjct: 239 SGYGSV 244


>gi|237716681|ref|ZP_04547162.1| ABC transporter ATP-binding protein [Bacteroides sp. D1]
 gi|262405457|ref|ZP_06082007.1| FeS assembly ATPase SufC [Bacteroides sp. 2_1_22]
 gi|293370444|ref|ZP_06616997.1| FeS assembly ATPase SufC [Bacteroides ovatus SD CMC 3f]
 gi|294646236|ref|ZP_06723890.1| FeS assembly ATPase SufC [Bacteroides ovatus SD CC 2a]
 gi|294809096|ref|ZP_06767814.1| FeS assembly ATPase SufC [Bacteroides xylanisolvens SD CC 1b]
 gi|298480551|ref|ZP_06998748.1| FeS assembly ATPase SufC [Bacteroides sp. D22]
 gi|229442664|gb|EEO48455.1| ABC transporter ATP-binding protein [Bacteroides sp. D1]
 gi|262356332|gb|EEZ05422.1| FeS assembly ATPase SufC [Bacteroides sp. 2_1_22]
 gi|292634436|gb|EFF52972.1| FeS assembly ATPase SufC [Bacteroides ovatus SD CMC 3f]
 gi|292638454|gb|EFF56818.1| FeS assembly ATPase SufC [Bacteroides ovatus SD CC 2a]
 gi|294443650|gb|EFG12399.1| FeS assembly ATPase SufC [Bacteroides xylanisolvens SD CC 1b]
 gi|295086248|emb|CBK67771.1| FeS assembly ATPase SufC [Bacteroides xylanisolvens XB1A]
 gi|298273372|gb|EFI14936.1| FeS assembly ATPase SufC [Bacteroides sp. D22]
          Length = 250

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V P EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVNPGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++L+ S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFYGKNLLELSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSTIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|198277421|ref|ZP_03209952.1| hypothetical protein BACPLE_03635 [Bacteroides plebeius DSM 17135]
 gi|198269919|gb|EDY94189.1| hypothetical protein BACPLE_03635 [Bacteroides plebeius DSM 17135]
          Length = 250

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A I     EI++G+NL V+  EV AIMGPNGSGKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKNLHANI--NGKEILKGINLTVKAGEVHAIMGPNGSGKSTLSNVLVGHPAYEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L  S  +R+ +G+FL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  TVTFDGKDLLALSPADRSHEGLFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMRQKREIVELDSKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSCIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|226228434|ref|YP_002762540.1| putative iron-sulfur cluster assembly ATPase SufC [Gemmatimonas
           aurantiaca T-27]
 gi|226091625|dbj|BAH40070.1| putative iron-sulfur cluster assembly ATPase SufC [Gemmatimonas
           aurantiaca T-27]
          Length = 249

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 175/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I +L A I      I++G+ L V   EV A+MGPNGSGKSTL+ +L+GH  YEIT G
Sbjct: 1   MLQITDLHAAI--DGKPILKGITLTVNAGEVHAVMGPNGSGKSTLAQVLAGHPAYEITGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++LYKGE++L+     RA  G+FLAFQYPVEIPG+    FL+ A NE RKA   +E+   
Sbjct: 59  EVLYKGENLLEMDPEVRAQSGVFLAFQYPVEIPGVTNAYFLRAAYNEVRKANGHEEVDPM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   V +    + +++ ML R +N GFSGGEKK  EILQM +L+P+L ILDETDSGLDI
Sbjct: 119 EFLDLVEEKLKLVDMDVSMLHRSVNAGFSGGEKKRNEILQMAVLQPTLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVNAL+  D + +++THYQRLLNYI PD +HVL  G+IIK+GD S+AL+LE 
Sbjct: 179 DALRIVAEGVNALKRPDSATIVVTHYQRLLNYIVPDFVHVLAGGRIIKSGDKSLALELES 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|159027407|emb|CAO86891.1| sufC [Microcystis aeruginosa PCC 7806]
          Length = 256

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 176/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A I     +I++G+NL+++  E  AIMG NGSGKST S +++GH DYE+T G
Sbjct: 5   ILSVKNLTASI--DGNQILKGVNLEIKAGETHAIMGRNGSGKSTFSKVIAGHPDYEVTGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+YKGE++LD    ERA  GIFLAFQYP+EIPG+  + FL++A N ++K    +EL   
Sbjct: 63  EIIYKGENLLDKEPDERALMGIFLAFQYPLEIPGVSNLDFLRVAYNARQKHLGSEELDSF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V K    + +N   L R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 123 DFEELVEKKLEVVQMNPSFLGRSLNEGFSGGEKKRNEILQMALLEPTLGILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I AQGVN L + D +FL+ITHYQRLLNYI+PD IHV+++G+I+ +G   +AL+LE 
Sbjct: 183 DALRIVAQGVNQLATPDNAFLLITHYQRLLNYIEPDVIHVMYDGRIVTSGGKELALELER 242

Query: 241 NGY 243
            GY
Sbjct: 243 TGY 245


>gi|121997339|ref|YP_001002126.1| FeS assembly ATPase SufC [Halorhodospira halophila SL1]
 gi|121588744|gb|ABM61324.1| Iron-regulated ABC transporter ATPase subunit SufC [Halorhodospira
           halophila SL1]
          Length = 250

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 129/244 (52%), Positives = 171/244 (70%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A +    TEI++G++ ++ P EV AIMGPNGSGKSTLS +L+G + YE+T G
Sbjct: 1   MLKINNLHASV--EATEILKGIDFEMGPGEVHAIMGPNGSGKSTLSKILAGDESYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ + +    ERA  G+FL FQYPVEIPG+    FLK A+N  R+AR E E+   
Sbjct: 59  SVTFDGQDLFEMEPEERARAGVFLGFQYPVEIPGVSNSYFLKAAVNAAREARGEGEIDPV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +  R+    + ++  +L RP+N GFSGGEKK  EI  M +LEP LCILDETDSGLDI
Sbjct: 119 SFLKMARERAQWVKLDESLLSRPVNAGFSGGEKKRNEIFHMAMLEPRLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVN++R   RSFLIITHYQRLL+YI PD +HV+ NG+I+++G   +A +LE 
Sbjct: 179 DALRAVADGVNSMRDPQRSFLIITHYQRLLSYIVPDHVHVMVNGRIVRSGGKELAEELER 238

Query: 241 NGYA 244
            GYA
Sbjct: 239 TGYA 242


>gi|218264753|ref|ZP_03478465.1| hypothetical protein PRABACTJOHN_04174 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221802|gb|EEC94452.1| hypothetical protein PRABACTJOHN_04174 [Parabacteroides johnsonii
           DSM 18315]
          Length = 251

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A I     EI++G+NL V+  EV AIMGPNGSGKSTLS +L G+  +++T G
Sbjct: 1   MLEIKNLHANI--NGKEILKGINLSVKAGEVHAIMGPNGSGKSTLSSVLVGNPAFDVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++ G+++LD    +R+ +GIFL+FQYPVEIPG+ M+ F++ ALNE RK +  + +   
Sbjct: 59  EVIFNGKNLLDLEPEDRSREGIFLSFQYPVEIPGVSMVNFMRAALNEHRKYKGLEPVSAT 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DFLKLMREKRAIVELDNKLASRSVNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LR+ + + ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVANGVNQLRTPENAAIVITHYQRLLDYIKPDVVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|254506001|ref|ZP_05118146.1| FeS assembly ATPase SufC [Vibrio parahaemolyticus 16]
 gi|219551224|gb|EED28204.1| FeS assembly ATPase SufC [Vibrio parahaemolyticus 16]
          Length = 248

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 176/249 (70%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI +L   +   D  I++G++L V P EV AIMGPNGSGKSTLS  L+G  DY+I AG
Sbjct: 1   MLEINDLHVSV--EDNPILKGISLTVNPGEVHAIMGPNGSGKSTLSATLAGKDDYDIDAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+KG+ + +    ERA +G+FLAFQYPVEIPG+    FL  ALNE R  R ++ L   
Sbjct: 59  EILFKGKDLTELDPEERAGEGVFLAFQYPVEIPGVSNKLFLNTALNEIRNYRGQEPLDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L +   +L R +N GFSGGEKK  +ILQM +L P LCILDETDSGLDI
Sbjct: 119 DFEDLLEEKANLLKMPTTLLNRSVNEGFSGGEKKRNDILQMAVLSPDLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  + GVNAL+   R+F+++THYQR+LNYIKPD +HVL+ GKI+++GD+++A +LEE
Sbjct: 179 DALKAVSSGVNALQDGQRAFILVTHYQRILNYIKPDYVHVLYKGKIVRSGDHTLAHELEE 238

Query: 241 NGYAELIKE 249
            GY  +  E
Sbjct: 239 KGYGWITGE 247


>gi|116626728|ref|YP_828884.1| Iron-regulated ABC transporter ATPase SufC [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229890|gb|ABJ88599.1| Iron-regulated ABC transporter ATPase subunit SufC [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 257

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 174/246 (70%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L AK+   + EI++G+NL V   EV AIMGPNGSGKSTL+ +L+G   Y +T G
Sbjct: 3   LLEIKDLHAKV--GEREILKGINLTVNAGEVHAIMGPNGSGKSTLAQVLAGRDMYAVTGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y G+ +L+ S  +RA +GIFLAFQYPVEIPG+  M FLK ALN  RK R  +EL   
Sbjct: 61  SVTYDGKDLLELSPEDRAREGIFLAFQYPVEIPGVSNMYFLKAALNATRKHRGIEELDAM 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++  +L RP+N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 121 DFLNVVREKMQIMKMDQALLNRPVNTGFSGGEKKRNEIFQMAVLEPRLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVNA+RS DR  +++THYQRLL+ I PD +HVL  G+I+K+G   +AL+LE 
Sbjct: 181 DALRTVAGGVNAMRSPDRGMIVVTHYQRLLSEIVPDFVHVLAEGRIVKSGGKELALELEA 240

Query: 241 NGYAEL 246
            GY  L
Sbjct: 241 EGYEGL 246


>gi|160883925|ref|ZP_02064928.1| hypothetical protein BACOVA_01899 [Bacteroides ovatus ATCC 8483]
 gi|237720413|ref|ZP_04550894.1| ABC transporter ATP-binding protein [Bacteroides sp. 2_2_4]
 gi|260172449|ref|ZP_05758861.1| ABC transporter ATP-binding protein [Bacteroides sp. D2]
 gi|299147100|ref|ZP_07040167.1| FeS assembly ATPase SufC [Bacteroides sp. 3_1_23]
 gi|315920743|ref|ZP_07916983.1| ABC transporter ATP-binding protein [Bacteroides sp. D2]
 gi|156110655|gb|EDO12400.1| hypothetical protein BACOVA_01899 [Bacteroides ovatus ATCC 8483]
 gi|229450164|gb|EEO55955.1| ABC transporter ATP-binding protein [Bacteroides sp. 2_2_4]
 gi|298514985|gb|EFI38867.1| FeS assembly ATPase SufC [Bacteroides sp. 3_1_23]
 gi|313694618|gb|EFS31453.1| ABC transporter ATP-binding protein [Bacteroides sp. D2]
          Length = 250

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V P EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVNPGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFYGKDLLELSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSTIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|88801811|ref|ZP_01117339.1| ABC transporter, ATP-binding protein [Polaribacter irgensii 23-P]
 gi|88782469|gb|EAR13646.1| ABC transporter, ATP-binding protein [Polaribacter irgensii 23-P]
          Length = 250

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 184/249 (73%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL+A I   +  I++GLNL+V+  EV AIMGPNG+GKSTL+ +++G  DYEI++G
Sbjct: 1   MLKIENLQASI--DNKLILKGLNLEVKAGEVHAIMGPNGAGKSTLANIIAGKDDYEISSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I   GE + + +  ERA  G+FL+FQYPVEIPG+ +  F+K A+N+ RKA+  +++   
Sbjct: 59  TIELNGEDLSELAPEERAHNGVFLSFQYPVEIPGVSVTNFIKTAINQTRKAKGLEDMPAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKMIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S+D + ++ITHYQRLL YI PD +HVL++GKI+KTGD S+AL+LE 
Sbjct: 179 DALRIVANGVNKLKSKDNAVIVITHYQRLLEYIVPDFVHVLYDGKIVKTGDASLALELEA 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|67924847|ref|ZP_00518243.1| FeS assembly ATPase SufC [Crocosphaera watsonii WH 8501]
 gi|67853306|gb|EAM48669.1| FeS assembly ATPase SufC [Crocosphaera watsonii WH 8501]
          Length = 256

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 180/243 (74%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IKNL A +    T I++G+NL ++  E+ AIMG NGSGKSTLS +L+GH DYEIT G
Sbjct: 5   ILSIKNLTANV--EGTPILKGVNLDIKAGEIHAIMGRNGSGKSTLSKVLAGHPDYEITGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++YKGE+ILD S  ERA +GIFLAFQYP+EIPG+  + FL++A N +RK    +E+   
Sbjct: 63  EVIYKGENILDKSPDERALEGIFLAFQYPLEIPGVSNLDFLRVAYNARRKHLGLEEIDTF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L+R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 123 DFEDLVEEKLEVVKMNSAFLERSLNEGFSGGEKKRNEILQMALLEPTLGILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVN L + D +FL+ITHYQRLLNYI+P  IHV+++G+I+ +G   +AL+LEE
Sbjct: 183 DALRIVSNGVNQLATPDNAFLLITHYQRLLNYIEPHHIHVMYDGQIVISGGKELALELEE 242

Query: 241 NGY 243
           +GY
Sbjct: 243 SGY 245


>gi|224536660|ref|ZP_03677199.1| hypothetical protein BACCELL_01536 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521751|gb|EEF90856.1| hypothetical protein BACCELL_01536 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 250

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A +     EI++G+NL V+  EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASV--NGKEILKGINLSVKAGEVHAIMGPNGSGKSTLSAVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++LD+S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK  +   L   
Sbjct: 59  SVTFCGKNLLDFSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYNHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPENSTIVITHYQRLLDYIKPDVVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|332186225|ref|ZP_08387970.1| feS assembly ATPase SufC [Sphingomonas sp. S17]
 gi|332013593|gb|EGI55653.1| feS assembly ATPase SufC [Sphingomonas sp. S17]
          Length = 250

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 176/245 (71%), Gaps = 3/245 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A+I      I++GL L+V   EV AIMGPNG+GKSTL Y+L G   YE+T G
Sbjct: 1   MLKIENLHAEI--DGKPILKGLTLEVNAGEVHAIMGPNGAGKSTLGYVLGGRPGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G  +L+    ERA+ G+FL FQYPVEIPG+  +QFL+ +LN QR  R+EK L   
Sbjct: 59  SVTFDGVDLLELEPNERAAAGLFLGFQYPVEIPGVSNVQFLRESLNAQRGQRDEKPLSGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R     LG+N DMLKRP+N+GFSGGEKK  E++QM +L P   ILDETDSGLDI
Sbjct: 119 EFLKLARAQADGLGLNQDMLKRPVNVGFSGGEKKRNEMVQMGILNPKFAILDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL+I   G+N  +R+ D++ L+ITHYQRLL+Y++PD +HVL +G+I+++G   +AL+LE
Sbjct: 179 DALRIVGDGINRIMRAPDKAVLLITHYQRLLDYVQPDRVHVLADGRIVRSGGPELALELE 238

Query: 240 ENGYA 244
             GYA
Sbjct: 239 REGYA 243


>gi|166365049|ref|YP_001657322.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa
           NIES-843]
 gi|166087422|dbj|BAG02130.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa
           NIES-843]
          Length = 256

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 176/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A I     +I++G+NL+++  E  AIMG NGSGKST S +++GH DYE+T G
Sbjct: 5   ILSVKNLTASI--DGNQILKGVNLEIKAGETHAIMGRNGSGKSTFSKVIAGHPDYEVTGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+YKGE++LD    ERA  GIFLAFQYP+EIPG+  + FL++A N ++K    +EL   
Sbjct: 63  EIIYKGENLLDKEPDERALMGIFLAFQYPLEIPGVSNLDFLRVAYNARQKYLGSEELDSF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V K    + +N   L R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 123 DFEELVEKKLEVVQMNPSFLGRSLNEGFSGGEKKRNEILQMALLEPTLGILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I AQGVN L + D +FL+ITHYQRLLNYI+PD IHV+++G+I+ +G   +AL+LE 
Sbjct: 183 DALRIVAQGVNHLATPDNAFLLITHYQRLLNYIEPDVIHVMYDGRIVTSGGKELALELER 242

Query: 241 NGY 243
            GY
Sbjct: 243 TGY 245


>gi|189459830|ref|ZP_03008615.1| hypothetical protein BACCOP_00460 [Bacteroides coprocola DSM 17136]
 gi|189433440|gb|EDV02425.1| hypothetical protein BACCOP_00460 [Bacteroides coprocola DSM 17136]
          Length = 250

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V+  EV AIMGPNGSGKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHATI--NGKEILKGINLTVKSGEVHAIMGPNGSGKSTLSNVLVGHPAYEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L+ S  +R+ +G+FL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFDGKDLLEMSAEDRSHEGLFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMRQKREIVELDSKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSCIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|29654656|ref|NP_820348.1| FeS assembly ATPase SufC [Coxiella burnetii RSA 493]
 gi|153209327|ref|ZP_01947346.1| FeS assembly ATPase SufC [Coxiella burnetii 'MSU Goat Q177']
 gi|154706975|ref|YP_001424794.1| ATP-dependent transporter [Coxiella burnetii Dugway 5J108-111]
 gi|161830751|ref|YP_001597201.1| FeS assembly ATPase SufC [Coxiella burnetii RSA 331]
 gi|212212266|ref|YP_002303202.1| ATP-dependent transporter [Coxiella burnetii CbuG_Q212]
 gi|212218765|ref|YP_002305552.1| ATP-dependent transporter [Coxiella burnetii CbuK_Q154]
 gi|29541924|gb|AAO90862.1| ATP-dependent transporter [Coxiella burnetii RSA 493]
 gi|120575398|gb|EAX32022.1| FeS assembly ATPase SufC [Coxiella burnetii 'MSU Goat Q177']
 gi|154356261|gb|ABS77723.1| ATP-dependent transporter [Coxiella burnetii Dugway 5J108-111]
 gi|161762618|gb|ABX78260.1| FeS assembly ATPase SufC [Coxiella burnetii RSA 331]
 gi|212010676|gb|ACJ18057.1| ATP-dependent transporter [Coxiella burnetii CbuG_Q212]
 gi|212013027|gb|ACJ20407.1| ATP-dependent transporter [Coxiella burnetii CbuK_Q154]
          Length = 244

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 179/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +   + +I+RG+NL +   EV AIMGPNGSGKSTL+ +L+G +DY I  G
Sbjct: 1   MLTIKNLHASV--HNNQILRGVNLTINAGEVHAIMGPNGSGKSTLASVLAGREDYAIVDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+ Y  E + + S  +RA+KG+FLAFQYPVEIPG+  + FLK A+N  RK R E      
Sbjct: 59  DVRYFDEDLFELSPEDRAAKGLFLAFQYPVEIPGVNNLYFLKTAVNSIRKTRGEAPFDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D    V++  A + ++   LKR +N GFSGGEKK  EILQM +L+P L ILDETDSGLDI
Sbjct: 119 DLMGLVKEKLALVDMDDKFLKRSVNEGFSGGEKKRNEILQMLMLDPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A+GVN+LR+++R+ L++THYQRLL+YIKPD +HVL NG+I+ +GD S+AL+LE+
Sbjct: 179 DALQTVAKGVNSLRNKERAILLVTHYQRLLDYIKPDFVHVLVNGRIVLSGDQSLALELEK 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|218245298|ref|YP_002370669.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 8801]
 gi|257058333|ref|YP_003136221.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 8802]
 gi|218165776|gb|ACK64513.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 8801]
 gi|256588499|gb|ACU99385.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 8802]
          Length = 256

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 176/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A +    T I++G+NL+++  EV AIMG NGSGKSTLS +L+GH DYEIT G
Sbjct: 5   ILLVKNLTANV--EGTPILKGVNLEIKSGEVHAIMGRNGSGKSTLSKILAGHPDYEITGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILYKGE+ILD    ERA  GIFLAFQYP+EIPG+    FL+++ N +R+    +E+   
Sbjct: 63  EILYKGENILDKEPDERAKMGIFLAFQYPLEIPGVSNFDFLRVSYNARRQYLGLEEMDTF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L+R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 123 DFEDLVEQKLEVVKMNPSFLERSLNEGFSGGEKKRNEILQMALLEPTLSILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L + D + L+ITHYQRLL+YI+P  +HV+H+GKI+ TG   +AL+LE 
Sbjct: 183 DALKIVANGVNQLTNPDNALLVITHYQRLLDYIEPHYVHVMHDGKIVTTGSKELALELEA 242

Query: 241 NGY 243
           +GY
Sbjct: 243 SGY 245


>gi|255692957|ref|ZP_05416632.1| FeS assembly ATPase SufC [Bacteroides finegoldii DSM 17565]
 gi|260621268|gb|EEX44139.1| FeS assembly ATPase SufC [Bacteroides finegoldii DSM 17565]
          Length = 250

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V+P EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVKPGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++L+ S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFYGKNLLELSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LE+
Sbjct: 179 DALRIVAEGVNKLKTPETSTIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELED 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|153809154|ref|ZP_01961822.1| hypothetical protein BACCAC_03464 [Bacteroides caccae ATCC 43185]
 gi|149128130|gb|EDM19350.1| hypothetical protein BACCAC_03464 [Bacteroides caccae ATCC 43185]
          Length = 250

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V+P EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVKPGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+++L+ S  +R+ +GIFL+FQYPVEIPG+ ++ F++ A+NEQRK +    L   
Sbjct: 59  SITFYGKNLLELSPEDRSHEGIFLSFQYPVEIPGVSIVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSTIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|325299864|ref|YP_004259781.1| FeS assembly ATPase SufC [Bacteroides salanitronis DSM 18170]
 gi|324319417|gb|ADY37308.1| FeS assembly ATPase SufC [Bacteroides salanitronis DSM 18170]
          Length = 250

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V+  EV AIMGPNGSGKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVKTGEVHAIMGPNGSGKSTLSNVLVGHPAYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +++ G+ +L  S  +R+ +G+FL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVIFDGKDLLAMSPEDRSHEGLFLSFQYPVEIPGVSMVNFMRSAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMRQKREVVELDSKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ GKI+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPNTSCIVITHYQRLLDYIKPDIVHVLYKGKIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|149185215|ref|ZP_01863532.1| ABC transporter, ATP-binding protein [Erythrobacter sp. SD-21]
 gi|148831326|gb|EDL49760.1| ABC transporter, ATP-binding protein [Erythrobacter sp. SD-21]
          Length = 250

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 182/250 (72%), Gaps = 3/250 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A+I     +I+ GL L+V   EV AIMGPNG+GKSTLSY+L G   YE+T G
Sbjct: 1   MLQIKNLTAEI--DGKQILNGLTLEVAAGEVHAIMGPNGAGKSTLSYVLGGRPGYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+++L+    ERA+ G+FL FQYPVEIPG+  +QFL+ ALN QRK R E+ L   
Sbjct: 59  SISFNGKNLLEMEPHERAAAGLFLGFQYPVEIPGVSNVQFLREALNAQRKGRGEEPLAGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++    L ++MDMLKR +N+GFSGGEKK AE++QM +L+P+  +LDETDSGLDI
Sbjct: 119 EFLKLAKEKAGLLKLDMDMLKRNVNVGFSGGEKKRAEMVQMGILDPTFAVLDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL++  +G+NA +R+ D++ L+ITHYQRLL  +KPD + +L  G+I+KTG   +A+ LE
Sbjct: 179 DALRVVGEGINAIMRAPDKAVLLITHYQRLLEVVKPDKVSILSKGRIVKTGGPELAVRLE 238

Query: 240 ENGYAELIKE 249
           + GY  ++ E
Sbjct: 239 KEGYDAVMAE 248


>gi|269104613|ref|ZP_06157309.1| iron-sulfur cluster assembly ATPase protein SufC [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161253|gb|EEZ39750.1| iron-sulfur cluster assembly ATPase protein SufC [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 247

 Score =  264 bits (675), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 178/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL   +   D EI++G+NL+++  EV AIMGPNGSGKSTLS  L+G +DYE+T G
Sbjct: 1   MLDIKNLHVSV--EDNEILKGINLQIKAGEVHAIMGPNGSGKSTLSSTLAGKEDYEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +  + +++    ERA +G+FLAFQYPVEIPG+    FL+ ALN  R  +   EL   
Sbjct: 59  SIEFLNKDLIELDADERAGEGVFLAFQYPVEIPGVSNKLFLRTALNGIRNYKGLSELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    L + + +L R +N GFSGGEKK  +ILQM +LEPSLCILDETDSGLDI
Sbjct: 119 DFDDLLEEKAEPLKMPVHLLDRSVNEGFSGGEKKRNDILQMAVLEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++ VN LR   R+F+++THYQR+L+YIKPD +HV+ +GKI+K+GDY +A +LEE
Sbjct: 179 DALKAVSESVNTLRDDKRAFIVVTHYQRILDYIKPDYVHVMVDGKIVKSGDYRLAKELEE 238

Query: 241 NGYAELIKE 249
            GY  +I E
Sbjct: 239 KGYGWIIGE 247


>gi|295132094|ref|YP_003582770.1| FeS assembly ATPase SufC [Zunongwangia profunda SM-A87]
 gi|294980109|gb|ADF50574.1| FeS assembly ATPase SufC [Zunongwangia profunda SM-A87]
          Length = 250

 Score =  264 bits (674), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 177/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A I     EI++G++L++ P EV AIMGPNGSGKSTLS +++G ++YE+T G
Sbjct: 1   MLKIKNLHASI--EGKEILKGIDLEINPGEVHAIMGPNGSGKSTLSSVIAGREEYEMTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+++ E + +    ERA KGIFL+FQYPVEIPG+ +  F+K A+N  RKA    ++   
Sbjct: 59  EIIFENEDLAELDPEERAHKGIFLSFQYPVEIPGVSVTNFMKTAINAHRKANGLDDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +R+ +  L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKLIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVN LR+++ + L+ITHYQRLLNYI PD +HVL +GKI+KTG   +A +LEE
Sbjct: 179 DALRIVSNGVNKLRTENNAVLVITHYQRLLNYIVPDVVHVLIDGKIVKTGGKELAYELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|108761954|ref|YP_629414.1| FeS assembly ATPase SufC [Myxococcus xanthus DK 1622]
 gi|108465834|gb|ABF91019.1| FeS assembly ATPase SufC [Myxococcus xanthus DK 1622]
          Length = 262

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 179/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A++   D  I++G++L+V P EV AIMGPNGSGKSTL+ +L+G   YE+T G
Sbjct: 3   LLTVRNLHARVAGKD--ILKGIDLEVAPGEVHAIMGPNGSGKSTLASVLAGRDGYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G+ +L+ S   RA+ G+FLAFQYPVEIPG+  + FL+ ALN QR+A+  +EL   
Sbjct: 61  EVLFDGKPLLELSPEARAAAGVFLAFQYPVEIPGVGNIHFLRTALNAQRRAKGLEELDAM 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +  ++ +  + ++   + R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 121 DFLQLAKEKSKLVQLDAAFMNRSVNEGFSGGEKKRNEIFQMAVLEPRLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVNALRS +R  ++ITHYQRLL+YI PD +HV+  G+I+++G   +AL+LEE
Sbjct: 181 DALRTVAGGVNALRSPERGMVLITHYQRLLDYIVPDKVHVIAAGRIVRSGGRELALELEE 240

Query: 241 NGYAEL 246
            GY  L
Sbjct: 241 KGYGWL 246


>gi|91790108|ref|YP_551060.1| FeS assembly ATPase SufC [Polaromonas sp. JS666]
 gi|91699333|gb|ABE46162.1| Iron-regulated ABC transporter ATPase subunit SufC [Polaromonas sp.
           JS666]
          Length = 256

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 176/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL   +   D  I+RG++L +   EV AIMGPNGSGKSTL+++L+G  ++ +TAG
Sbjct: 1   MLEIRNLHVSV--DDKPILRGIDLTIRAGEVHAIMGPNGSGKSTLAHVLAGRDNHVVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ Y+G ++LD    ERA  GIFLAFQYPVEIPG+  +  LK ALN QR  R E EL   
Sbjct: 59  EVRYEGRNLLDLPPEERARAGIFLAFQYPVEIPGVANIYLLKAALNAQRLHRGEPELDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V+   A +G++  +L R +N GFSGGEKK  EILQM +LEP L ILDETDSGLDI
Sbjct: 119 DFLALVKGKLALMGMDTSLLYRAVNEGFSGGEKKRNEILQMAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A G++A+RS +R+ +++THYQRLLNYI PD +HVL  G+I  +G   +AL+LE+
Sbjct: 179 DALQVVAGGISAMRSPERAIVLVTHYQRLLNYIVPDHVHVLAQGRIALSGGRELALELEK 238

Query: 241 NGYA 244
           +GY 
Sbjct: 239 HGYG 242


>gi|165924049|ref|ZP_02219881.1| FeS assembly ATPase SufC [Coxiella burnetii RSA 334]
 gi|165916508|gb|EDR35112.1| FeS assembly ATPase SufC [Coxiella burnetii RSA 334]
          Length = 244

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 179/246 (72%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +   + +I+RG+NL +   EV AIMGPNGSGKSTL+ +L+G +DY I  G
Sbjct: 1   MLTIKNLHASV--HNNQILRGVNLTINAGEVHAIMGPNGSGKSTLASVLAGREDYAIVDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+ Y  E + + S  +RA+KG+FLAFQYPVEIPG+  + FLK A+N  RK R E      
Sbjct: 59  DVRYFDEDLFELSPEDRAAKGLFLAFQYPVEIPGVNNLYFLKTAVNSIRKTRGEAPFDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D    V++  A + ++   LKR +N GFSGGEKK  EILQM +L+P L ILDETDSGLDI
Sbjct: 119 DLMGLVKEKLALVDMDDKFLKRSVNEGFSGGEKKRNEILQMLMLDPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A+GVN+LR+++R+ L++THYQRLL+YIKPD +HVL NG+I+ +GD S+AL+L++
Sbjct: 179 DALQTVAKGVNSLRNKERAILLVTHYQRLLDYIKPDFVHVLVNGRIVLSGDQSLALELDK 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|304321532|ref|YP_003855175.1| ABC transporter ATP-binding protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300434|gb|ADM10033.1| ABC transporter, ATP-binding protein [Parvularcula bermudensis
           HTCC2503]
          Length = 250

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 170/248 (68%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I +L   I     EI++GL+L+V   EV AIMGPNGSGKSTLSY ++G   Y   +G
Sbjct: 3   LLKIDDLHLSI--EGNEILQGLSLEVPAGEVHAIMGPNGSGKSTLSYAVAGRPGYAPLSG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++   GES+L  +  ERA+KGIFL+FQ PV IPG+  M FL+ ALN QR AR E+E+   
Sbjct: 61  EVTLNGESLLGLTPEERAAKGIFLSFQNPVAIPGVATMNFLRTALNAQRAARGEEEMSAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R+  A +G++ D LKRP N GFSGGEKK  E+LQM L  P   I+DETDSGLDI
Sbjct: 121 EFLKVFREKAALVGLSPDKLKRPFNDGFSGGEKKRMEMLQMALFAPRFAIMDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+    VN LR  DR FL+ITHYQRLL+++KPD IHVL  G+I+KTG   +A  LE 
Sbjct: 181 DALKMVGDVVNTLRGPDRGFLVITHYQRLLDHVKPDVIHVLSQGRIVKTGGPELAAQLEA 240

Query: 241 NGYAELIK 248
            GY +  +
Sbjct: 241 EGYDQFTE 248


>gi|332829538|gb|EGK02187.1| FeS assembly ATPase SufC [Dysgonomonas gadei ATCC BAA-286]
          Length = 253

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IK+L A +     EI++GLNL+V   E+ AIMGPNG+GKSTL+ +L G+ ++E+T G
Sbjct: 4   LLNIKDLHANV--EGKEILKGLNLEVNEGEIHAIMGPNGAGKSTLASVLVGNPNFEVTEG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I Y+G  +LD    +RA +G+FL+FQYPVEIPG+ M  F++ +LNE RK R ++ +   
Sbjct: 62  EIDYRGHDLLDMDPEDRAREGLFLSFQYPVEIPGVSMTNFMRASLNEIRKHREQEPISAS 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +++    + ++ D+  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 122 DFLKMIKEKRELVELDKDLAGRSVNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LR +D + ++ITHYQRLL+YIKPD +HVL+ G+I+K+    +AL+LEE
Sbjct: 182 DALRIVAAGVNKLRRKDNATVVITHYQRLLDYIKPDFVHVLYKGRIVKSAGAELALELEE 241

Query: 241 NGYAELIKE 249
            GY  +IKE
Sbjct: 242 KGYDWIIKE 250


>gi|320161200|ref|YP_004174424.1| putative ATP-dependent transporter SufC [Anaerolinea thermophila
           UNI-1]
 gi|319995053|dbj|BAJ63824.1| putative ATP-dependent transporter SufC [Anaerolinea thermophila
           UNI-1]
          Length = 256

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 180/246 (73%), Gaps = 8/246 (3%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L IKNL   I     EII+GL+L +   EV AIMGPNG+GKSTL+Y L GH  YE+T G+
Sbjct: 4   LVIKNLHVAI--EGKEIIKGLDLTIRQGEVHAIMGPNGTGKSTLAYTLMGHPAYEVTEGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARN--EKELLI 119
           + +KG++IL+    ER+  GIFLAFQYPV IPG+ +  FL+ A+N +R+A N  +K + I
Sbjct: 62  VWFKGQNILELEPDERSRLGIFLAFQYPVAIPGVTVANFLRTAINARRRAENPEDKGIPI 121

Query: 120 PDFTRKVRKITAELGINMD--MLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           P+F RK+ K   EL + MD     R LN GFSGGEKK AEILQM +L+P + ILDETDSG
Sbjct: 122 PEF-RKLLKSKMEL-LKMDPAFAGRYLNDGFSGGEKKRAEILQMAMLQPEIAILDETDSG 179

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL+I A+GVNALRS+D   L+ITHYQR+LNYI PD +H++  G+I+++GD  +AL 
Sbjct: 180 LDIDALRIVAEGVNALRSKDLGVLVITHYQRILNYITPDFVHIMLGGRIVESGDADLALH 239

Query: 238 LEENGY 243
           LEE+GY
Sbjct: 240 LEEHGY 245


>gi|189465085|ref|ZP_03013870.1| hypothetical protein BACINT_01429 [Bacteroides intestinalis DSM
           17393]
 gi|189437359|gb|EDV06344.1| hypothetical protein BACINT_01429 [Bacteroides intestinalis DSM
           17393]
          Length = 250

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A +     EI++G+NL V+  EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASV--NGKEILKGINLSVKAGEVHAIMGPNGSGKSTLSAVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++LD+S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NEQRK  +   L   
Sbjct: 59  SVTFCGKNLLDFSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVNEQRKYNHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ +   ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPENGTIVITHYQRLLDYIKPDVVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 KGYDWIKKE 247


>gi|307824106|ref|ZP_07654333.1| FeS assembly ATPase SufC [Methylobacter tundripaludum SV96]
 gi|307734890|gb|EFO05740.1| FeS assembly ATPase SufC [Methylobacter tundripaludum SV96]
          Length = 251

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 177/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL   +   D  I++G+NL+++  E+ AIMGPNGSGKSTLS++LSG   Y +T G
Sbjct: 1   MLSIKNLHVSV--GDKPILKGINLEIKAGEIHAIMGPNGSGKSTLSHVLSGKGGYTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              Y+G+ +L+ +   RA +G+FLAFQYPVEIPG+  +  LK ALN  RK   + E+   
Sbjct: 59  SATYQGKDLLEMAPEIRAREGVFLAFQYPVEIPGVSNIYLLKAALNSIRKHNGQPEVDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V+     L ++   L R +N GFSGGEKK  EILQM +LEP LCI+DETDSGLDI
Sbjct: 119 DFLTLVKDKVRLLEMDEKFLYRAVNEGFSGGEKKRNEILQMAILEPKLCIMDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVN+LRS +R+F+++THYQRLL+YIKPD +HVL +G+I+K+G   +AL+LEE
Sbjct: 179 DALKIVSEGVNSLRSPERAFVMVTHYQRLLDYIKPDFVHVLAHGQIVKSGGADLALELEE 238

Query: 241 NGYA 244
            GY+
Sbjct: 239 KGYS 242


>gi|167753460|ref|ZP_02425587.1| hypothetical protein ALIPUT_01734 [Alistipes putredinis DSM 17216]
 gi|167658085|gb|EDS02215.1| hypothetical protein ALIPUT_01734 [Alistipes putredinis DSM 17216]
          Length = 250

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +KNLRA++     EI++G++L+V+  EV AIMGPNGSGKSTL+ +L+G++ + +T G
Sbjct: 1   MLSVKNLRAQV--AGKEILKGIDLEVKAGEVHAIMGPNGSGKSTLASVLAGNEKFTVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +  +  + +L   I ERA  G+FL FQYPVEIPG+ M  F+K+A+NEQRK R EK L   
Sbjct: 59  EATFLEQDLLSLPIEERACMGLFLGFQYPVEIPGVSMANFMKMAVNEQRKFRGEKPLAPA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + VR+ +A + ++  ++ R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLVREKSAIVELDSKLISRSVNEGFSGGEKKKNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I   GV  L   D + ++ITHYQRLL+YI PD +HVL+ G+II +GD S+AL LE+
Sbjct: 179 DALRIVGTGVTKLHRSDNATIVITHYQRLLDYIVPDFVHVLYKGRIIYSGDRSLALKLEK 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 EGYDWLIND 247


>gi|152992591|ref|YP_001358312.1| Fe-S cluster assembly ATPase SufC [Sulfurovum sp. NBC37-1]
 gi|151424452|dbj|BAF71955.1| Fe-S cluster assembly ATPase SufC [Sulfurovum sp. NBC37-1]
          Length = 252

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 178/248 (71%), Gaps = 2/248 (0%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEI+N+ AKI   + EI++GLNL +EP +V AIMGPNG+GKSTLS  + GH D ++T GD
Sbjct: 4   LEIENIHAKI--GEKEILKGLNLALEPGKVHAIMGPNGAGKSTLSKTIVGHYDVKVTEGD 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           I YKG+SI++    ERA +GIFL+FQ+PVEIPG+    FL+ ALN +RK   ++EL   +
Sbjct: 62  IRYKGKSIIEMEPEERALEGIFLSFQHPVEIPGVNNAYFLRTALNAKRKHEGKEELNAAE 121

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R ++     LG+  DM+ R LN GFSGGEKK  EILQM +LEP + ILDE DSGLDID
Sbjct: 122 FLRLMKSHLEMLGMKSDMISRSLNEGFSGGEKKRNEILQMLILEPEVIILDEIDSGLDID 181

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL+  ++G+N ++   RSFL+ITHY R+L+YI+PD IHVL  G+IIKT    +   LEE 
Sbjct: 182 ALRAVSEGINKMKDGKRSFLVITHYSRILDYIEPDYIHVLKEGRIIKTAGPELVAKLEEE 241

Query: 242 GYAELIKE 249
           GY  +I++
Sbjct: 242 GYESIIED 249


>gi|326386613|ref|ZP_08208235.1| FeS assembly ATPase SufC [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208928|gb|EGD59723.1| FeS assembly ATPase SufC [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 249

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 170/231 (73%), Gaps = 1/231 (0%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVER 77
           I++GL+L +   E+ AIMGPNG+GKSTL+Y L G   YE+T G + + GE +L     ER
Sbjct: 18  ILKGLSLSIGAGEIHAIMGPNGAGKSTLAYTLGGRPGYEVTGGSVTFAGEDLLAMEPHER 77

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINM 137
           A+ G+FL FQYPVEIPG+  +QFL+ ALN QRK R E+ L    F +  R+  A L ++ 
Sbjct: 78  AAAGLFLGFQYPVEIPGVSTVQFLREALNAQRKTRGEEPLSGGAFLKLAREKAALLKLDP 137

Query: 138 DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNA-LRSQ 196
           +MLKRP+N+GFSGGEKK AE++QM +L+P   ILDETDSGLDIDAL+I  +G+NA +R  
Sbjct: 138 EMLKRPVNVGFSGGEKKRAEMVQMGVLDPKFAILDETDSGLDIDALRIVGEGINAIMRKP 197

Query: 197 DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELI 247
           D++ L+ITHYQRLL+Y+KPD +HVL  G+I+++G   +AL+LEE GY  ++
Sbjct: 198 DKAVLLITHYQRLLDYVKPDFVHVLAAGRIVRSGGPELALELEEQGYEAVV 248


>gi|258542737|ref|YP_003188170.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633815|dbj|BAH99790.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636874|dbj|BAI02843.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639927|dbj|BAI05889.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642983|dbj|BAI08938.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646038|dbj|BAI11986.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649091|dbj|BAI15032.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652078|dbj|BAI18012.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655135|dbj|BAI21062.1| FeS assembly ATP-binding protein SufC [Acetobacter pasteurianus IFO
           3283-12]
          Length = 256

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 131/252 (51%), Positives = 178/252 (70%), Gaps = 4/252 (1%)

Query: 1   MLEIKNLRAKIVDTD---TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
            LEI  L A+I D D    +I+RG++L + P EV AIMGPNG GKSTLSY+L+G +DYE+
Sbjct: 4   FLEISGLCARI-DADGQEKQILRGVDLTIPPGEVHAIMGPNGCGKSTLSYVLAGREDYEV 62

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           TAG + +KG+ +L     ERA+ G+FLAFQ P+E+PG+    FL+ A+N  R+AR  +EL
Sbjct: 63  TAGSVTFKGQDLLAMEPEERAAAGLFLAFQSPIELPGVNNANFLRTAVNAVRRARGLEEL 122

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
               F +  R+    L +  DMLKR +N+GFSGGEKK  E+LQM LL+PS  ILDETDSG
Sbjct: 123 DAVAFLKMAREAAKSLSMAPDMLKRNVNVGFSGGEKKRNEVLQMTLLQPSFAILDETDSG 182

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LD+DAL+I A+GVN LRS D S L+ITH+Q+LL+Y+ PD IHV+  G+II +G   +A  
Sbjct: 183 LDVDALRIVAEGVNRLRSPDFSALVITHHQKLLDYLVPDRIHVMAKGRIILSGGPELAKR 242

Query: 238 LEENGYAELIKE 249
           +++ GY + + E
Sbjct: 243 IDQEGYTKFLAE 254


>gi|254424639|ref|ZP_05038357.1| FeS assembly ATPase SufC [Synechococcus sp. PCC 7335]
 gi|196192128|gb|EDX87092.1| FeS assembly ATPase SufC [Synechococcus sp. PCC 7335]
          Length = 261

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +++L A +    TEI++G+N +V+  EV AIMG NGSGKST S +L+GH DYEITAG
Sbjct: 9   ILSVRDLHASV--DGTEILKGVNFEVKAGEVHAIMGLNGSGKSTFSKVLAGHPDYEITAG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G ++L+    ERA+ G+FLAFQYP+EIPG+    FL++A N  RKA  E+E+ + 
Sbjct: 67  EVIFQGMNLLELEPHERANSGVFLAFQYPLEIPGVSNRDFLRVAYNSHRKANGEEEIDVF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V + +  + +++  L R +N GFSGGEKK  EILQM LLEP+L ILDETDSGLDI
Sbjct: 127 DFDDLVEERSDVVKMDVSFLDRSVNEGFSGGEKKRNEILQMALLEPTLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN L + + + ++ITHYQRLLNYI PD +HV+  G+I+KTG   +A +LE 
Sbjct: 187 DALKIVSNGVNQLSTPENASILITHYQRLLNYIVPDYVHVMAQGRIVKTGGKELAQELES 246

Query: 241 NGYAELIKE 249
            GY  ++ E
Sbjct: 247 RGYDWIVAE 255


>gi|329114664|ref|ZP_08243423.1| FeS assembly ATPase SufC [Acetobacter pomorum DM001]
 gi|326696144|gb|EGE47826.1| FeS assembly ATPase SufC [Acetobacter pomorum DM001]
          Length = 256

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 131/252 (51%), Positives = 178/252 (70%), Gaps = 4/252 (1%)

Query: 1   MLEIKNLRAKIVDTD---TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
            LEI  L A+I D D    +I+RG++L + P EV AIMGPNG GKSTLSY+L+G +DYE+
Sbjct: 4   FLEISGLCARI-DADGQEKQILRGVDLTIPPGEVHAIMGPNGCGKSTLSYVLAGREDYEV 62

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           TAG + +KG+ +L     ERA+ G+FLAFQ P+E+PG+    FL+ A+N  R+AR  +EL
Sbjct: 63  TAGSVTFKGQDLLAMEPEERAAAGLFLAFQSPIELPGVNNANFLRTAVNAVRRARGLEEL 122

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
               F +  R+    L +  DMLKR +N+GFSGGEKK  E+LQM LL+PS  ILDETDSG
Sbjct: 123 DAVAFLKMAREAAKSLSMAPDMLKRNVNVGFSGGEKKRNEVLQMTLLQPSFAILDETDSG 182

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LD+DAL+I A+GVN LRS D S L+ITH+Q+LL+Y+ PD IHV+  G+II +G   +A  
Sbjct: 183 LDVDALRIVAEGVNRLRSPDFSALVITHHQKLLDYLVPDRIHVMAKGRIILSGGPELAKR 242

Query: 238 LEENGYAELIKE 249
           +++ GY + + E
Sbjct: 243 IDQEGYTKFLTE 254


>gi|224025203|ref|ZP_03643569.1| hypothetical protein BACCOPRO_01937 [Bacteroides coprophilus DSM
           18228]
 gi|224018439|gb|EEF76437.1| hypothetical protein BACCOPRO_01937 [Bacteroides coprophilus DSM
           18228]
          Length = 250

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 178/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V+  EV AIMGPNGSGKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVKEGEVHAIMGPNGSGKSTLSNVLVGHPAYEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L  S  +R+ +G+FL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFGGKDLLALSPEDRSHEGLFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMRQKREIVELDSKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++   S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPQTSCIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 RGYDWIKKE 247


>gi|34540103|ref|NP_904582.1| ABC transporter ATP-binding protein [Porphyromonas gingivalis W83]
 gi|34396414|gb|AAQ65481.1| ABC transporter, ATP-binding protein [Porphyromonas gingivalis W83]
          Length = 250

 Score =  261 bits (667), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +     EI++G+NL++   E+ AIMGPNGSGKSTLS +L GH  +E+T G
Sbjct: 1   MLKIKNLHATV--QGKEILKGINLEINAGEIHAIMGPNGSGKSTLSSVLVGHPSFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G  +L+    ERA  G+FL+FQYPVEIPG+ M+ F++ A+NE RKA   + +   
Sbjct: 59  EVTFNGIDLLELEPEERAHLGLFLSFQYPVEIPGVSMVNFMRAAVNEHRKAIGAEPVSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DFLKMMREKRAIVELDNKLASRSVNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS + + ++ITHYQRLL YIKPD +HVL+ G+I+K+G   +AL LEE
Sbjct: 179 DALRIVAGGVNRLRSPENAAIVITHYQRLLEYIKPDFVHVLYKGRIVKSGGAELALTLEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|22299447|ref|NP_682694.1| ABC transporter ATP-binding protein [Thermosynechococcus elongatus
           BP-1]
 gi|22295630|dbj|BAC09456.1| ABC transporter ATP-binding protein [Thermosynechococcus elongatus
           BP-1]
          Length = 260

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 173/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE++ L A +   DT I++GLNL +   E+ AIMGPNGSGKST S +L+GH DY +T G
Sbjct: 9   ILEVRELTASV--EDTPILKGLNLTIRAGEIHAIMGPNGSGKSTFSKILAGHPDYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++LYKG+++LD    ERA +G+FLAFQYP+EIPG+  + FL++A N +RK +  +EL   
Sbjct: 67  EVLYKGKNLLDLPPEERAREGVFLAFQYPLEIPGVSNLDFLRVAYNAKRKHQGLEELDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + +    L+R +N GFSGGEKK  EILQM LLEP+L ILDETDSGLDI
Sbjct: 127 DFDDLVRQKIELVKLEEGFLQRGVNEGFSGGEKKRNEILQMALLEPTLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L   D   L+ITHYQRLL+YI PD +HV+  G+I+ TG   +AL+LE 
Sbjct: 187 DALRIVANGVNQLTRPDNCILLITHYQRLLDYIVPDYVHVMEGGRIVLTGPKELALELEA 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|255532927|ref|YP_003093299.1| FeS assembly ATPase SufC [Pedobacter heparinus DSM 2366]
 gi|255345911|gb|ACU05237.1| FeS assembly ATPase SufC [Pedobacter heparinus DSM 2366]
          Length = 255

 Score =  261 bits (666), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKN+ A +     EI++G+NL+++  EV AIMGPNGSGKSTL+ +L+G + YE+T G
Sbjct: 3   MLSIKNIHANV--EGKEILKGINLEIKAGEVHAIMGPNGSGKSTLASVLAGREQYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +  + +L+ S  +RA +G+FLAFQYP+EIPG+    F+K A+NE+RK    + L   
Sbjct: 61  EVSFLEKDLLELSPEDRAREGLFLAFQYPIEIPGVSTTNFIKAAVNEKRKYHGLEPLDAV 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + +++  A + I+  +L R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 121 TFLKMMKEKMALVEIDQSLLSRSINEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+N L S DR+ L+ITHYQRLL+YI+PD +HVL+NG+I+K+G   +AL+LEE
Sbjct: 181 DALRIVANGINKLHSPDRAVLVITHYQRLLDYIQPDFVHVLYNGRIVKSGTKELALELEE 240

Query: 241 NGY 243
            GY
Sbjct: 241 KGY 243


>gi|94677007|ref|YP_588902.1| FeS assembly ATPase SufC [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|94220157|gb|ABF14316.1| FeS assembly ATPase SufC [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 246

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 179/248 (72%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL  ++   +  II  LNL+++P E+ AIMGPNGSGKSTLS  L+GHKDY +TAG
Sbjct: 1   MLSIQNLNVEV--ENKLIINRLNLEIKPGEIHAIMGPNGSGKSTLSTTLAGHKDYHVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +K  ++L  +  ERA +G+FLAFQYPVEIPGI    FL+ A+N  RK R  + L   
Sbjct: 59  TIRFKEHNLLMLNPEERAGEGLFLAFQYPVEIPGISNTLFLQTAINSIRKYRKLEPLDSW 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D    + +    L I+  +LKR +N+GFSGGEKK  EILQM +LEP LCILDE DSGLDI
Sbjct: 119 DLIDLINQKINRLNISDKLLKRSVNVGFSGGEKKRNEILQMAVLEPDLCILDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+ +  LR+ +RSF++ITHYQR+L+ I+P+ +HV+H+G IIK+G++S+A  LEE
Sbjct: 179 DALKIIARCITLLRNANRSFIVITHYQRILDDIQPEYVHVMHHGSIIKSGNFSLAKQLEE 238

Query: 241 NGYAELIK 248
            GY  LIK
Sbjct: 239 QGYDWLIK 246


>gi|313887362|ref|ZP_07821053.1| FeS assembly ATPase SufC [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332299230|ref|YP_004441151.1| FeS assembly ATPase SufC [Porphyromonas asaccharolytica DSM 20707]
 gi|312923281|gb|EFR34099.1| FeS assembly ATPase SufC [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332176293|gb|AEE11983.1| FeS assembly ATPase SufC [Porphyromonas asaccharolytica DSM 20707]
          Length = 258

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 179/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+IKNL A I   D EI++G+NL +   E  AIMGPNGSGKSTLS +L GH  + +T+G
Sbjct: 5   ILDIKNLHANI--GDKEILKGINLTIREGETHAIMGPNGSGKSTLSSVLVGHPAFTVTSG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ Y G+ +L    VERA  G+FL+FQYPVEIPG+ M+ F++ ALNE+RK + EK +   
Sbjct: 63  EVTYLGQDLLAMDAVERAHAGLFLSFQYPVEIPGVSMVNFMRSALNERRKTQGEKPMPAG 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++    +G++  +LKR +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 123 EFLKMLKEKREVVGLDDRLLKRSVNEGFSGGEKKRNEIFQMAVLEPRLSILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVN L+  D + ++ITHYQRLL+YIKP  +H+L+ G+I+ +G   +AL LE+
Sbjct: 183 DALRAVAHGVNTLQRPDSACVVITHYQRLLDYIKPQFVHILYKGRIVTSGGPELALRLED 242

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 243 EGY-DWIKE 250


>gi|126665741|ref|ZP_01736722.1| FeS assembly ATPase SufC [Marinobacter sp. ELB17]
 gi|126629675|gb|EBA00292.1| FeS assembly ATPase SufC [Marinobacter sp. ELB17]
          Length = 254

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 181/246 (73%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +     +I++G+NL+++  EV AIMGPNGSGKSTLS +L+G+  +E+T G
Sbjct: 1   MLSIKNLHASV--EGKQILKGINLEIKAGEVHAIMGPNGSGKSTLSQVLAGNDAFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++   G+++L+     RA +G+FLAFQYPVEIPG+  +QFL+ A+N  RK + + ++   
Sbjct: 59  EVTLNGDNLLELPTEARAREGVFLAFQYPVEIPGVSNLQFLRTAVNAMRKHQGKDDMNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++++ ++ ++   LKR +N GFSGGEKK  EI+Q  LL+P L ILDETDSGLDI
Sbjct: 119 EFMKLAKEVSKQVDLDPAFLKRGVNEGFSGGEKKRNEIMQALLLQPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ + GVNALR+ DR+ L+ITHYQRLL++I PD +HVL +GKIIK+G   +AL+LE 
Sbjct: 179 DALKVVSDGVNALRAPDRAILMITHYQRLLDHIVPDYVHVLADGKIIKSGGRELALELEA 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|226314443|ref|YP_002774339.1| ABC transporter ATP-binding protein SufC [Brevibacillus brevis NBRC
           100599]
 gi|226097393|dbj|BAH45835.1| ABC transporter ATP-binding protein SufC [Brevibacillus brevis NBRC
           100599]
          Length = 262

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 175/248 (70%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L+IKNLRAKI   D EI++GLNL+++  EV AIMGPNG+GKSTL+  L GH  YE+T G+
Sbjct: 7   LQIKNLRAKI--EDKEILKGLNLEIKGGEVHAIMGPNGTGKSTLASTLMGHPKYEVTDGE 64

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L   E +L+ ++ ERA  G+FLA QYP EI G+    FL+ A+N +R   NE  L+   
Sbjct: 65  VLINDEDLLEMAVDERARAGLFLAMQYPSEISGVTNSDFLRSAINARRGEGNEISLM--K 122

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R++ K    L ++     R LN GFSGGEKK  EILQM LLEP++CILDE DSGLDID
Sbjct: 123 FIREMDKKMNTLEMDESFSHRYLNEGFSGGEKKRNEILQMMLLEPAICILDEIDSGLDID 182

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALKI A GVN +RS DR FLIITHYQRLLNY+KPD +HV+  G+I+K+G   +A  LE  
Sbjct: 183 ALKIVANGVNEMRSADRGFLIITHYQRLLNYVKPDFVHVMMQGRIVKSGGPELAERLEAE 242

Query: 242 GYAELIKE 249
           GY + IKE
Sbjct: 243 GY-DWIKE 249


>gi|332885279|gb|EGK05530.1| FeS assembly ATPase SufC [Dysgonomonas mossii DSM 22836]
          Length = 253

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 180/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IKNL A +     EI+RGL+L V   E+ AIMGPNG+GKSTL+ +L G+ ++E+T G
Sbjct: 4   LLNIKNLHANV--EGKEILRGLDLVVNEGEIHAIMGPNGAGKSTLASVLVGNPNFEVTEG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ ++   +L+    +RA +G+FL+FQYPVEIPG+ M  F++ +LNE RK R E+ +   
Sbjct: 62  EVTFREHDLLEMDPEDRAREGLFLSFQYPVEIPGVSMTNFMRASLNEIRKHRREEPISAS 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    + ++ D+  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 122 DFLKMMREKRQLVELDKDLAGRSVNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS+D + ++ITHYQRLL+YIKPD +HVL+ G+I+K+    +AL+LEE
Sbjct: 182 DALRIVAAGVNKLRSKDNATVVITHYQRLLDYIKPDYVHVLYKGRIVKSAGAELALELEE 241

Query: 241 NGYAELIKE 249
            GY  +IK+
Sbjct: 242 RGYDWIIKD 250


>gi|56752364|ref|YP_173065.1| ABC transporter ATP-binding protein [Synechococcus elongatus PCC
           6301]
 gi|81300545|ref|YP_400753.1| Iron-regulated ABC transporter ATPase subunit SufC [Synechococcus
           elongatus PCC 7942]
 gi|56687323|dbj|BAD80545.1| ABC transporter ATP-binding protein [Synechococcus elongatus PCC
           6301]
 gi|81169426|gb|ABB57766.1| Iron-regulated ABC transporter ATPase subunit SufC [Synechococcus
           elongatus PCC 7942]
          Length = 261

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 174/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L I++L A++   D  I++G+NL+V   E+ AIMG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   ILSIQDLTAEV--EDAAILKGVNLEVRAGEIHAIMGRNGSGKSTLSKVLAGHPAYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I YKG+ +L     ER+  G+FLAFQYP+EIPG+  + FL++A+N +RKA  ++EL   
Sbjct: 67  SITYKGQDLLALEPEERSQAGVFLAFQYPLEIPGVSNLDFLRVAVNARRKAAGQEELDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V      + +N D L R +N GFSGGEKK  EILQM LLEPSL ILDETDSGLDI
Sbjct: 127 DFQELVEARLDVVKMNPDFLGRGVNEGFSGGEKKRNEILQMALLEPSLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVN L + D + ++ITHYQRLL+YIKPD +HV+  G+II+TG   +AL+LEE
Sbjct: 187 DALRIVSDGVNQLTNADNATILITHYQRLLDYIKPDFVHVMAEGRIIRTGGPELALELEE 246

Query: 241 NGY 243
            GY
Sbjct: 247 TGY 249


>gi|89900647|ref|YP_523118.1| FeS assembly ATPase SufC [Rhodoferax ferrireducens T118]
 gi|89345384|gb|ABD69587.1| FeS assembly ATPase SufC [Rhodoferax ferrireducens T118]
          Length = 263

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+++L A +  TD  I++GLN  V+  EV AIMGPNGSGKST + +L+GH  Y++T G
Sbjct: 9   LLEVRDLCASVNGTD--ILKGLNFTVKRGEVHAIMGPNGSGKSTFAKVLAGHAAYQVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L++G+++L+ S   RA  G+FLAFQYP+EIPG+   QFL++A N  +  R   EL   
Sbjct: 67  EVLFEGKNLLELSPEMRARAGVFLAFQYPIEIPGVGNSQFLRLAYNTVQAERGHDELDPL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR+    L ++ + L+R +N GFSGGEKK  EILQM LLEPSL ILDETDSGLDI
Sbjct: 127 EFDDLVREKMKLLEMSPEFLERSVNEGFSGGEKKRNEILQMALLEPSLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ +QGVN L S+D + +++THYQRLLNYI PD +HV+  G+II+TG   +AL+LEE
Sbjct: 187 DALRVVSQGVNHLASKDNAIVLVTHYQRLLNYIVPDYVHVMSAGRIIRTGGKELALELEE 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|284050864|ref|ZP_06381074.1| FeS assembly ATPase SufC [Arthrospira platensis str. Paraca]
 gi|291567131|dbj|BAI89403.1| FeS assembly ATPase SufC [Arthrospira platensis NIES-39]
          Length = 260

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 178/248 (71%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A I      I++GLNL+V+  E+ AIMG NGSGKST S +L+GH  YE+T G
Sbjct: 9   ILSVKNLTATI--DGNPILKGLNLEVKAGEIHAIMGQNGSGKSTFSKILAGHPAYEVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++L+    ERA  GIFLAFQYP+EIPG+  + FL++A N QRK R   EL + 
Sbjct: 67  EVTFLGQNLLELEADERALIGIFLAFQYPIEIPGVSNLDFLRVAYNSQRKHRGLDELDVF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +++    + +  + L+R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFEDLIQEKLEVVKMRPEFLERSVNQGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L + + + L+ITHYQRLL+YI PD +HV+ +G+IIKTG   +AL+LEE
Sbjct: 187 DALKIVANGVNQLANAENAMLVITHYQRLLDYIVPDYVHVMADGRIIKTGAKELALELEE 246

Query: 241 NGYAELIK 248
            GY ++I+
Sbjct: 247 QGYDDIIE 254


>gi|258623335|ref|ZP_05718340.1| Probable ATP-dependent transporter sufC [Vibrio mimicus VM573]
 gi|258584395|gb|EEW09139.1| Probable ATP-dependent transporter sufC [Vibrio mimicus VM573]
          Length = 248

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 177/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL+A +    + I++G+NL V P EV AIMGPNGSGKSTL+  ++G + YE+T G
Sbjct: 1   MLDIQNLQASV--EGSPILKGINLVVRPGEVHAIMGPNGSGKSTLASTIAGKEAYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  G+ + +    ERA +G+FLAFQYPVEIPG+    FL+ ALN  R+ R   EL   
Sbjct: 59  SILLNGQDLTELEPEERAGEGVFLAFQYPVEIPGVSNRLFLQTALNGIRQYRGLPELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +    L + +D+L R +N GFSGGEKK  +++QM +LEP LCILDETDSGLDI
Sbjct: 119 EFEDHLEQKAQLLKMPLDLLNRSVNEGFSGGEKKRNDMVQMAVLEPQLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++GVNALR   R+F+++THYQR+L+YIKPD +HVL+ G+I+K+GD+++A  LE+
Sbjct: 179 DALKAVSEGVNALRDGKRAFIVVTHYQRILDYIKPDFVHVLYQGRIVKSGDHTLAKRLED 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 EGYG 242


>gi|291514465|emb|CBK63675.1| Iron-regulated ABC transporter ATPase subunit SufC [Alistipes
           shahii WAL 8301]
          Length = 250

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML++KNL A +     EI+RG++L+V+  EV AIMGPNGSGKSTL+ +L+G++ + +T G
Sbjct: 1   MLKVKNLHASV--DGKEILRGIDLEVKAGEVHAIMGPNGSGKSTLASVLAGNEKFTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G  +L   I +RA  G+FL FQYPVEIPG+ M  F+K+A+NEQRK R E+ L   
Sbjct: 59  SAEFLGRDLLSMPIEDRARLGLFLGFQYPVEIPGVTMANFMKLAVNEQRKFRGEEPLSAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+ +A + ++  +  R +N GFSGGEKK  EI QM +L+P L ILDETDSGLDI
Sbjct: 119 EFLKLMREKSAVVELSSKLTSRAVNEGFSGGEKKKNEIFQMAMLDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GV  L   D + ++ITHYQRLL+YI PD +HVL+ G+II +GD S+AL LE+
Sbjct: 179 DALRIVATGVTKLHRADNATVVITHYQRLLDYIVPDVVHVLYKGRIIHSGDKSLALKLEK 238

Query: 241 NGYAELIKE 249
            GY  LI E
Sbjct: 239 EGYDWLINE 247


>gi|262196469|ref|YP_003267678.1| FeS assembly ATPase SufC [Haliangium ochraceum DSM 14365]
 gi|262079816|gb|ACY15785.1| FeS assembly ATPase SufC [Haliangium ochraceum DSM 14365]
          Length = 257

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/246 (53%), Positives = 176/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I++L  ++      I++GL+L V   EV AIMGPNGSGKSTLSY+L+G + YEIT G
Sbjct: 6   MLRIEDLHVEV--EGKPILKGLSLTVNEGEVHAIMGPNGSGKSTLSYVLAGREGYEITGG 63

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            ++Y+G+ +LD SI  RA  G+FLAFQYPVEIPG+  + FLK A+N  RK R E EL   
Sbjct: 64  RVVYQGQDLLDMSIESRARAGVFLAFQYPVEIPGVSNLYFLKAAVNAIRKERGEAELDAF 123

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R+    + ++  + KR +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 124 EFMKLSRERAKLVELSDALSKRAVNQGFSGGEKKRNEIFQMAMLEPRLAILDETDSGLDI 183

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVNALRS +RS L+ITHYQRLL +I PD +HVL +G+++++G   +A  LE 
Sbjct: 184 DALRIVSSGVNALRSPERSMLVITHYQRLLLHIVPDKVHVLMDGRVVRSGGPELAESLEA 243

Query: 241 NGYAEL 246
           +GY ++
Sbjct: 244 SGYEDI 249


>gi|42521819|ref|NP_967199.1| Iron-regulated ABC transporter ATPase subunit SufC [Bdellovibrio
           bacteriovorus HD100]
 gi|39574349|emb|CAE77853.1| Iron-regulated ABC transporter ATPase subunit SufC [Bdellovibrio
           bacteriovorus HD100]
          Length = 252

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 177/247 (71%), Gaps = 6/247 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL A++   + EI++GLNL V+P EV AIMGPNGSGKSTLS +L+GH  YE+T+G
Sbjct: 3   LLEIKNLHARV--EEKEILKGLNLTVKPGEVHAIMGPNGSGKSTLSKVLAGHPAYEVTSG 60

Query: 61  DILYKGE----SILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
           ++ Y+      ++LD    ERA +GIFLAFQYP+E+PG+    FL  A N   + +  + 
Sbjct: 61  EVKYEVNFNMTNLLDLEPDERAKEGIFLAFQYPIEVPGVSNFTFLHTAFNSVLQHQGSEP 120

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
           +   +F   + +    + +  + L RP+N GFSGGEKK  EILQM +L P L +LDETDS
Sbjct: 121 MPEGEFREFLYQKMKLVSMKPEYLDRPVNTGFSGGEKKKNEILQMAVLSPRLALLDETDS 180

Query: 177 GLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIAL 236
           GLDIDAL++ ++GVN LR +D + +++THYQRLL+YIKPD +HVL NGKII+TGD S+AL
Sbjct: 181 GLDIDALRVVSEGVNKLRRKDNAIILVTHYQRLLDYIKPDFVHVLANGKIIETGDSSLAL 240

Query: 237 DLEENGY 243
            LEE GY
Sbjct: 241 KLEEKGY 247


>gi|327404073|ref|YP_004344911.1| Iron-regulated ABC transporter ATPase subunit SufC [Fluviicola
           taffensis DSM 16823]
 gi|327319581|gb|AEA44073.1| Iron-regulated ABC transporter ATPase subunit SufC [Fluviicola
           taffensis DSM 16823]
          Length = 250

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A I     EI++GLNL+V+  EV AIMGPNG+GKSTL+ +L+G ++YEIT G
Sbjct: 1   MLKINNLHASI--DGKEILKGLNLEVKAGEVHAIMGPNGAGKSTLANILAGREEYEITEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G  +L+ +  +RA +G+FLAFQYPVEIPG+  + FL+ ALNE ++ R E ++   
Sbjct: 59  SVDFDGTDLLEMATEDRAREGLFLAFQYPVEIPGVSNVNFLRTALNEIKEYRGEPQISAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V++ +A + ++  +  R +N GFSGGEKK  EI QM +L+P L ILDETDSGLDI
Sbjct: 119 DFMALVKEKSAIVELDAKLASRSVNEGFSGGEKKRNEIFQMAMLDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S   + ++ITHYQRLL+YI PD +HVL+NG+I+K+G   +AL+LEE
Sbjct: 179 DALRIVANGVNKLKSDKNATIVITHYQRLLDYIVPDFVHVLYNGQIVKSGPKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|313675022|ref|YP_004053018.1| iron-regulated ABC transporter atpase subunit sufc [Marivirga
           tractuosa DSM 4126]
 gi|312941720|gb|ADR20910.1| Iron-regulated ABC transporter ATPase subunit SufC [Marivirga
           tractuosa DSM 4126]
          Length = 251

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A I     EI++G+NL+V+P EV AIMGPNGSGKSTL+ +L+G +DY + +G
Sbjct: 1   MLSIKNLHASI--EGKEILKGINLEVKPGEVHAIMGPNGSGKSTLASVLAGREDYTVDSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I + G  +L+    ERA +G+FLAFQYP+EIPG+    F+K ALN+ R+ +  + L   
Sbjct: 59  EITFNGNDLLELEADERAKEGVFLAFQYPIEIPGVSTTNFMKTALNKIREHKGLEPLDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F  K+++    + I+  +L R LN GFSGGEKK  EI QM +LEP+L ILDETDSGLDI
Sbjct: 119 SFLAKMKEKMKLVEIDQALLSRSLNEGFSGGEKKRNEIFQMAMLEPTLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L++ D + +++THYQRLL+YI PD +HVL +GKI+KTG   +A  LEE
Sbjct: 179 DALRIVANGVNKLKNDDNATVVVTHYQRLLDYIVPDFVHVLFDGKIVKTGGKELAHKLEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|319957061|ref|YP_004168324.1| iron-regulated ABC transporter atpase subunit sufc [Nitratifractor
           salsuginis DSM 16511]
 gi|319419465|gb|ADV46575.1| Iron-regulated ABC transporter ATPase subunit SufC [Nitratifractor
           salsuginis DSM 16511]
          Length = 251

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 177/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ++ I+NL A+I   + EI++GLNL++E  +V AIMGPNG+GKSTLS  ++GH D E+T G
Sbjct: 5   VMNIENLHARI--GEKEILKGLNLQMEEGKVHAIMGPNGAGKSTLSKAITGHYDVEVTDG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I YKG+ I+DW   +RA +GIFL+FQ PVEIPG+    FL+ A+N +RK     EL   
Sbjct: 63  AINYKGQDIVDWEPEDRALEGIFLSFQNPVEIPGVNNAYFLRTAVNAKRKHLGLPELNAA 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R+++++  ELG+  +M+ R LN GFSGGEKK  EILQM +L+P L ILDE DSGLDI
Sbjct: 123 EFLREMKRLVTELGMKPEMINRSLNEGFSGGEKKRNEILQMMMLQPDLIILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  ++G+N ++   RSFL+ITHY R+L+YI+PD IHVL +G+I+KT    +  +LEE
Sbjct: 183 DALRAVSEGINKMKDGKRSFLVITHYSRILDYIEPDYIHVLKDGRIVKTAGPELVAELEE 242

Query: 241 NGYA 244
            GY 
Sbjct: 243 KGYG 246


>gi|307544375|ref|YP_003896854.1| ABC transporter ATP-binding protein [Halomonas elongata DSM 2581]
 gi|307216399|emb|CBV41669.1| ABC-type transport system ATP-binding protein [Halomonas elongata
           DSM 2581]
          Length = 250

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 178/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+K+L   +    +EI++GL+L +   EV A+MGPNG+GKSTLS +++G   YE+T+G
Sbjct: 1   MLEVKDLHVTV--EGSEILKGLSLTIGAGEVHALMGPNGAGKSTLSAVIAGKDGYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I ++G  +L+  I ERA  G+ L FQYPVEIPG+  +  LK ALN QR AR E E+  P
Sbjct: 59  SITFEGRDVLEMEIEERAQAGLLLGFQYPVEIPGVKNIYLLKAALNAQRAARGEDEIPAP 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++    + ++   L+R +N GFSGGEKK  EILQM +L+P L +LDE DSGLDI
Sbjct: 119 EFMKLVKEKVGFMKMDTSFLQRAVNEGFSGGEKKRNEILQMLVLQPKLAMLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K+ A GVN+LR +D+  L++THYQRLL+YI PD +HVL +G+I+K+GD  +A +LE 
Sbjct: 179 DAMKVVADGVNSLRGEDKGILLVTHYQRLLDYIVPDHVHVLVDGRIVKSGDADLARELES 238

Query: 241 NGYAELIKE 249
            GY  ++++
Sbjct: 239 RGYDWVVED 247


>gi|11465707|ref|NP_053851.1| sulfate ABC transporter protein [Porphyra purpurea]
 gi|1703045|sp|P51241|ABCX_PORPU RecName: Full=Probable ATP-dependent transporter ycf16
 gi|1276707|gb|AAC08127.1| hypothetical chloroplast ORF 16 [Porphyra purpurea]
          Length = 251

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 175/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L A +   D  I++G+NL ++P E+ AIMGPNGSGKSTLS +++GH  Y +  G
Sbjct: 5   ILEIKDLHASV--NDVPILKGVNLSIKPGEIHAIMGPNGSGKSTLSKVIAGHPAYSLLNG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ G SIL     ERA  GIFLAFQYPVEIPG+    FL+IALN +RK R   EL   
Sbjct: 63  DILFYGRSILKMEPDERARAGIFLAFQYPVEIPGVSNADFLRIALNARRKFRELPELSPL 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + + +    +G+    L R +N GFSGGEKK  EILQM LLE +L ILDETDSGLDI
Sbjct: 123 EFFQLITEKINLVGMKESFLSRNVNEGFSGGEKKRNEILQMALLESNLSILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI AQG+N L +   S ++ITHYQRLL+YI P+ +H++ +GKI+KTG+ ++A DLE+
Sbjct: 183 DALKIIAQGINTLATSTNSIVLITHYQRLLDYIIPNFVHIMSDGKIVKTGNVNLAQDLEK 242

Query: 241 NGY 243
           +GY
Sbjct: 243 HGY 245


>gi|83815136|ref|YP_445510.1| FeS assembly ATPase SufC [Salinibacter ruber DSM 13855]
 gi|294507396|ref|YP_003571454.1| FeS assembly ATPase SufC [Salinibacter ruber M8]
 gi|83756530|gb|ABC44643.1| FeS assembly ATPase SufC [Salinibacter ruber DSM 13855]
 gi|294343724|emb|CBH24502.1| FeS assembly ATPase SufC [Salinibacter ruber M8]
          Length = 256

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 181/249 (72%), Gaps = 1/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI+NL   + D D  I++G++L ++  ++ AIMGPNGSGKSTL+ +L+G ++YE+  G
Sbjct: 3   LLEIENLHVGVEDEDIHILKGVDLTLDTGDLHAIMGPNGSGKSTLASVLAGREEYEVLEG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I Y G+ +L+    ERA +GIFLAFQYPVE+PG+ M  FLK A+N  R+AR E EL   
Sbjct: 63  SIRYDGDDLLELEPEERAEEGIFLAFQYPVELPGVSMTNFLKEAVNSVREARGEDELSST 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +++R+    LG++ D+ KR +N GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 123 EFLQQMRERADMLGLDADLTKRSVNEGFSGGEKKRNEIFQLAMLEPRLAILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVN LR  DR FL+ITHY+R+L YI PD IHV+ +G+I ++GD  +A  LEE
Sbjct: 183 DALQSVANGVNKLRDGDRGFLVITHYERILQYIVPDRIHVMMDGQIARSGDKDLAETLEE 242

Query: 241 NGYAELIKE 249
           +GY E I+E
Sbjct: 243 HGY-EWIRE 250


>gi|188994222|ref|YP_001928474.1| putative ABC transporter ATP-binding protein [Porphyromonas
           gingivalis ATCC 33277]
 gi|188593902|dbj|BAG32877.1| putative ABC transporter ATP-binding protein [Porphyromonas
           gingivalis ATCC 33277]
          Length = 250

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +     EI++G++L++   E+ AIMGPNGSGKSTLS +L GH  +E+T G
Sbjct: 1   MLKIKNLHATV--QGKEILKGIDLEINAGEIHAIMGPNGSGKSTLSSVLVGHPSFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G  +L+    ERA  G+FL+FQYPVEIPG+ M+ F++ A+NE RKA   + +   
Sbjct: 59  EVTFNGIDLLELEPEERAHLGLFLSFQYPVEIPGVSMVNFMRAAVNEHRKAIGAEPVSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DFLKMMREKRAIVELDNKLASRSVNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS + + ++ITHYQRLL YIKPD +HVL+ G+I+K+G   +AL LEE
Sbjct: 179 DALRIVAGGVNRLRSPENAAIVITHYQRLLEYIKPDFVHVLYKGRIVKSGGAELALTLEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|224823959|ref|ZP_03697067.1| FeS assembly ATPase SufC [Lutiella nitroferrum 2002]
 gi|224603378|gb|EEG09553.1| FeS assembly ATPase SufC [Lutiella nitroferrum 2002]
          Length = 255

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 172/244 (70%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL   I   D  I+RGL+L V   EV AIMGPNGSGKSTL+++L+G + Y +TAG
Sbjct: 1   MLEIRNLHVSI--NDKPILRGLDLTVRAGEVHAIMGPNGSGKSTLAHVLAGREGYTVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ Y G ++L+ S   RA +GIFLAFQYPVEIPG+  +  LK A+N  R  R E EL   
Sbjct: 59  EVRYLGRNLLELSPELRAREGIFLAFQYPVEIPGVANIYLLKAAVNALRLHRGEPELDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V+     +G++  +L R +N GFSGGEKK  EILQM +LEP L +LDETDSGLDI
Sbjct: 119 DFLALVKDKLRLMGMDTGLLYRSVNEGFSGGEKKRNEILQMAVLEPRLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNA+RS +R+ +++THYQRLLNYI PD +HVL  G+I  +G   +AL+LE 
Sbjct: 179 DALKIVAGGVNAMRSPERAMVLVTHYQRLLNYIVPDQVHVLAQGRIALSGGRELALELEN 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 RGYG 242


>gi|313157986|gb|EFR57392.1| FeS assembly ATPase SufC [Alistipes sp. HGB5]
          Length = 250

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 178/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +KNL A +     EI+RG++L+V+  EV A+MGPNGSGKSTL+ +L+G++ + +T G
Sbjct: 1   MLSVKNLHASV--DGKEILRGIDLEVKAGEVHAVMGPNGSGKSTLAAVLAGNEKFTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              + G  +L+  I +RA  G+FL FQYPVEIPG+ M  F+K+A+NEQRK R E+ L   
Sbjct: 59  SATFLGRDLLEMPIEDRARLGLFLGFQYPVEIPGVTMANFMKLAVNEQRKFRGEEPLTAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+ +A + ++  +  R +N GFSGGEKK  EI QM +L+P L ILDETDSGLDI
Sbjct: 119 EFLKLMREKSAVVELDSKLTSRAVNEGFSGGEKKKNEIFQMAMLDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GV  L + + + ++ITHYQRLL+YI PD +HVL+ G+II TGD ++AL LE+
Sbjct: 179 DALRIVATGVTKLHTPENATVVITHYQRLLDYIVPDVVHVLYRGRIIHTGDKTLALKLEK 238

Query: 241 NGYAELIKE 249
            GY  LI +
Sbjct: 239 EGYDWLIND 247


>gi|85709854|ref|ZP_01040919.1| ABC transporter ATP-binding protein [Erythrobacter sp. NAP1]
 gi|85688564|gb|EAQ28568.1| ABC transporter ATP-binding protein [Erythrobacter sp. NAP1]
          Length = 251

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 3/250 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A++      I++GLNL+V+  EV AIMGPNG+GKSTL+++L G   Y++TAG
Sbjct: 1   MLTINNLHAEV--DGKAILKGLNLEVQAGEVHAIMGPNGAGKSTLAHVLGGKPGYDVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G  + D    ERA+ G+FL FQYPVEIPG+  +QFL+ ALN QRK R E+ L   
Sbjct: 59  SVTFRGAQLFDLDPHERAATGLFLGFQYPVEIPGVSNVQFLREALNAQRKYRGEEPLSGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  ++    L ++M+MLKR +N+GFSGGEKK AE++QM +L+P+  +LDETDSGLDI
Sbjct: 119 EFLKLAKEKAGLLKMDMEMLKRQVNVGFSGGEKKRAEMVQMGILDPAFAVLDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL++  +G+N+ +R+ D+  L+ITHYQRLL+ +KPD + VL +G+I++TG   +AL LE
Sbjct: 179 DALRVVGEGINSIMRAPDKGVLLITHYQRLLDVVKPDRVSVLADGRIVETGGPELALRLE 238

Query: 240 ENGYAELIKE 249
             GY  ++ E
Sbjct: 239 SEGYDAIMAE 248


>gi|146329287|ref|YP_001209735.1| FeS assembly ATPase SufC [Dichelobacter nodosus VCS1703A]
 gi|146232757|gb|ABQ13735.1| FeS assembly ATPase SufC [Dichelobacter nodosus VCS1703A]
          Length = 252

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 129/245 (52%), Positives = 173/245 (70%), Gaps = 2/245 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL   +      I+ G+NL +   EV AIMGPNGSGKSTL+ +++G+ DY++TAG
Sbjct: 1   MLRIENLHVSV--EQKSILNGVNLHIPAGEVHAIMGPNGSGKSTLANVIAGYPDYQVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +K + +L     ERA +G+FLAFQYPVEIPG+  + FLK ALN +RK  N   L   
Sbjct: 59  NVWFKDQDLLALDPEERAREGVFLAFQYPVEIPGVSTLYFLKTALNAKRKHHNLPPLDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + V +   ++ +  D LKR +N+GFSGGEKK  E+LQM +LEP L +LDETDSGLDI
Sbjct: 119 DFHQFVMERLQQIKMGEDFLKRAVNVGFSGGEKKRNELLQMSVLEPDLAVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN L    RSFL+ITHYQRLL YI PD +HVL +GKI+++G   +AL+LE 
Sbjct: 179 DALRVVADGVNQLMDGKRSFLVITHYQRLLEYIVPDVVHVLVDGKIVQSGSKELALELEA 238

Query: 241 NGYAE 245
           +GY +
Sbjct: 239 SGYQD 243


>gi|326801401|ref|YP_004319220.1| FeS assembly ATPase SufC [Sphingobacterium sp. 21]
 gi|326552165|gb|ADZ80550.1| FeS assembly ATPase SufC [Sphingobacterium sp. 21]
          Length = 256

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 176/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL+A +   D EI++GLNL+V+  EV AIMGPNGSGKSTL+ +L+G + YE+T G
Sbjct: 1   MLSIKNLQASV--DDKEILKGLNLEVKAGEVHAIMGPNGSGKSTLASVLAGKEAYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++    + +L+ S  +RA +G+FLAFQYPVEIPG+  + FLK A+NE R  +    +   
Sbjct: 59  EVRLDNKDLLELSPEDRAREGLFLAFQYPVEIPGVSNINFLKTAVNEIRAYKGLAPIEAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++    +  +  +  R LN GFSGGEKK  EI Q+ +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLVKEKQKLVEFDAKLANRSLNEGFSGGEKKRNEIFQLAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN LRS++ +F++ITHYQRLL+YI PD +HVL+ GKI+K+G   +AL+LEE
Sbjct: 179 DALRIVANGVNHLRSENNAFIVITHYQRLLDYIVPDFVHVLYKGKIVKSGTKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|150003925|ref|YP_001298669.1| ABC transporter ATP-binding protein [Bacteroides vulgatus ATCC
           8482]
 gi|254880834|ref|ZP_05253544.1| ABC transporter ATP-binding protein [Bacteroides sp. 4_3_47FAA]
 gi|294775081|ref|ZP_06740610.1| FeS assembly ATPase SufC [Bacteroides vulgatus PC510]
 gi|319639844|ref|ZP_07994573.1| ABC transporter ATP-binding protein [Bacteroides sp. 3_1_40A]
 gi|149932349|gb|ABR39047.1| ABC transporter ATP-binding protein [Bacteroides vulgatus ATCC
           8482]
 gi|254833627|gb|EET13936.1| ABC transporter ATP-binding protein [Bacteroides sp. 4_3_47FAA]
 gi|294451125|gb|EFG19596.1| FeS assembly ATPase SufC [Bacteroides vulgatus PC510]
 gi|317388508|gb|EFV69358.1| ABC transporter ATP-binding protein [Bacteroides sp. 3_1_40A]
          Length = 250

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A +     EI++G+NL ++  EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASV--NGKEILKGINLSIKKGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+ +L  S  +R+ +G+FL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFEGKDLLALSPEDRSHEGLFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSCIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|262165767|ref|ZP_06033504.1| iron-sulfur cluster assembly ATPase protein SufC [Vibrio mimicus
           VM223]
 gi|262025483|gb|EEY44151.1| iron-sulfur cluster assembly ATPase protein SufC [Vibrio mimicus
           VM223]
          Length = 248

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 177/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL+A +    + I++G+NL V P EV AIMGPNGSGKSTL+  ++G + YE+T G
Sbjct: 1   MLDIQNLQASV--EGSPILKGINLVVRPGEVHAIMGPNGSGKSTLASTIAGKEAYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  G+ + +    ERA +G+FLAFQYPVEIPG+    FL+ ALN  R+ R   EL   
Sbjct: 59  SILLNGQDLTELEPEERAGEGVFLAFQYPVEIPGVSNRLFLQTALNGIRQYRGLPELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +    L + +D+L R +N GFSGGEKK  +++QM +LEP LCILDETDSGLDI
Sbjct: 119 EFEDHLEQKAQLLKMPLDLLNRSVNEGFSGGEKKRNDMVQMAVLEPQLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++GVNALR   R+F+++THYQR+L+YIKPD +HVL+ G+I+++GD+++A  LE+
Sbjct: 179 DALKAVSEGVNALRDGKRAFIVVTHYQRILDYIKPDFVHVLYQGRIVQSGDHTLAKRLED 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 EGYG 242


>gi|258627395|ref|ZP_05722177.1| Probable ATP-dependent transporter sufC [Vibrio mimicus VM603]
 gi|258580318|gb|EEW05285.1| Probable ATP-dependent transporter sufC [Vibrio mimicus VM603]
          Length = 248

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 176/244 (72%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL+A +    + I++G+NL V P EV AIMGPNGSGKSTL+  ++G + YE+T G
Sbjct: 1   MLDIQNLQASV--EGSPILKGINLVVRPGEVHAIMGPNGSGKSTLASTIAGKEAYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  G+ +      ERA +G+FLAFQYPVEIPG+    FL+ ALN  R+ R   EL   
Sbjct: 59  SILLNGQDLTVLEPEERAGEGVFLAFQYPVEIPGVSNRLFLQTALNGIRQYRGLPELDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +    L + +D+L R +N GFSGGEKK  +++QM +LEP LCILDETDSGLDI
Sbjct: 119 EFEEHLEQKAQLLKMPLDLLNRSVNEGFSGGEKKRNDMVQMAVLEPQLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++GVNALR   R+F+++THYQR+L+YIKPD +HVL+ G+I+K+GD+++A  LE+
Sbjct: 179 DALKAVSEGVNALRDGKRAFIVVTHYQRILDYIKPDFVHVLYQGRIVKSGDHTLAKRLED 238

Query: 241 NGYA 244
            GY 
Sbjct: 239 EGYG 242


>gi|228470955|ref|ZP_04055800.1| FeS assembly ATPase SufC [Porphyromonas uenonis 60-3]
 gi|228307352|gb|EEK16366.1| FeS assembly ATPase SufC [Porphyromonas uenonis 60-3]
          Length = 258

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 179/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +++IKNL A I   D EI++G+NL +   E  AIMGPNGSGKSTLS +L GH  + +T+G
Sbjct: 5   IIDIKNLHANI--GDKEILKGINLTIREGETHAIMGPNGSGKSTLSSVLVGHPAFTVTSG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ Y G+ +L    VERA  G+FL+FQYPVEIPG+ M+ F++ A+NE+RK + EK +   
Sbjct: 63  EVTYLGQDLLAMDAVERAHAGLFLSFQYPVEIPGVSMVNFMRSAVNERRKTQGEKPMPAG 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++    +G++  +LKR +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 123 EFLKMLKEKREVVGLDDRLLKRSVNEGFSGGEKKRNEIFQMAVLEPRLSILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVN L+  D + ++ITHYQRLL+YIKP  +H+L+ G+I+ +G   +AL LE+
Sbjct: 183 DALRAVAHGVNTLQRPDSACVVITHYQRLLDYIKPQFVHILYKGRIVTSGGPELALRLED 242

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 243 EGY-DWIKE 250


>gi|209516300|ref|ZP_03265157.1| FeS assembly ATPase SufC [Burkholderia sp. H160]
 gi|209503236|gb|EEA03235.1| FeS assembly ATPase SufC [Burkholderia sp. H160]
          Length = 259

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 172/246 (69%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI NL  ++      I+RG++L V+  EV AIMGPNGSGKSTL+++L+GH+ Y +T G
Sbjct: 1   MLEISNLSVEV--DGKPILRGVDLGVKAGEVHAIMGPNGSGKSTLAHVLAGHERYHVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y G  +   +  ERA +G+FLAFQYPVEIPG+  +  LK ALN QRK R + EL   
Sbjct: 59  SVRYAGHDLFSLAPEERAREGLFLAFQYPVEIPGVSNVYLLKAALNAQRKHRGDPELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   V++  A + ++  +L R +N GFSGGEKK  E+LQM +LEP L ILDETDSGLDI
Sbjct: 119 EFLELVKEKMALMQMDESLLYRAVNEGFSGGEKKRNEVLQMAVLEPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVN +RS DR+ +++THYQRLL Y+ PD +HVL  G I ++G   +AL+LE 
Sbjct: 179 DALRVVARGVNQMRSADRAIVLVTHYQRLLEYVAPDYVHVLSQGHIARSGTRELALELER 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|220908818|ref|YP_002484129.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 7425]
 gi|219865429|gb|ACL45768.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 7425]
          Length = 260

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 176/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +++L A +    T I++GLNL+++  E+ AIMGPNGSGKST S +L+GH  Y +T G
Sbjct: 9   ILSVRDLTADV--DGTPILKGLNLEIKAGEIHAIMGPNGSGKSTFSKVLAGHPAYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILYKG+++L+    ERA +G+FLAFQYP+EIPG+  + FL++A N +RK +  +EL   
Sbjct: 67  EILYKGQNLLELEPEERAREGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKHQGLEELDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+  + + ++   L R +N GFSGGEKK  EILQM LLEP+L ILDETDSGLDI
Sbjct: 127 DFDDLVRERLSVVKMDDRFLDRSVNEGFSGGEKKRNEILQMALLEPTLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L + D + L+ITHYQRLL+YI PD +HV+  GKII TG   +AL+LE 
Sbjct: 187 DALKIVANGVNQLTTADNAILLITHYQRLLDYIVPDFVHVMEAGKIILTGGKELALELEA 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|212550995|ref|YP_002309312.1| Fe-S cluster assembly protein SufC [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|212549233|dbj|BAG83901.1| Fe-S cluster assembly protein SufC [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 250

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 178/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+NL A +     EI++GLNL V   E+ AIMGPNGSGKSTLS +L G   Y+I  G
Sbjct: 1   MLVIENLHASV--NGKEILKGLNLNVHAGEIHAIMGPNGSGKSTLSAVLVGDPAYKIVEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            ++++GE++L     +R+  G+FL+FQYPVE+PG+  + F++ A+NE RK + E+ L   
Sbjct: 59  KVIFEGENLLKLLPEQRSHLGLFLSFQYPVELPGVSTINFIRTAVNEHRKHKGEETLSAG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  + + ++ +++ R +N GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 119 EFLKIMREKQSIVQLDKNLVNRSVNEGFSGGEKKRNEIFQMAMLNPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S D + +IITHYQRLL Y+ P+ +HVL+NG+IIKTGD S+AL+LE+
Sbjct: 179 DALRIVANGVNQLKSSDNAIIIITHYQRLLEYVHPNVVHVLYNGRIIKTGDASLALELEK 238

Query: 241 NGYAELIKE 249
            GY  L  E
Sbjct: 239 KGYDWLKNE 247


>gi|296282940|ref|ZP_06860938.1| ABC transporter, ATP-binding protein [Citromicrobium bathyomarinum
           JL354]
          Length = 254

 Score =  257 bits (657), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 176/247 (71%), Gaps = 4/247 (1%)

Query: 1   MLEIKNLRAKIVDTD---TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           ML+I NL A+I   +    +I+ GL L V   EV AIMGPNG+GKSTL+Y+L G   YE+
Sbjct: 1   MLQIDNLHAEIASENGGGKKILDGLTLTVNAGEVHAIMGPNGAGKSTLAYVLGGRPGYEV 60

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T G + ++G+ +L+    ERA+ G+FL FQYPVEIPG+  +QFL+ ALN QR+AR E+ +
Sbjct: 61  TEGSVTFRGQDLLEMDPHERAAAGLFLGFQYPVEIPGVSNIQFLREALNAQRRARGEEAM 120

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
              DF +  ++    L ++M+MLKR +N+GFSGGEKK AE++QM +L+P   +LDETDSG
Sbjct: 121 TGGDFLKLAKEKAGLLKLDMEMLKRNVNVGFSGGEKKRAEMVQMGILDPQFAVLDETDSG 180

Query: 178 LDIDALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIAL 236
           LDIDAL++   G+NA +R+ ++  L+ITHYQRLL+ ++PD + +L  G+I+KTG   +A 
Sbjct: 181 LDIDALRVVGDGINAIMRNPEKGVLLITHYQRLLDVVQPDRVSILSKGRIVKTGGPELAT 240

Query: 237 DLEENGY 243
           DLE  GY
Sbjct: 241 DLEREGY 247


>gi|229496572|ref|ZP_04390286.1| FeS assembly ATPase SufC [Porphyromonas endodontalis ATCC 35406]
 gi|229316469|gb|EEN82388.1| FeS assembly ATPase SufC [Porphyromonas endodontalis ATCC 35406]
          Length = 254

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 180/249 (72%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL A I     EI++G+NL +   E+ AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 5   LLEIKNLHASI--NGKEILKGINLSINEGEIHAIMGPNGSGKSTLSSVLVGNPAFEVTEG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ ++GE+IL  S  ER+ +G+FL+FQYPVEIPG+ M  F+K A+NE+RK++    +   
Sbjct: 63  EVTFRGENILPLSPEERSHRGLFLSFQYPVEIPGVSMANFMKAAINEKRKSQGLPPMPAA 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++    + +   +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 123 EFLKLMKEKREFVQLESKLSNRSVNEGFSGGEKKRNEIFQMAMLEPRLSILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L + + S ++ITHYQRLL+YIKP  +HVL+NG+I+K G   +AL+LE+
Sbjct: 183 DALRIVAEGVNKLHTPETSSIVITHYQRLLDYIKPQFVHVLYNGRIVKDGGSELALELEK 242

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 243 RGY-DWIKE 250


>gi|298372248|ref|ZP_06982238.1| FeS assembly ATPase SufC [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275152|gb|EFI16703.1| FeS assembly ATPase SufC [Bacteroidetes oral taxon 274 str. F0058]
          Length = 246

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +     EI++G+NL+V   E+ AIMGPNGSGKSTLS +L G+  +EIT G
Sbjct: 1   MLKIKNLHASV--NGKEILKGINLEVNKGEIHAIMGPNGSGKSTLSSVLVGNPAFEITEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+++L+ S  +RA +GIFL+FQYPVEIPG+ M  F++ A+N QRK +    +   
Sbjct: 59  SIEFMGKNLLELSPEDRACEGIFLSFQYPVEIPGVSMTNFMRAAINAQRKYKGLDPISPA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  + + ++  +  R +N GFSGGEKK  EI QM +L+P L ILDETDSGLDI
Sbjct: 119 DFLKLMREKQSLVELDNKLAGRSVNEGFSGGEKKRNEIFQMAMLDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN+L+S + + +IITHYQRLL YI PD +H+L+ G+I+KTGD S+AL+LE+
Sbjct: 179 DALRVVAHGVNSLKSPENASIIITHYQRLLQYIIPDYVHILYKGQIVKTGDKSLALELEQ 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|212692751|ref|ZP_03300879.1| hypothetical protein BACDOR_02249 [Bacteroides dorei DSM 17855]
 gi|237709447|ref|ZP_04539928.1| ABC transporter ATP-binding protein [Bacteroides sp. 9_1_42FAA]
 gi|237724953|ref|ZP_04555434.1| ABC transporter ATP-binding protein [Bacteroides sp. D4]
 gi|265754646|ref|ZP_06089698.1| FeS assembly ATPase SufC [Bacteroides sp. 3_1_33FAA]
 gi|212664687|gb|EEB25259.1| hypothetical protein BACDOR_02249 [Bacteroides dorei DSM 17855]
 gi|229436691|gb|EEO46768.1| ABC transporter ATP-binding protein [Bacteroides dorei 5_1_36/D4]
 gi|229456503|gb|EEO62224.1| ABC transporter ATP-binding protein [Bacteroides sp. 9_1_42FAA]
 gi|263234760|gb|EEZ20328.1| FeS assembly ATPase SufC [Bacteroides sp. 3_1_33FAA]
          Length = 250

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A +     EI++G+NL ++  EV AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEIKDLHASV--NGKEILKGINLSIKKGEVHAIMGPNGSGKSTLSSVLVGNPAFEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+ +L  +  +R+ +G+FL+FQYPVEIPG+ M+ F++ A+NEQRK +    L   
Sbjct: 59  SVTFEGKDLLALNPEDRSHEGLFLSFQYPVEIPGVSMVNFMRAAVNEQRKYKGLPALTAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHYQRLL+YIKPD +HVL+ G+I+KT    +AL+LEE
Sbjct: 179 DALRIVAEGVNKLKTPETSCIVITHYQRLLDYIKPDIVHVLYKGRIVKTAGPELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|297622514|ref|YP_003703948.1| FeS assembly ATPase SufC [Truepera radiovictrix DSM 17093]
 gi|297163694|gb|ADI13405.1| FeS assembly ATPase SufC [Truepera radiovictrix DSM 17093]
          Length = 250

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 176/242 (72%), Gaps = 4/242 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEI+NL A I      I+RG+NL V   EV A+MGPNGSGKSTLS +++G   YE+T GD
Sbjct: 4   LEIRNLHASI--GGEPILRGVNLIVPRGEVHALMGPNGSGKSTLSKVIAGDPTYEVTEGD 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  GESIL+    ERA KG++LAFQYPVE+PG+ M  FL++ALN +R   +E  ++  +
Sbjct: 62  VLVDGESILELEPDERARKGLYLAFQYPVEVPGVSMANFLRLALNARRAEGDEVGVM--E 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F  KV++   EL  + ++L+R LN GFSGGEKK +E+LQM +LEP   +LDETDSGLD+D
Sbjct: 120 FYNKVQRAVKELNWDENILERYLNEGFSGGEKKRSEVLQMLVLEPKYALLDETDSGLDVD 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ +QGVNA R  +   L+ITHYQRLLNYI PD +HV++ G+II+ G   +A++L++ 
Sbjct: 180 ALKVVSQGVNAARGPEFGALVITHYQRLLNYIVPDKVHVMYKGQIIREGPKELAVELDQR 239

Query: 242 GY 243
           GY
Sbjct: 240 GY 241


>gi|238854816|ref|ZP_04645146.1| FeS assembly ATPase SufC [Lactobacillus jensenii 269-3]
 gi|260664047|ref|ZP_05864900.1| FeS assembly ATPase SufC [Lactobacillus jensenii SJ-7A-US]
 gi|282933894|ref|ZP_06339242.1| FeS assembly ATPase SufC [Lactobacillus jensenii 208-1]
 gi|313472321|ref|ZP_07812813.1| FeS assembly ATPase SufC [Lactobacillus jensenii 1153]
 gi|238832606|gb|EEQ24913.1| FeS assembly ATPase SufC [Lactobacillus jensenii 269-3]
 gi|239529824|gb|EEQ68825.1| FeS assembly ATPase SufC [Lactobacillus jensenii 1153]
 gi|260561933|gb|EEX27902.1| FeS assembly ATPase SufC [Lactobacillus jensenii SJ-7A-US]
 gi|281301983|gb|EFA94237.1| FeS assembly ATPase SufC [Lactobacillus jensenii 208-1]
          Length = 263

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 174/252 (69%), Gaps = 8/252 (3%)

Query: 2   LEIKNLRAKIVDTDTE--IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA 59
           LE+K+L   + D + E  I++GLNLK+   E+ AIMGPNG+GKSTLS  + G   Y I +
Sbjct: 4   LEVKDLYVSVQDNNEEKQILKGLNLKMSTGEIHAIMGPNGTGKSTLSSTIMGDAKYHINS 63

Query: 60  GDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLI 119
           GDIL  GESILDW + +RA  G+FLA QYP EIPG+   +F+K A+N    AR  K   +
Sbjct: 64  GDILLNGESILDWPVDQRARAGLFLAMQYPAEIPGVTNAEFVKAAVN----ARRPKNDPV 119

Query: 120 P--DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           P  +F ++++     L + M+M  R LN GFSGGEKK  EI+QM +++PS  ILDE DSG
Sbjct: 120 PMGEFMKELQSTLKTLDMTMEMAGRYLNQGFSGGEKKRNEIMQMMMIKPSFAILDEIDSG 179

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN +R  +   L+ITHYQRLLNYI+PD +HV+  GKI+KTGD S+A  
Sbjct: 180 LDIDALKVVSRGVNLMRGDNFGALLITHYQRLLNYIEPDFVHVMMGGKIVKTGDASLAKR 239

Query: 238 LEENGYAELIKE 249
           LE  GYA+L  E
Sbjct: 240 LENEGYAKLRDE 251


>gi|256851340|ref|ZP_05556729.1| FeS assembly ATPase SufC [Lactobacillus jensenii 27-2-CHN]
 gi|260660765|ref|ZP_05861680.1| FeS assembly ATPase SufC [Lactobacillus jensenii 115-3-CHN]
 gi|282933214|ref|ZP_06338601.1| FeS assembly ATPase SufC [Lactobacillus jensenii 208-1]
 gi|297206211|ref|ZP_06923606.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus jensenii JV-V16]
 gi|256616402|gb|EEU21590.1| FeS assembly ATPase SufC [Lactobacillus jensenii 27-2-CHN]
 gi|260548487|gb|EEX24462.1| FeS assembly ATPase SufC [Lactobacillus jensenii 115-3-CHN]
 gi|281302718|gb|EFA94933.1| FeS assembly ATPase SufC [Lactobacillus jensenii 208-1]
 gi|297149337|gb|EFH29635.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus jensenii JV-V16]
          Length = 263

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 174/252 (69%), Gaps = 8/252 (3%)

Query: 2   LEIKNLRAKIVDTDTE--IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA 59
           LE+K+L   + D + E  I++GLNLK+   E+ AIMGPNG+GKSTLS  + G   Y I +
Sbjct: 4   LEVKDLYVSVQDNNEEKQILKGLNLKMSTGEIHAIMGPNGTGKSTLSSTIMGDAKYHINS 63

Query: 60  GDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLI 119
           GDIL  GESILDW + +RA  G+FLA QYP EIPG+   +F+K A+N    AR  K   +
Sbjct: 64  GDILLNGESILDWPVDQRARAGLFLAMQYPAEIPGVTNAEFVKAAVN----ARRPKNDPV 119

Query: 120 P--DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           P  +F ++++     L + M+M  R LN GFSGGEKK  EI+QM +++PS  ILDE DSG
Sbjct: 120 PMGEFMKELQTTLKTLDMTMEMAGRYLNQGFSGGEKKRNEIMQMMMIKPSFAILDEIDSG 179

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN +R  +   L+ITHYQRLLNYI+PD +HV+  GKI+KTGD S+A  
Sbjct: 180 LDIDALKVVSRGVNLMRGDNFGALLITHYQRLLNYIEPDFVHVMMGGKIVKTGDASLAKR 239

Query: 238 LEENGYAELIKE 249
           LE  GYA+L  E
Sbjct: 240 LENEGYAKLRDE 251


>gi|313204299|ref|YP_004042956.1| fes assembly ATPase sufc [Paludibacter propionicigenes WB4]
 gi|312443615|gb|ADQ79971.1| FeS assembly ATPase SufC [Paludibacter propionicigenes WB4]
          Length = 253

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 178/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIKNL A I     EII+GL+L V   E+ AIMGPNG+GKSTLS +L+G+  + +T G
Sbjct: 1   MLEIKNLHANI--NGKEIIKGLSLTVNAGEIHAIMGPNGAGKSTLSSVLTGNPAFTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+++L+ S  +R+ +GIFL+FQYPVEIPG+ M+ F++ A+NE RK +N   +   
Sbjct: 59  QVTFNGKNLLELSPEDRSREGIFLSFQYPVEIPGVSMVNFMRTAVNEHRKYKNLDPISAT 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R +R+    + ++  +  R +N GFSGGEKK  EI QM +L P L ILDETDSGLDI
Sbjct: 119 DFLRLMREKKELVEMDNKLANRSVNEGFSGGEKKRNEIFQMAMLNPLLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L+S D + ++ITHYQRLL+YI PD +HVL++G+I+K+G   +A +LEE
Sbjct: 179 DALRIVANGVNKLKSPDNASIVITHYQRLLDYIIPDFVHVLYDGRIVKSGGKELAYELEE 238

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 239 RGYDWIKKE 247


>gi|86608872|ref|YP_477634.1| FeS assembly ATPase SufC [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557414|gb|ABD02371.1| FeS assembly ATPase SufC [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 271

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 178/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +++L A+I    T I++GL+L++   E+ AIMGPNGSGKST S +L+GH DY +T G
Sbjct: 9   ILSVRDLSAEI--DGTPILKGLSLEIRAGEIHAIMGPNGSGKSTFSKILAGHPDYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILY G+++L+    ERA  GIFLAFQYP+E+PG+  + FL+ A N ++K R++ EL   
Sbjct: 67  EILYLGKNLLEMEPEERAWAGIFLAFQYPIEVPGVSNLDFLRAAYNARQKYRDQPELDAL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L+R +N GFSGGEKK  EILQM +LEP+L ILDETDSGLDI
Sbjct: 127 DFDDLVREKLDIVKMDPVFLERSVNEGFSGGEKKRNEILQMAVLEPTLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I AQG+N L   + + L+ITHYQRLL+Y+ PD +HV+  G+I+ +GD ++AL+LEE
Sbjct: 187 DALRIVAQGINRLAGSENAMLLITHYQRLLDYVTPDYVHVMEGGRIVISGDKTLALELEE 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|333029419|ref|ZP_08457480.1| FeS assembly ATPase SufC [Bacteroides coprosuis DSM 18011]
 gi|332740016|gb|EGJ70498.1| FeS assembly ATPase SufC [Bacteroides coprosuis DSM 18011]
          Length = 250

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 177/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A I     EI++G+NL +   E  AIMGPNGSGKSTL  +L G+ +YEIT G
Sbjct: 1   MLKIKNLHASI--NGNEILKGINLSINRGETHAIMGPNGSGKSTLGNVLIGNPNYEITKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y  + +L     ERA +G+FL+FQYPVEIPG+ M +FL+ A+N QR+ R    +   
Sbjct: 59  TVEYLDKDLLQLEPEERAGEGLFLSFQYPVEIPGVSMTRFLRSAMNGQREYRGLPHVSAE 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +++    + ++ ++  R +N GFSGGEKK  EI QM LLEP+L ILDETDSGLDI
Sbjct: 119 DFLKIMKEKRDLVKLDGNLTSRAVNEGFSGGEKKRNEIFQMALLEPTLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN  +S +RSF+IITHYQRLL+YIKPD +HVL+ GKI+K+G   +AL LEE
Sbjct: 179 DALRIVANGVNQYKSPERSFIIITHYQRLLDYIKPDYVHVLYGGKIVKSGGPELALLLEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|119509159|ref|ZP_01628310.1| FeS assembly ATPase SufC [Nodularia spumigena CCY9414]
 gi|119466325|gb|EAW47211.1| FeS assembly ATPase SufC [Nodularia spumigena CCY9414]
          Length = 260

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 174/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +K+L A +    T I++GLNL+V   EV AIMGPNGSGKST S +L+GH  YE+T G
Sbjct: 9   VLSVKDLTASV--DGTPILKGLNLEVRSGEVHAIMGPNGSGKSTFSKVLAGHPAYEVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G+++L+    ERA  G+FLAFQYP+EIPG+  + FL++A N +RKA+  +EL   
Sbjct: 67  EVIFQGQNLLEMEPEERARSGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKAQGLEELDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    + +N   L R LN GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFDDLIEEKLDVVKMNPAFLNRSLNEGFSGGEKKRNEILQMALLEPKLGILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S + + ++ITHYQRLLNYI PD +HV+ +G+I+  G   +AL+LEE
Sbjct: 187 DALRIVADGVNQLASPENATIMITHYQRLLNYIVPDFVHVMAHGRILMCGGKDLALELEE 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|258544529|ref|ZP_05704763.1| FeS assembly ATPase SufC [Cardiobacterium hominis ATCC 15826]
 gi|258520264|gb|EEV89123.1| FeS assembly ATPase SufC [Cardiobacterium hominis ATCC 15826]
          Length = 256

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 173/249 (69%), Gaps = 1/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI NL     +   +I+ G+NL++   EV AIMGPNGSGKSTL+ +++G + Y IT G
Sbjct: 1   MLEIHNLHVA-TEEGKKILNGVNLRIGAGEVHAIMGPNGSGKSTLANVIAGREGYVITEG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I Y G+ +L+    ERA  GIFLAFQYPVEIPG+  + FLK A+N +R    + E+   
Sbjct: 60  SISYDGKDLLEMEPDERACAGIFLAFQYPVEIPGVSNLYFLKAAVNAKRAYEGKGEMDAM 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   ++     + ++   L R +N+GFSGGEKK  EI+QM +LEP L +LDETDSGLDI
Sbjct: 120 EFYELLQNRMKSVKMHDSFLSRAVNVGFSGGEKKRNEIMQMAVLEPRLAVLDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ + GVNALR   RSF++ITHYQRLL YI PD +HVL NG+I+++GD ++AL LEE
Sbjct: 180 DALRVVSDGVNALRDAKRSFMVITHYQRLLEYIVPDYVHVLVNGEIVESGDKTLALQLEE 239

Query: 241 NGYAELIKE 249
            GYA+   E
Sbjct: 240 KGYADFRGE 248


>gi|149369534|ref|ZP_01889386.1| iron-regulated ABC transporter, ATP-binding protein [unidentified
           eubacterium SCB49]
 gi|149356961|gb|EDM45516.1| iron-regulated ABC transporter, ATP-binding protein [unidentified
           eubacterium SCB49]
          Length = 250

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 177/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKN+ A +   D  I+ G+NL+V+  EV AIMGPNG+GKSTL+ ++SG ++YE+T G
Sbjct: 1   MLQIKNVHASV--EDKVILNGINLEVKAGEVHAIMGPNGAGKSTLASVISGKEEYEMTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+   E I +    ERA KG+F++FQYP+ IPG+    F+K A+NE RK++  +++   
Sbjct: 59  EIILDNEDITELDPEERAHKGVFMSFQYPISIPGVSTTNFIKTAINETRKSKGLEDMPAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + +++    L I+   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKMIKEKAELLDIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L+S D + ++ITHYQRLL+YI PD +HVL +GKI+K+G   +A +LEE
Sbjct: 179 DALKIVANGVNKLKSNDNAVVVITHYQRLLDYIVPDFVHVLMDGKIVKSGTKELAYELEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|186684917|ref|YP_001868113.1| FeS assembly ATPase SufC [Nostoc punctiforme PCC 73102]
 gi|186467369|gb|ACC83170.1| FeS assembly ATPase SufC [Nostoc punctiforme PCC 73102]
          Length = 263

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A +    T I++G+NL+V   E+ AIMGPNGSGKST S +L+GH  YE+T G
Sbjct: 9   VLSVRNLTANV--DGTPILKGVNLEVRSGEIHAIMGPNGSGKSTFSKVLAGHPAYEVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G+++L+    ERA  G+FLAFQYP+EIPG+  + FL++A N +RKA+  +E+   
Sbjct: 67  EVIFQGQNLLELEPEERARSGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKAQGLEEIDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    + +N   L R LN GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFDDLIEEKLDVVKMNASFLSRSLNEGFSGGEKKRNEILQMALLEPKLGILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S + S ++ITHYQRLL+YI PD +HV+  G+II +G   +AL+LE 
Sbjct: 187 DALRIVANGVNQLASPENSTILITHYQRLLDYIVPDFVHVMAQGQIITSGGKELALELES 246

Query: 241 NGYAELIKE 249
            GY  +++E
Sbjct: 247 RGYDWVLEE 255


>gi|85375379|ref|YP_459441.1| ABC transporter, ATP-binding protein [Erythrobacter litoralis
           HTCC2594]
 gi|84788462|gb|ABC64644.1| ABC transporter, ATP-binding protein [Erythrobacter litoralis
           HTCC2594]
          Length = 249

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 175/244 (71%), Gaps = 3/244 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+NL A+I     +I+ GL L+V+  EV AIMGPNG+GKSTL+Y+L G   YE+TAG
Sbjct: 1   MLKIENLHAEI--DGKQILNGLTLEVQAGEVHAIMGPNGAGKSTLAYVLGGRPGYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +      ERA+ G+FL FQYPVEIPG+  +QFL+ ALN QR AR E+ L   
Sbjct: 59  SVTFMGQDLFAMEPHERAAAGLFLGFQYPVEIPGVSNVQFLREALNAQRTARGEEPLSGG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +  ++    L ++M+MLKR +N+GFSGGEKK AE++QM +L+P+  +LDETDSGLDI
Sbjct: 119 DFLKLAKEKAGLLKLDMEMLKRQVNVGFSGGEKKRAEMVQMGILDPTFAVLDETDSGLDI 178

Query: 181 DALKIAAQGVNA-LRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           DAL++  +G+NA +R   +  L+ITHYQRLL  +KPD + +L  G+I++TG   IA+ LE
Sbjct: 179 DALRVVGEGINAIMRDPAKGVLLITHYQRLLEVVKPDKVSILAAGRIVQTGGPEIAVRLE 238

Query: 240 ENGY 243
           + GY
Sbjct: 239 DEGY 242


>gi|90407345|ref|ZP_01215530.1| probable ABC transporter ATP-dependent protein [Psychromonas sp.
           CNPT3]
 gi|90311496|gb|EAS39596.1| probable ABC transporter ATP-dependent protein [Psychromonas sp.
           CNPT3]
          Length = 248

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 173/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L   +      I+ G+NL ++  EV AIMGPNGSGKSTL+ +L+G   Y I +G
Sbjct: 1   MLEIKDLYVSV--DGNMILNGINLNIKAGEVHAIMGPNGSGKSTLASVLAGRDSYRIESG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+KG ++LD    ERA +GIFLAFQYPVEIPG+    FL+ ++N  RK      L   
Sbjct: 59  SILFKGRNLLDLEPNERAGEGIFLAFQYPVEIPGVSNQFFLQASINAVRKYNGLDALDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D    + +    L +  D+L+R +N+ FSGGEKK  +ILQM +LEPSLCILDETDSGLDI
Sbjct: 119 DIVDLIDEKIQLLNMPKDLLQRSVNVAFSGGEKKRNDILQMAVLEPSLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  + GVN+LR   R+F+I+THYQR+L+YI+PD +HVL NGKI+K+G +S+  +LEE
Sbjct: 179 DALKEVSHGVNSLRDNTRAFIIVTHYQRILDYIRPDYVHVLANGKIVKSGGFSMVAELEE 238

Query: 241 NGYAELIKE 249
            GY  +  E
Sbjct: 239 KGYGWVADE 247


>gi|301166541|emb|CBW26117.1| putative ABC transport system, ATP-binding protein [Bacteriovorax
           marinus SJ]
          Length = 250

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 136/252 (53%), Positives = 172/252 (68%), Gaps = 6/252 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M+EIKNL AK+ D D  I+RG++L ++  EV AIMGPNGSGKSTLS +++GH  +E+T G
Sbjct: 1   MIEIKNLHAKVEDND--ILRGIDLTIKAGEVHAIMGPNGSGKSTLSKVIAGHPAFEVTQG 58

Query: 61  DILY----KGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
            I Y    K   +L+    ERA  GIFL FQYP+EIPG+    FL  + NE  KA    E
Sbjct: 59  SIEYNINGKNSDLLELEADERAKNGIFLGFQYPIEIPGVTNFNFLHESFNEVSKANGAGE 118

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
           +    F   +      L +  + L RP+N GFSGGEKK  EILQM +L P L +LDETDS
Sbjct: 119 MDEAAFKEILMPKLKLLEMREEFLNRPVNTGFSGGEKKKNEILQMAVLNPRLALLDETDS 178

Query: 177 GLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIAL 236
           GLDIDALKI A+GVNAL+S+  S +++THYQRLL+YI PD +HVL+ GKIIK+G   +AL
Sbjct: 179 GLDIDALKIVAKGVNALKSRFNSVVLVTHYQRLLDYIVPDYVHVLYQGKIIKSGGKELAL 238

Query: 237 DLEENGYAELIK 248
           +LEE GY  LIK
Sbjct: 239 ELEEKGYDWLIK 250


>gi|307152985|ref|YP_003888369.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 7822]
 gi|306983213|gb|ADN15094.1| FeS assembly ATPase SufC [Cyanothece sp. PCC 7822]
          Length = 256

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 177/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A +      I++G+NL+++  EV AIMG NGSGKST S +L+GH +YE+T G
Sbjct: 5   ILSVRNLTANV--DGKPILKGVNLEIKAGEVHAIMGRNGSGKSTFSKVLTGHPEYEVTGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I YKGE++L+    +RA +GIFLAFQYP+EIPG+  + FL++A N ++K    +E+   
Sbjct: 63  EIFYKGENLLEKEPEKRALEGIFLAFQYPLEIPGVSNLDFLRVAYNARQKHLGLEEIDTF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V++    + +N   L+R LN GFSGGEKK  EILQM LL+P+L ILDE DSGLDI
Sbjct: 123 DFEDLVQEKLDIVKMNPSFLERSLNEGFSGGEKKRNEILQMALLDPTLAILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L   D +FL+ITHYQRLLNYI+PD +HV+++G+I+K+G   +AL+LE 
Sbjct: 183 DALKIVANGVNQLAKPDNAFLLITHYQRLLNYIEPDFVHVMYDGRIVKSGTKELALELEA 242

Query: 241 NGY 243
            GY
Sbjct: 243 QGY 245


>gi|254498597|ref|ZP_05111317.1| ATP transporter, ABC binding component, ATP-binding protein
           [Legionella drancourtii LLAP12]
 gi|254352188|gb|EET11003.1| ATP transporter, ABC binding component, ATP-binding protein
           [Legionella drancourtii LLAP12]
          Length = 276

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 173/248 (69%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I  L  ++   +  I++G+NL V   EV AIMGPNGSGKSTLS +L+GH  Y +T+G
Sbjct: 1   MLNINELNVEV--NEQSILKGINLTVNAGEVHAIMGPNGSGKSTLSKVLAGHPSYHVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y G  +   S  ERA  GIFL+FQYPVEIPG+  + FLK ++N  RK + +  L   
Sbjct: 59  AMTYLGNDLAPLSPEERARAGIFLSFQYPVEIPGVTNINFLKASVNAVRKGQGKNTLDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+  A L ++   L R +N GFSGGEKK  EILQM  LEP L ILDETDSGLDI
Sbjct: 119 EFLTFIREKCALLDMDESFLYRSINEGFSGGEKKRNEILQMAALEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVNA+RS +RS +++THYQRLL+YI+PD IHVL NG+II +GD ++AL+LE+
Sbjct: 179 DALRIISHGVNAMRSPERSIVLVTHYQRLLDYIEPDFIHVLVNGRIIMSGDKTLALELEK 238

Query: 241 NGYAELIK 248
            G A L K
Sbjct: 239 KGMAGLRK 246


>gi|152990762|ref|YP_001356484.1| Fe-S cluster assembly ATPase SufC [Nitratiruptor sp. SB155-2]
 gi|151422623|dbj|BAF70127.1| Fe-S cluster assembly ATPase SufC [Nitratiruptor sp. SB155-2]
          Length = 249

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 179/243 (73%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M++I NL AKI   + EI++G++L++   +V AIMGPNG+GKSTLS  + GH D E+T G
Sbjct: 3   MMKINNLHAKI--GEKEILKGIDLELFKGKVHAIMGPNGAGKSTLSKTIVGHPDVEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILYKG++I++    ERA +GIF++FQ+PVEIPG+    FL+ ALN +RK +  K L   
Sbjct: 61  EILYKGKNIVEMEPEERALEGIFMSFQHPVEIPGVNNAYFLRTALNAKRKHQGLKPLNAA 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R +++   ELG+  +M+ R LN GFSGGEKK+ EILQM +LEP   ILDE DSGLDI
Sbjct: 121 EFLRLLKEKIKELGMREEMIHRSLNEGFSGGEKKLNEILQMEILEPDFVILDEIDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++ +N +R ++R+F+IITHY+++L+YI+PD +HVL NGK+++TG   I   LE+
Sbjct: 181 DALKKVSEAINNMRDENRTFMIITHYRKILDYIEPDYVHVLKNGKVLRTGGLEIVDALEK 240

Query: 241 NGY 243
            GY
Sbjct: 241 EGY 243


>gi|16331745|ref|NP_442473.1| ABC transporter [Synechocystis sp. PCC 6803]
 gi|3024873|sp|Q55791|Y075_SYNY3 RecName: Full=Probable ATP-dependent transporter slr0075
 gi|1001706|dbj|BAA10543.1| ABC transporter subunit [Synechocystis sp. PCC 6803]
          Length = 256

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 177/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IKNL A +     +I++G+NL+++  EV AIMG NGSGKSTLS +++GH DYEIT G
Sbjct: 5   ILSIKNLTASV--DGNQILKGVNLEIKAGEVHAIMGRNGSGKSTLSKVITGHPDYEITGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+Y+G+ +      ERA  GIFLAFQYP+EIPG+  + FL+IA N +RK    +EL   
Sbjct: 63  EIIYQGQDLSALEPHERALAGIFLAFQYPLEIPGVSNLDFLRIAYNAKRKHLGLEELDTF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +++    + +N   L+R LN GFSGGEKK  EILQM +LEP+L ILDE DSGLDI
Sbjct: 123 DFEDLIQEKLDVVKMNPAFLERSLNEGFSGGEKKRNEILQMAILEPTLSILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++GVN L++ D + L+ITHYQRLLNYI PD IHV+++GKI+ +G   +AL+LEE
Sbjct: 183 DALRIVSEGVNFLKNPDNATLVITHYQRLLNYIIPDHIHVMYDGKIVMSGGKELALELEE 242

Query: 241 NGY 243
            GY
Sbjct: 243 KGY 245


>gi|113477760|ref|YP_723821.1| FeS assembly ATPase SufC [Trichodesmium erythraeum IMS101]
 gi|110168808|gb|ABG53348.1| FeS assembly ATPase SufC [Trichodesmium erythraeum IMS101]
          Length = 271

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A +     EI++G NL+++  E+ AIMGPNGSGKST S +L+GH  YE+T G
Sbjct: 20  ILSVKNLTANV--EGKEILKGFNLEIKAGEIHAIMGPNGSGKSTFSKVLAGHPAYEVTGG 77

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++ D    ER+  G+FLAFQYP+EIPG+  + FL++A N ++K +  +EL   
Sbjct: 78  EVTFLGKNLFDMEPEERSLNGVFLAFQYPLEIPGVSNLDFLRVAYNTKQKYQGLEELDAF 137

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V+     + +  + L R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 138 DFDDLVQDKLDVVKMKPEFLDRSVNEGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 197

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L ++  S LIITHYQRLLNYI PD +HV  +G+IIKTG   +AL+LEE
Sbjct: 198 DALRIVANGVNKLANESNSLLIITHYQRLLNYIVPDFVHVTESGRIIKTGTKELALELEE 257

Query: 241 NGYAEL 246
            GY ++
Sbjct: 258 KGYDDV 263


>gi|170078419|ref|YP_001735057.1| FeS assembly ATPase SufC [Synechococcus sp. PCC 7002]
 gi|34765744|gb|AAQ82448.1| SufC [Synechococcus sp. PCC 7002]
 gi|169886088|gb|ACA99801.1| FeS assembly ATPase SufC [Synechococcus sp. PCC 7002]
          Length = 257

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IKNL A +      I++G++L+++  E+ AIMG NGSGKSTLS +++GH +YE+T G
Sbjct: 5   ILAIKNLTATV--DGQPILKGVDLEIKAGEIHAIMGRNGSGKSTLSKIIAGHPEYEVTGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+YKGE++L+    ERA  GIFLAFQYP+EIPG+  + FL++A N + K + ++E+   
Sbjct: 63  EIIYKGENLLEKEAEERALDGIFLAFQYPLEIPGVSNLDFLRVAYNAKLKHQGKEEIDAF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    + +N   L+R LN GFSGGEKK  EILQM LLEPSL ILDE DSGLDI
Sbjct: 123 DFEDLIEEKLEVVKMNPSFLERSLNEGFSGGEKKRNEILQMALLEPSLGILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L + D +FL+ITHYQRLL+YI P  +HV+++G+I+K+G   +AL+LE 
Sbjct: 183 DALRIVAEGVNQLATPDNAFLLITHYQRLLDYITPQFVHVMYDGRIVKSGGKELALELEA 242

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 243 TGYDFLDQE 251


>gi|332709644|ref|ZP_08429603.1| FeS assembly ATPase SufC [Lyngbya majuscula 3L]
 gi|332351471|gb|EGJ31052.1| FeS assembly ATPase SufC [Lyngbya majuscula 3L]
          Length = 262

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 176/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +++L A +     +I++GLNL+V+  E+ AIMGPNGSGKSTLS +L+GH  Y++T G
Sbjct: 9   ILSVRDLTADV--DGNQILKGLNLEVKAGEIHAIMGPNGSGKSTLSKVLAGHPAYDVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++L+    ER+  G+FLAFQYP+EIPG+  + FL++A N +RK +  +E+   
Sbjct: 67  EVSFLGQNLLEMEPEERSLAGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKHKGLEEIDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L+R LN GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFEDLVEEKLEIVKMNPSFLERSLNEGFSGGEKKRNEILQMALLEPKLGILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L S D + ++ITHYQRLLNYI+PD +HV+ +G+I++TG   +AL+LE 
Sbjct: 187 DALKIVANGVNQLASADNAMILITHYQRLLNYIEPDFVHVMADGRILRTGSKELALELES 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|86606833|ref|YP_475596.1| FeS assembly ATPase SufC [Synechococcus sp. JA-3-3Ab]
 gi|86555375|gb|ABD00333.1| FeS assembly ATPase SufC [Synechococcus sp. JA-3-3Ab]
          Length = 271

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 177/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +++L A+I    T I++GL+L++   E+ AIMGPNGSGKST S +L+GH DY +T G
Sbjct: 9   ILSVRDLSAEI--DGTPILKGLSLEIRAGEIHAIMGPNGSGKSTFSKILAGHPDYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILY G+++L+    ERA  GIFLAFQYP+EIPG+  + FL+ A N ++K R++ EL   
Sbjct: 67  EILYLGKNLLEMEPEERAWAGIFLAFQYPIEIPGVSNLDFLRAAYNARQKYRDQPELDAL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L+R +N GFSGGEKK  EILQM +LEP+L ILDETDSGLDI
Sbjct: 127 DFDDLVREKLDIVKMDPVFLERSVNEGFSGGEKKRNEILQMAVLEPTLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+N L   + + L+ITHYQRLL+Y+ PD +HV+  G+I+ +GD ++AL+LEE
Sbjct: 187 DALRIVAHGINRLAGPENAMLLITHYQRLLDYVTPDYVHVMEGGRIVISGDKTLALELEE 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|217970311|ref|YP_002355545.1| FeS assembly ATPase SufC [Thauera sp. MZ1T]
 gi|217507638|gb|ACK54649.1| FeS assembly ATPase SufC [Thauera sp. MZ1T]
          Length = 261

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 168/244 (68%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I NL A I      I++GLNL+V   EV AIMGPNGSGKSTL+ +L+G + + +T G
Sbjct: 1   MLKINNLHAAI--DGKAILKGLNLEVADGEVHAIMGPNGSGKSTLAQVLAGRETFTVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G  +L     ERA  G+FLAFQYPVEIPG+    FLK A+N  R+ R   E    
Sbjct: 59  SVDWNGADLLALPAEERARAGLFLAFQYPVEIPGVSNAYFLKAAVNAVRRHRGLPEYDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  +V+     +G+  + L R +N GFSGGEKK  E+LQM LLEP L +LDETDSGLDI
Sbjct: 119 DFLARVKAEMKAVGMKEEFLYRSVNEGFSGGEKKRNEVLQMALLEPRLAVLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+GVN LRS  RS ++ITHYQRLL+YI PD +HVL  G+I+++G   +AL+LEE
Sbjct: 179 DALKIVAEGVNRLRSPARSMIVITHYQRLLDYIVPDKVHVLSQGRIVRSGGRELALELEE 238

Query: 241 NGYA 244
           +GY 
Sbjct: 239 HGYG 242


>gi|300863814|ref|ZP_07108739.1| FeS assembly ATPase SufC [Oscillatoria sp. PCC 6506]
 gi|300338162|emb|CBN53885.1| FeS assembly ATPase SufC [Oscillatoria sp. PCC 6506]
          Length = 263

 Score =  254 bits (649), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 174/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A +    T+I++GLNL+++  E+ AIMGPNGSGKST S +L+GH  Y +T G
Sbjct: 9   ILSVQNLTADV--DGTKILKGLNLEIKAGEIHAIMGPNGSGKSTFSKILAGHPAYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++++ G+++L+ S  ER+  G+FLAFQYP+EIPG+  + FL++A N +RK +  +EL   
Sbjct: 67  EVIFLGQNLLELSPQERSLAGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKHQGLEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFQDLVEQKLEIVKMNPAFLDRSVNEGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L + + + L+ITHYQRLLNYI PD +HV+  G+I+ TG+  +AL+LE 
Sbjct: 187 DALKIVATGVNHLANAENAMLVITHYQRLLNYIVPDYVHVMEGGRILTTGNKDLALELEA 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|209527509|ref|ZP_03276012.1| FeS assembly ATPase SufC [Arthrospira maxima CS-328]
 gi|209492058|gb|EDZ92410.1| FeS assembly ATPase SufC [Arthrospira maxima CS-328]
          Length = 260

 Score =  254 bits (649), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 177/248 (71%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A +      I++GLNL+++  E+ AIMG NGSGKST S +L+GH  YE+T G
Sbjct: 9   ILSVKNLTATV--DGKAILKGLNLEIKAGEIHAIMGQNGSGKSTFSKILAGHPAYEVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++L+    ERA  G+FLAFQYP+EIPG+  + FL++A N QRK R   EL + 
Sbjct: 67  EVTFLGQNLLELESEERALIGLFLAFQYPIEIPGVSNLDFLRVAYNSQRKYRGLDELDVF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    + +  + L+R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFEDLIHEKLEVVKMRPEFLERSVNQGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L + + + L+ITHYQRLL+YI PD +HV+ +G+IIKTG   +A++LE+
Sbjct: 187 DALKIVANGVNQLANAENAMLVITHYQRLLDYIVPDYVHVMADGRIIKTGAKELAIELEK 246

Query: 241 NGYAELIK 248
            GY ++I+
Sbjct: 247 QGYDDIIE 254


>gi|284929292|ref|YP_003421814.1| FeS assembly ATPase SufC [cyanobacterium UCYN-A]
 gi|284809736|gb|ADB95433.1| FeS assembly ATPase SufC [cyanobacterium UCYN-A]
          Length = 256

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 175/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A I    T I++G+NL+++  E+ AIMG NGSGKST S +++GH DYE+T G
Sbjct: 5   ILSVKNLSANI--NGTPILKGVNLEIKAGEIHAIMGRNGSGKSTFSKVIAGHPDYEVTGG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I+YKG++IL+    ERA +GIFLAFQYP+EIPG+  + FL++A N +RK    +E+   
Sbjct: 63  EIIYKGQNILEKEPNERALEGIFLAFQYPLEIPGVSNLDFLRVAYNIRRKHLGLEEIDTF 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L R LN GFSGGEKK  EILQM LLEP+L ILDE DSGLDI
Sbjct: 123 DFEDLVEQKLDIVKMNPAFLDRSLNEGFSGGEKKRNEILQMALLEPTLAILDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L   + +FL+ITHYQRLL YI+P  IHV+++GKI+ +G   +AL+LEE
Sbjct: 183 DALRIVADGVNQLAHANNAFLLITHYQRLLTYIEPHHIHVMYDGKIVISGGKELALELEE 242

Query: 241 NGY 243
            GY
Sbjct: 243 TGY 245


>gi|322373789|ref|ZP_08048324.1| FeS assembly ATPase SufC [Streptococcus sp. C150]
 gi|321277161|gb|EFX54231.1| FeS assembly ATPase SufC [Streptococcus sp. C150]
          Length = 273

 Score =  254 bits (648), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 177/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   +   D EI++GLNL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 20  VLEIKNLHVSV--EDKEILKGLNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTEG 77

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ GESILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +E ++ + 
Sbjct: 78  DILFDGESILDLEVDERARLGLFLAMQYPAEIPGITNAEFIRAAMNAGKE--DEDKISVL 135

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 136 DFITKLDEKMELLGMREEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 195

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+  GK++ +G   +A  LE+
Sbjct: 196 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGKVVLSGGPELAARLEQ 255

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 256 EGYAKIAEE 264


>gi|282900436|ref|ZP_06308386.1| FeS assembly ATPase SufC [Cylindrospermopsis raciborskii CS-505]
 gi|281194749|gb|EFA69696.1| FeS assembly ATPase SufC [Cylindrospermopsis raciborskii CS-505]
          Length = 261

 Score =  254 bits (648), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 179/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +K+L+A++    T I++G+NL+V   E+ AIMGPNGSGKSTLS +L+GH  Y +T+G
Sbjct: 9   ILSVKDLQAQV--DGTPILKGVNLEVRAGEIHAIMGPNGSGKSTLSKVLAGHPTYSVTSG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G ++L+    ERA  G+FLAFQYP+E+PG+  + FL++A N  RKA+   E+   
Sbjct: 67  EVVFQGANLLEMEAEERARSGVFLAFQYPLEVPGVSNLDFLRVAYNSHRKAKGLPEVDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L+R +N GFSGGEKK  EILQM +LEP L ILDETDSGLDI
Sbjct: 127 DFDDLVMEKLEVVKMNSSFLERSVNEGFSGGEKKRNEILQMAILEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN L + + + ++ITHYQRLL+YI PD +HV+  G+II++G   +AL+LE 
Sbjct: 187 DALKIVSNGVNQLTNAENATIMITHYQRLLDYIVPDFVHVMAQGRIIRSGGKELALELES 246

Query: 241 NGYAELIKE 249
            GY  +++E
Sbjct: 247 QGYDWVLEE 255


>gi|184155572|ref|YP_001843912.1| ABC transporter ATP-binding component [Lactobacillus fermentum IFO
           3956]
 gi|227514947|ref|ZP_03944996.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus fermentum ATCC 14931]
 gi|183226916|dbj|BAG27432.1| ABC transporter ATP-binding component [Lactobacillus fermentum IFO
           3956]
 gi|227086711|gb|EEI22023.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus fermentum ATCC 14931]
 gi|299783322|gb|ADJ41320.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus fermentum CECT 5716]
          Length = 265

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/252 (51%), Positives = 175/252 (69%), Gaps = 6/252 (2%)

Query: 2   LEIKNLRAKIVDTDT----EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           LE+KNL   + D +T    EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G   Y +
Sbjct: 4   LEVKNLHVSVTDDETKQTKEILKGVNLSMKTGEIHAIMGPNGTGKSTLSQTIMGQPGYTV 63

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T G+IL  GE+IL+  + ERA KG+FLA QYP EI G+   +FL+ A+N +R A  + ++
Sbjct: 64  TEGEILLNGENILEMPVDERARKGLFLAMQYPAEIQGVTNAEFLRAAINARRPA--DDQI 121

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            + DF +K+    A L ++  M +R LN GFSGGEKK  EILQ+ ++EPS  ILDE DSG
Sbjct: 122 SVMDFIKKLDHNLALLDMDESMTERYLNEGFSGGEKKRNEILQLLMIEPSFAILDEIDSG 181

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN++R  +   LIITHYQRLLNYI PDT+HV+  GKI+KTGD  +A  
Sbjct: 182 LDIDALKVVSKGVNSMRGDNFGSLIITHYQRLLNYIVPDTVHVMMGGKIVKTGDAELAKK 241

Query: 238 LEENGYAELIKE 249
           LE  GYA L  E
Sbjct: 242 LEAEGYAGLRDE 253


>gi|189501696|ref|YP_001957413.1| hypothetical protein Aasi_0241 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497137|gb|ACE05684.1| hypothetical protein Aasi_0241 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 249

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 173/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A +     EI+RG+NL V+  EV AIMGPNGSGKSTL+ +L+G   Y +TAG
Sbjct: 1   MLVINNLHASV--EGQEILRGINLTVQAGEVHAIMGPNGSGKSTLASILAGKPGYTVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+ + G+ +L  +  ERA+ G+FLAFQYPVEIPG+    FLK A+N+ RK R ++ L   
Sbjct: 59  DVNFNGQDLLSLAPEERAAAGLFLAFQYPVEIPGVSNTNFLKTAVNQIRKHRGQEPLDAV 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +++    + I+ ++L R LN GFSGGEKK  EILQM +L PSL ILDETDSGLDI
Sbjct: 119 EFLKILKEKARLVNIDKELLHRTLNEGFSGGEKKRNEILQMAMLSPSLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A G+N L++ D + ++ITHYQRLL++I PD +HVL+ GKI+K+G   +A +LE 
Sbjct: 179 DALKTVAFGINQLKTPDNATIVITHYQRLLDFIVPDFVHVLYKGKIVKSGFKELAKELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|260662975|ref|ZP_05863868.1| FeS assembly ATPase SufC [Lactobacillus fermentum 28-3-CHN]
 gi|260552596|gb|EEX25596.1| FeS assembly ATPase SufC [Lactobacillus fermentum 28-3-CHN]
          Length = 265

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/252 (51%), Positives = 175/252 (69%), Gaps = 6/252 (2%)

Query: 2   LEIKNLRAKIVDTDT----EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           LE+KNL   + D +T    EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G   Y +
Sbjct: 4   LEVKNLHVSVTDDETKQTKEILKGVNLSMKTGEIHAIMGPNGTGKSTLSQTIMGQPGYTV 63

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T G+IL  GE+IL+  + ERA KG+FLA QYP EI G+   +FL+ A+N +R A ++  +
Sbjct: 64  TEGEILLNGENILEMPVDERARKGLFLAMQYPAEIQGVTNAEFLRAAINARRPAADQ--I 121

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            + DF +K+    A L ++  M +R LN GFSGGEKK  EILQ+ ++EPS  ILDE DSG
Sbjct: 122 SVMDFIKKLDHNLALLDMDESMTERYLNEGFSGGEKKRNEILQLLMIEPSFAILDEIDSG 181

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN++R  +   LIITHYQRLLNYI PDT+HV+  GKI+KTGD  +A  
Sbjct: 182 LDIDALKVVSKGVNSMRGDNFGSLIITHYQRLLNYIVPDTVHVMMGGKIVKTGDAELAKK 241

Query: 238 LEENGYAELIKE 249
           LE  GYA L  E
Sbjct: 242 LEAEGYAGLRDE 253


>gi|298490171|ref|YP_003720348.1| FeS assembly ATPase SufC ['Nostoc azollae' 0708]
 gi|298232089|gb|ADI63225.1| FeS assembly ATPase SufC ['Nostoc azollae' 0708]
          Length = 261

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 175/249 (70%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +K L A +    T I++GLNL V   E+ AIMGPNGSGKST S +L+GH  Y +T G
Sbjct: 9   ILSVKGLTADV--DGTPILKGLNLDVRAGEIHAIMGPNGSGKSTFSKVLAGHPAYSVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G+++L+    ERA  G+FLAFQYP+EIPG+  + FL++A N +RKA+  +E+   
Sbjct: 67  EVIFQGQNLLEMEATERARSGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKAQGLEEVDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L R LN GFSGGEKK  EILQM +LEP L ILDETDSGLDI
Sbjct: 127 DFDDLVEEKLDIVKMNPAFLNRSLNEGFSGGEKKRNEILQMGILEPRLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L S + + ++ITHYQRLL+YI PD +HV+  G+II++G   +AL+LE 
Sbjct: 187 DALKIVANGVNQLTSPENATIMITHYQRLLDYIVPDFVHVMAQGQIIRSGGKELALELES 246

Query: 241 NGYAELIKE 249
            GY  +++E
Sbjct: 247 RGYNWVLEE 255


>gi|156740326|ref|YP_001430455.1| FeS assembly ATPase SufC [Roseiflexus castenholzii DSM 13941]
 gi|156231654|gb|ABU56437.1| FeS assembly ATPase SufC [Roseiflexus castenholzii DSM 13941]
          Length = 260

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 134/254 (52%), Positives = 177/254 (69%), Gaps = 8/254 (3%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L IK+LR  +   D EI++G+NL V+   + AIMGPNGSGKSTL+Y L GH  Y +T G+
Sbjct: 5   LVIKDLRVSV--EDKEILKGVNLTVKAGTIHAIMGPNGSGKSTLAYTLMGHPGYTVTGGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQR--KARNEKELLI 119
           + Y+  +IL+    ER+  G+FLAFQYPV IPG+ +  FL+ A+N  R  + ++ KE  I
Sbjct: 63  VWYRDHNILELEPDERSKLGLFLAFQYPVAIPGVTVANFLRAAINAHRAEEGKDPKETAI 122

Query: 120 P--DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           P   F +++R+  A LGI+    +R LN GFSGGEKK  EILQM +LEPS+ I+DETDSG
Sbjct: 123 PMAQFRKQLREQMAALGIDESFARRYLNEGFSGGEKKRIEILQMAMLEPSMAIMDETDSG 182

Query: 178 LDIDALKIAAQGVNALRSQ--DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIA 235
           LDIDALKI AQGVN L +Q  +   L+ITHYQRLLNYIKP  + VL +G+I++ G   +A
Sbjct: 183 LDIDALKIVAQGVNTLYAQHPEMGVLVITHYQRLLNYIKPHFVSVLMDGRIVREGGPELA 242

Query: 236 LDLEENGYAELIKE 249
           L+LEE GY  L +E
Sbjct: 243 LELEEKGYDFLREE 256


>gi|228476451|ref|ZP_04061141.1| FeS assembly ATPase SufC [Streptococcus salivarius SK126]
 gi|312863993|ref|ZP_07724229.1| FeS assembly ATPase SufC [Streptococcus vestibularis F0396]
 gi|322517571|ref|ZP_08070440.1| FeS assembly ATPase SufC [Streptococcus vestibularis ATCC 49124]
 gi|228251872|gb|EEK10918.1| FeS assembly ATPase SufC [Streptococcus salivarius SK126]
 gi|311100406|gb|EFQ58613.1| FeS assembly ATPase SufC [Streptococcus vestibularis F0396]
 gi|322123831|gb|EFX95405.1| FeS assembly ATPase SufC [Streptococcus vestibularis ATCC 49124]
          Length = 256

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   +   D EI++GLNL ++  E+ AIMGPNG+GKSTLS  + G+ +YEIT G
Sbjct: 3   VLEIKNLHVSV--EDKEILKGLNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEITEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ GESILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +++++ + 
Sbjct: 61  DILFDGESILDLEVDERARLGLFLAMQYPAEIPGITNAEFIRAAMNAGKE--DDEKISVL 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMELLGMREEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+  GK++ +G   +A  LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGKVVLSGGPELAARLEQ 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAKIAEE 247


>gi|282897160|ref|ZP_06305162.1| FeS assembly ATPase SufC [Raphidiopsis brookii D9]
 gi|281197812|gb|EFA72706.1| FeS assembly ATPase SufC [Raphidiopsis brookii D9]
          Length = 261

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +K+L+A++    T I++G+NL+V   E+ AIMGPNGSGKST S +L+GH  Y +T G
Sbjct: 9   ILSVKDLQAQV--DGTPILKGVNLEVRAGEIHAIMGPNGSGKSTFSKVLAGHPAYSVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G +IL+    ERA  G+FLAFQYP+E+PG+  + FL++A N  RKA+   E+   
Sbjct: 67  EVVFQGTNILEMEAEERARSGVFLAFQYPLEVPGVSNLDFLRVAYNSHRKAKGLPEVDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + +N   L+R +N GFSGGEKK  EILQM +LEP L ILDETDSGLDI
Sbjct: 127 DFDDLVMEKLEVVKMNSSFLERSVNEGFSGGEKKRNEILQMAILEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + GVN L + + + ++ITHYQRLL+YI PD +HV+  G+IIK+G   +AL+LE 
Sbjct: 187 DALKIVSNGVNQLTNAENATIMITHYQRLLDYIVPDFVHVMAQGRIIKSGGKELALELES 246

Query: 241 NGYAELIKE 249
            GY  +++E
Sbjct: 247 RGYDWVLEE 255


>gi|119493190|ref|ZP_01624065.1| FeS assembly ATPase SufC [Lyngbya sp. PCC 8106]
 gi|119452755|gb|EAW33932.1| FeS assembly ATPase SufC [Lyngbya sp. PCC 8106]
          Length = 260

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 177/248 (71%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +++L A +    T I++GLNL+++  E+ A+MG NGSGKST S +L+GH  YE+T G
Sbjct: 9   ILSVRDLTANV--DGTPILKGLNLEIKAGEIHAVMGQNGSGKSTFSKVLAGHPAYEVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++L+    ERA  GIFLAFQYP+EIPG+  + FL+ A N + K++ ++E+   
Sbjct: 67  EVTFLGQNLLELEPNERAIAGIFLAFQYPLEIPGLTNLDFLRAAYNARLKSQGKEEIDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +R     + +  + L+R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFDDLIRDKLEVVKMKPEFLERSVNEGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L + D S L+ITHYQRLL+YI PD +HV+  G+IIKTG   +AL+LEE
Sbjct: 187 DALRIVAGGVNQLATADNSMLVITHYQRLLDYIVPDFVHVMQAGQIIKTGTKELALELEE 246

Query: 241 NGYAELIK 248
            GY E+I+
Sbjct: 247 KGYDEVIE 254


>gi|75906650|ref|YP_320946.1| FeS assembly ATPase SufC [Anabaena variabilis ATCC 29413]
 gi|75700375|gb|ABA20051.1| FeS assembly ATPase SufC [Anabaena variabilis ATCC 29413]
          Length = 262

 Score =  253 bits (646), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +KNL A++    T I++G+NL+V   E+ AIMGPNGSGKST S +L+GH  Y +T G
Sbjct: 9   VLSVKNLTAEV--DGTPILKGVNLEVRSGEIHAIMGPNGSGKSTFSKVLAGHPAYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G+++L+    ERA  G+FLAFQYP+EIPG+  + FL++A N +RKA+  +E+   
Sbjct: 67  EVIFQGQNLLELEPEERARTGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKAQGLEEIDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    + +N   L R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFDDLIEEKLEVVKMNPAFLNRSVNEGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L S + + ++ITHYQRLL+YI PD +HV+  G+II +G   +AL+LE 
Sbjct: 187 DALKIVAHGVNQLASPENATIMITHYQRLLDYIVPDFVHVMARGQIITSGGKELALELES 246

Query: 241 NGYAELIKE 249
            GY  L+++
Sbjct: 247 RGYDWLLED 255


>gi|325281867|ref|YP_004254409.1| FeS assembly ATPase SufC [Odoribacter splanchnicus DSM 20712]
 gi|324313676|gb|ADY34229.1| FeS assembly ATPase SufC [Odoribacter splanchnicus DSM 20712]
          Length = 251

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +     EI++G++L+++  EV AIMGPNG+GKSTLS +L+G + +E+T G
Sbjct: 1   MLKIKNLHASV--DGKEILKGIDLEIKAGEVHAIMGPNGAGKSTLSAVLTGRERFEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++L+    +RA +GIFL+FQYPVEIPG+  + FLK A+NE RK   +      
Sbjct: 59  EVEFNGKNLLEMPAEDRAREGIFLSFQYPVEIPGVSTVNFLKTAVNEIRKYHGQPPYPAG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    +GI+  +L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DFLKMIRQKMELVGIDNKLLNRSLNEGFSGGEKKKNEIFQMAVLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A GVN L+  + + ++ITHYQRLL+YI PD +HVL++G+I+KT    +  +LEE
Sbjct: 179 DALRTVANGVNKLKKPENATIVITHYQRLLDYIVPDVVHVLYDGRIVKTAGKELVAELEE 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 KGY-DWIKE 246


>gi|254413273|ref|ZP_05027044.1| FeS assembly ATPase SufC [Microcoleus chthonoplastes PCC 7420]
 gi|196179893|gb|EDX74886.1| FeS assembly ATPase SufC [Microcoleus chthonoplastes PCC 7420]
          Length = 262

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 176/249 (70%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A +     +I++GL L+V+  E+ AIMG NGSGKST S LL+GH  YE+T G
Sbjct: 9   ILSVRNLTANV--EGQQILKGLTLEVKAGEIHAIMGQNGSGKSTFSKLLAGHPAYEVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++L+    ERA  GIFLAFQYP+EIPG+  + FL++A N +RK +  +E+   
Sbjct: 67  EVTFLGQNLLELEPEERALAGIFLAFQYPLEIPGVSNLDFLRVAYNSRRKHQGLEEIDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    + +N   L+R LN GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFEDLIEEKLEIVKMNPSFLERSLNEGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GV+ L + D + ++ITHYQR+LNYI+PD +HV+  G+I+KTG   +AL+LE 
Sbjct: 187 DALKIVANGVSQLATSDNAMILITHYQRMLNYIEPDYVHVMAGGRILKTGGKELALELES 246

Query: 241 NGYAELIKE 249
            GY  +I+E
Sbjct: 247 RGYDWVIEE 255


>gi|160902129|ref|YP_001567710.1| FeS assembly ATPase SufC [Petrotoga mobilis SJ95]
 gi|160359773|gb|ABX31387.1| FeS assembly ATPase SufC [Petrotoga mobilis SJ95]
          Length = 257

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 182/249 (73%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI++LRAK+ D D EI++G+NL +   E+ A+MGPNGSGKSTL++++ G+  Y++T+G
Sbjct: 4   LLEIQDLRAKVRDEDVEILKGVNLTINKGEIHALMGPNGSGKSTLAHVIMGNPKYQVTSG 63

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL++G+SI+D S  ERA  G+F++FQ P E+ GI M QFL   +N  R    E ++ + 
Sbjct: 64  DILFEGQSIIDLSTDERAKLGLFMSFQTPEEVEGIKMRQFL---INSFRNIHKEDKITLL 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  + + +++  L +N + L+R +N GFSGGEKK +EILQM  L+P L ILDE DSGLDI
Sbjct: 121 ELNKVISQLSQNLDLNGEFLERYINTGFSGGEKKKSEILQMGFLKPKLSILDEIDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+ +N +++ +   L+ITHYQR+LN++ PD +H+  +GKI+KTG   +A ++EE
Sbjct: 181 DALRIVAENINRVKTGNMGVLLITHYQRILNFVVPDYVHIYIDGKIVKTGSEELAKEIEE 240

Query: 241 NGYAELIKE 249
           NGY+ L +E
Sbjct: 241 NGYSTLEQE 249


>gi|116695454|ref|YP_841030.1| iron sulfur cluster assembly protein SufC [Ralstonia eutropha H16]
 gi|113529953|emb|CAJ96300.1| iron sulfur cluster assembly protein (SufC),ABC-type transporter
           ATPase component: Fe-S family [Ralstonia eutropha H16]
          Length = 248

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 170/246 (69%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+ L   +   D  I+ G++L V+  EV AIMGPNGSGKSTL+++L+G   + +T G
Sbjct: 1   MLEIRKLHVSV--DDKPILHGIDLSVKAGEVHAIMGPNGSGKSTLAHVLAGRDRFTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++LY G S+L     ERA  GIFLAFQYPVEIPG+  +  LK  LN  RK R E EL   
Sbjct: 59  EVLYDGTSLLGMPPEERARAGIFLAFQYPVEIPGVSNIYLLKAGLNAIRKHRGEPELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V+     + ++ D+L R +N GFSGGEKK  EILQM +LEP L ILDETDSGLDI
Sbjct: 119 DFLALVKDKLQLMEMDQDLLYRSVNEGFSGGEKKRNEILQMAVLEPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A+G+ A+RS  R+ +++THYQRLL+YI PD +HVL  G+I ++G   +A +LE 
Sbjct: 179 DALKIVARGIEAMRSPQRAIVLVTHYQRLLDYIVPDQVHVLAQGRIARSGGPELARELER 238

Query: 241 NGYAEL 246
           +GYA +
Sbjct: 239 HGYAAM 244


>gi|55820262|ref|YP_138704.1| ABC transporter ATP binding protein [Streptococcus thermophilus LMG
           18311]
 gi|55822152|ref|YP_140593.1| ABC transporter ATP binding protein [Streptococcus thermophilus
           CNRZ1066]
 gi|38679243|gb|AAR26257.1| SufC [Streptococcus thermophilus]
 gi|55736247|gb|AAV59889.1| ABC transporter ATP binding protein [Streptococcus thermophilus LMG
           18311]
 gi|55738137|gb|AAV61778.1| ABC transporter ATP binding protein [Streptococcus thermophilus
           CNRZ1066]
          Length = 267

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   +   D EI++GLNL ++  E+ AIMGPNG+GKSTLS  + G+ +YEIT G
Sbjct: 14  VLEIKNLHVSV--EDKEILKGLNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEITEG 71

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ GESILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +++++ + 
Sbjct: 72  DILFDGESILDLEVDERARLGLFLAMQYPAEIPGITNAEFIRAAMNAGKE--DDEKISVL 129

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 130 DFITKLDEKMELLGMREEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 189

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+  G+++ +G   +A  LE+
Sbjct: 190 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGQVVLSGGPELAARLEQ 249

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 250 EGYAKIAEE 258


>gi|116627116|ref|YP_819735.1| ABC transporter ATP-binding protein [Streptococcus thermophilus
           LMD-9]
 gi|116100393|gb|ABJ65539.1| ABC-type transport system involved in Fe-S cluster assembly, ATPase
           component [Streptococcus thermophilus LMD-9]
 gi|312277584|gb|ADQ62241.1| ABC-type Fe-S cluster assembly transporter, ATPase component,
           putative [Streptococcus thermophilus ND03]
          Length = 256

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   +   D EI++GLNL ++  E+ AIMGPNG+GKSTLS  + G+ +YEIT G
Sbjct: 3   VLEIKNLHVSV--EDKEILKGLNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEITEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ GESILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +++++ + 
Sbjct: 61  DILFDGESILDLEVDERARLGLFLAMQYPAEIPGITNAEFIRAAMNAGKE--DDEKISVL 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMELLGMREEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+  G+++ +G   +A  LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGQVVLSGGPELAARLEQ 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAKIAEE 247


>gi|291295173|ref|YP_003506571.1| FeS assembly ATPase SufC [Meiothermus ruber DSM 1279]
 gi|290470132|gb|ADD27551.1| FeS assembly ATPase SufC [Meiothermus ruber DSM 1279]
          Length = 251

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 177/248 (71%), Gaps = 6/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEI+NL A+IVD +T I+ G+NL +   +V AIMGPNG+GKSTL  +++G   YEIT GD
Sbjct: 5   LEIRNLHARIVDGET-ILNGVNLVLPKGQVHAIMGPNGAGKSTLGKIIAGDPSYEITKGD 63

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  GESIL+    ERA KG+FLAFQYPVE+PG+    FL++AL    +A+   E+ + +
Sbjct: 64  ILMDGESILEMEADERARKGLFLAFQYPVEVPGVSNANFLRLAL----QAKKGGEVNLTE 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F  K++K    L  +  +L R LN GFSGGEKK  EI+ M +LEP+  I+DETDSGLDID
Sbjct: 120 FYSKLQKALETLEWDESILTRYLNDGFSGGEKKRNEIMHMMVLEPTYAIMDETDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVNA+R  +   L+ITHYQRLLNYI PD +HV+ +G+I+ +G   +A+ LEE 
Sbjct: 180 ALKVVAKGVNAMRGPNFGALLITHYQRLLNYIVPDMVHVMIDGRIVTSGGPELAMKLEEQ 239

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 240 GY-EWVKE 246


>gi|221632409|ref|YP_002521630.1| FeS assembly ATPase SufC [Thermomicrobium roseum DSM 5159]
 gi|221157260|gb|ACM06387.1| FeS assembly ATPase SufC [Thermomicrobium roseum DSM 5159]
          Length = 275

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 177/248 (71%), Gaps = 5/248 (2%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           I+NLRA I     EI+RG+NL +E  E+ A+MGPNGSGKSTL+Y+++GH +YE+  G IL
Sbjct: 24  IENLRAGI--EGKEILRGVNLVIERGEIHALMGPNGSGKSTLAYVIAGHPNYEVYEGRIL 81

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKAR-NEKELLIP-D 121
           YKGE++L+    ERA  G+FLAFQYP  IPG+ M  FL++A+N  RKAR  E + L P +
Sbjct: 82  YKGENVLELPPDERARMGMFLAFQYPTAIPGVTMANFLRLAVNSVRKARLGEDKALSPRE 141

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R +R+    L ++     R LN GFSGGEKK AEILQM +LEP   +LDETDSGLDID
Sbjct: 142 FRRLLREKLEMLRMDESFASRYLNEGFSGGEKKRAEILQMAMLEPEFAVLDETDSGLDID 201

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL+  ++GVN L + + + L+ITHYQR+LNYI+P  +HV+ +GKI  +G   +A +LEE 
Sbjct: 202 ALRTVSEGVNRLFNPNMALLVITHYQRILNYIRPHYVHVMLDGKIAVSGGPELAEELEEK 261

Query: 242 GYAELIKE 249
           GY + +KE
Sbjct: 262 GY-DWVKE 268


>gi|315320531|ref|YP_004072587.1| FeS cluster assembly protein SufC [Thalassiosira oceanica CCMP1005]
 gi|283569004|gb|ADB27541.1| FeS cluster assembly protein SufC [Thalassiosira oceanica CCMP1005]
          Length = 251

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 175/247 (70%), Gaps = 2/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L+A I   + EI++ LNL ++  E+ AIMGPNGSGKST S +++GH  YE+ +G
Sbjct: 7   ILEIKDLKASI--NNNEILKSLNLTIKRGEIHAIMGPNGSGKSTFSKIIAGHPAYEVISG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ G SILD    ER+  GIFLAFQYP+EIPG+    FL+++ N ++K  N+ E+   
Sbjct: 65  DILFNGSSILDLDPEERSHLGIFLAFQYPIEIPGVSNEDFLRLSYNSKQKFLNKPEVDPI 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   + +    + ++   L R +N GFSGGEKK  EILQM LLE  L ILDETDSGLDI
Sbjct: 125 QFFSIINEKLKLVDMSSVFLSRNVNEGFSGGEKKRNEILQMILLESELSILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++G+N   S D+S ++ITHYQRLL+YIKPD +HV+ NGKIIKTG  ++A +LE 
Sbjct: 185 DALKIISKGINTFMSSDKSIILITHYQRLLDYIKPDYVHVMQNGKIIKTGTANLAKELEI 244

Query: 241 NGYAELI 247
            GY  LI
Sbjct: 245 KGYEWLI 251


>gi|258593119|emb|CBE69430.1| SufC, related to ABC transporter associated with Fe-S cluster
           assembly (ATP-binding protein) [NC10 bacterium 'Dutch
           sediment']
          Length = 256

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 172/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL  K+     EI+RG++L V   EV A+MGPNGSGKSTL+++L+G   YE+TAG
Sbjct: 1   MLTITNLHVKV--GGAEILRGVDLVVGHGEVHAVMGPNGSGKSTLAHVLAGRDGYEVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++Y+G+ +L      RA +G+FL+FQYPVEIPG+    FLK A+N  RK    +EL   
Sbjct: 59  EVVYEGKDLLRMPPEVRAREGVFLSFQYPVEIPGVNTSYFLKAAVNAVRKHCGLEELDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   +++    + ++  +L R LN GFSGGEKK  EI QM +L+P L ILDETDSGLDI
Sbjct: 119 DFLNLIKEKMKLVELDQGLLNRSLNEGFSGGEKKRNEIFQMAVLDPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+G++ALRS DRS ++ITHYQRLLNYI PD +HVL  G+I+K+G   +A +LE 
Sbjct: 179 DALRIVAKGIDALRSPDRSMILITHYQRLLNYITPDFVHVLFEGRIVKSGGRDLAHELEA 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|24216262|ref|NP_713743.1| ABC transporter ATP-binding protein [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45656529|ref|YP_000615.1| ABC transporter ATP-binding protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24197526|gb|AAN50761.1| ATP-binding component of an ABC transporter complex [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45599764|gb|AAS69252.1| ABC transporter ATP-binding protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 255

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 178/253 (70%), Gaps = 8/253 (3%)

Query: 1   MLEIKNLRAKIVDTDT----EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYE 56
           +L+I+NL+A I   D+    EI++G++L + P EV AIMGPNGSGKSTLS ++ GH  Y+
Sbjct: 4   ILKIQNLKAGIQTGDSGEIKEIVKGVDLTIRPGEVHAIMGPNGSGKSTLSNVIMGHPKYQ 63

Query: 57  ITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
           + +GDIL++G+SIL+    ERA  GIFL FQYP  IPG+ +  FLK  +   R     KE
Sbjct: 64  VLSGDILFEGKSILNLPTDERARLGIFLCFQYPTSIPGVTIGNFLKTIVKSVRG----KE 119

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
           L + +F +++++  A L +    + R +N GFSGGEKK  EILQM LL+P L +LDETDS
Sbjct: 120 LPVKEFRKELKESMAALDMPESFIARYVNDGFSGGEKKRNEILQMSLLKPKLSVLDETDS 179

Query: 177 GLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIAL 236
           GLDIDAL+I ++G+N  ++ +RS L+ITHYQR+LNYI PD +HV   GKI+KTG   +AL
Sbjct: 180 GLDIDALRIVSEGINRNKTPERSILLITHYQRMLNYITPDFVHVFAKGKILKTGTRELAL 239

Query: 237 DLEENGYAELIKE 249
           +LEE GY  ++ E
Sbjct: 240 ELEEKGYDWILAE 252


>gi|270158824|ref|ZP_06187481.1| FeS assembly ATPase SufC [Legionella longbeachae D-4968]
 gi|289166383|ref|YP_003456521.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Legionella longbeachae NSW150]
 gi|269990849|gb|EEZ97103.1| FeS assembly ATPase SufC [Legionella longbeachae D-4968]
 gi|288859556|emb|CBJ13521.1| component of SufBCD complex, ATP-binding component of ABC
           superfamily [Legionella longbeachae NSW150]
          Length = 249

 Score =  252 bits (643), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 175/246 (71%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IK+L   +      I++G++L+V   EV AIMGPNGSGKSTLS +L+GH  Y++T G
Sbjct: 1   MLKIKDLNVSV--NGQAILKGIDLQVNAGEVHAIMGPNGSGKSTLSKVLAGHPSYQVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I Y  + +   S  ERA  G+FL+FQYPVEIPG+  + FLK ++N  RK + +  L   
Sbjct: 59  EISYLEQDLNPLSPEERARAGVFLSFQYPVEIPGVTNINFLKASVNAVRKGQGKNTLDAI 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    L ++   L R +N GFSGGEKK  EILQM  LEP L ILDETDSGLDI
Sbjct: 119 EFLTFIREKCQLLEMDESFLYRSINEGFSGGEKKRNEILQMAALEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVNA+RS +RS +++THYQRLL+YI+PD IHVL NG+II +GD S+AL+LE+
Sbjct: 179 DALRIISHGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLVNGRIILSGDKSLALELEK 238

Query: 241 NGYAEL 246
            GY+ L
Sbjct: 239 KGYSWL 244


>gi|253996498|ref|YP_003048562.1| FeS assembly ATPase SufC [Methylotenera mobilis JLW8]
 gi|253983177|gb|ACT48035.1| FeS assembly ATPase SufC [Methylotenera mobilis JLW8]
          Length = 273

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 171/244 (70%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL A I     EI+RG+NL+V+  E+ AIMGPN SGKSTL+ LL+G + Y++TAG
Sbjct: 1   MLSINNLHASI--DGKEILRGINLEVKAGEMHAIMGPNASGKSTLAQLLAGRELYDVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y G  +L  S  +RA +G+FLAFQYPVEIPGI    FLK ALN  RK   + EL   
Sbjct: 59  SVRYLGHDLLSMSPEQRACEGMFLAFQYPVEIPGISNALFLKTALNAIRKYHLQPELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    +G++  ML R +N GFSGGEKK  EILQ+ +L+P L ILDETDSGLDI
Sbjct: 119 DFLSMVRERMQRVGMDDAMLLRAVNEGFSGGEKKRNEILQLSVLQPRLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A G+N +R   R+ +++THYQRLL+Y+ PD +HVL  G+IIK+G   +A +LE+
Sbjct: 179 DALKLIANGINDMRDPARAIILVTHYQRLLDYVVPDFVHVLSQGRIIKSGGADLAKNLEQ 238

Query: 241 NGYA 244
           +GY 
Sbjct: 239 HGYG 242


>gi|17229985|ref|NP_486533.1| ABC transporter ATP-binding protein [Nostoc sp. PCC 7120]
 gi|17131585|dbj|BAB74192.1| ABC transporter ATP-binding protein [Nostoc sp. PCC 7120]
          Length = 262

 Score =  251 bits (642), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++ L A++    T I++G+NL+V   EV AIMGPNGSGKSTLS +L+GH  Y +T G
Sbjct: 9   VLSVRGLTAEV--DGTPILKGVNLEVRSGEVHAIMGPNGSGKSTLSKVLAGHPAYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++++G+++L+    ERA  G+FLAFQYP+EIPG+  + FL++A N +RKA+  +E+   
Sbjct: 67  EVVFQGQNLLELEPEERARTGVFLAFQYPLEIPGVSNLDFLRVAYNSRRKAQGLEEIDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   + +    + +N   L R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFDDLIEERLEVVKMNPAFLNRSVNEGFSGGEKKRNEILQMALLEPKLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L S + + ++ITHYQRLL+YI PD +HV+  G+II +G   +AL+LE 
Sbjct: 187 DALKIVAHGVNQLASPENATILITHYQRLLDYIVPDFVHVMARGQIITSGGKELALELES 246

Query: 241 NGYAELIKE 249
            GY  L+++
Sbjct: 247 RGYDWLLED 255


>gi|90994432|ref|YP_536922.1| sulfate ABC transporter protein [Porphyra yezoensis]
 gi|122194715|sp|Q1XDP6|ABCX_PORYE RecName: Full=Probable ATP-dependent transporter ycf16
 gi|90818996|dbj|BAE92365.1| unnamed protein product [Porphyra yezoensis]
          Length = 251

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 173/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L A +   +T I++G+NL +   E+ AIMGPNGSGKSTLS +++GH  Y + +G
Sbjct: 5   ILEIKDLYASV--GETTILKGVNLSIRAGEIHAIMGPNGSGKSTLSKVIAGHPAYSLISG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+ G+SIL+    ERA  GIFLAFQYPVEIPG+    FL+IALN +RK +   E    
Sbjct: 63  DILFFGQSILEIEPDERAKAGIFLAFQYPVEIPGVSNSDFLRIALNARRKFQGLSEFSPL 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + + +    +G+    L R +N GFSGGEKK  EILQM LL+  + ILDETDSGLDI
Sbjct: 123 EFFQLITEKIDLVGMQESFLTRNVNEGFSGGEKKRNEILQMALLDSKISILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+G+N L     S ++ITHYQRLL+YI PD +H++ NG+I+KTG  ++A DLE+
Sbjct: 183 DALRVVAKGINTLAKSTNSIILITHYQRLLDYIIPDFVHIMSNGQIVKTGSVTLAQDLEK 242

Query: 241 NGY 243
           +GY
Sbjct: 243 HGY 245


>gi|11467361|ref|NP_043218.1| sulfate ABC transporter protein [Cyanophora paradoxa]
 gi|1351834|sp|P48255|ABCX_CYAPA RecName: Full=Probable ATP-dependent transporter ycf16
 gi|1016162|gb|AAA81249.1| ABC transporter subunit [Cyanophora paradoxa]
          Length = 259

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 174/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL+A++    TEI++G+NL +   E+ AIMGPNGSGKST S +L+GH  Y++T G
Sbjct: 8   ILEVKNLKAQV--DGTEILKGVNLTINSGEIHAIMGPNGSGKSTFSKILAGHPAYQVTGG 65

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+K +++L+    ERA  G+FLAFQYP+EI G+  + FL++A N +RK     EL   
Sbjct: 66  EILFKNKNLLELEPEERARAGVFLAFQYPIEIAGVSNIDFLRLAYNNRRKEEGLTELDPL 125

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   V++    + ++   L R +N GFSGGEKK  EILQM LL PSL ILDETDSGLDI
Sbjct: 126 TFYSIVKEKLNVVKMDPHFLNRNVNEGFSGGEKKRNEILQMALLNPSLAILDETDSGLDI 185

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L +++ S ++ITHYQRLL+YI PD IHV+ NG+I+KTG   +A +LE 
Sbjct: 186 DALRIVAEGVNQLSNKENSIILITHYQRLLDYIVPDYIHVMQNGRILKTGGAELAKELEI 245

Query: 241 NGY 243
            GY
Sbjct: 246 KGY 248


>gi|282879389|ref|ZP_06288132.1| FeS assembly ATPase SufC [Prevotella buccalis ATCC 35310]
 gi|281298502|gb|EFA90928.1| FeS assembly ATPase SufC [Prevotella buccalis ATCC 35310]
          Length = 249

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 175/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL A I     EI++G+NL ++  EV AIMGPNGSGKSTLS +L G+  YE+T G
Sbjct: 1   MLEVKNLHATI--NGKEILKGINLVIKTGEVHAIMGPNGSGKSTLSAVLVGNPMYEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+ +L     +RA +G+FL+FQYPVEIPG+ M  F++ A+NE+RK + ++ +   
Sbjct: 59  EVTFNGKDLLAMPPEDRAHEGLFLSFQYPVEIPGVSMTNFMRAAINEKRKYQGQEPMSAG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +++    + ++  +  R +N GFSGGEKK  EI QM +LEP+L ILDETDSGLD+
Sbjct: 119 DFIKLMKEKRKVVELDSKLSNRSVNEGFSGGEKKRNEIFQMAMLEPTLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L+  D S ++ITHY RLL+ IKPD +HVL NG+I+KTG   +A ++E+
Sbjct: 179 DALRIVAEGVNKLKRPDTSTIVITHYDRLLDLIKPDIVHVLFNGRIVKTGGPELAREIED 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|82701830|ref|YP_411396.1| FeS assembly ATPase SufC [Nitrosospira multiformis ATCC 25196]
 gi|82409895|gb|ABB74004.1| FeS assembly ATPase SufC [Nitrosospira multiformis ATCC 25196]
          Length = 262

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 170/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+  LRA +     EI++G++L V+  EV AIMG NGSGKST + +L+GH  Y++T G
Sbjct: 9   ILEVSGLRAAV--EGVEILKGVDLVVKRGEVHAIMGTNGSGKSTFAKVLAGHSAYQVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +L++G ++ D    ERA  G+FLAFQYP+EIPG+    FL++A N  +  R + EL   
Sbjct: 67  SVLFEGRNLFDLEPEERARAGVFLAFQYPIEIPGVSNSHFLRLAYNTLQSQRGKDELDPL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR+    L +N + L R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 EFEDFVREKMKLLEMNPNFLDRGVNEGFSGGEKKRNEILQMALLEPRLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I   GVN L ++D + +++THYQR+LNYI+PD +HV+ +G+I+KTG   +ALDLE 
Sbjct: 187 DALRIVTNGVNKLATKDNAIILVTHYQRMLNYIEPDYVHVMRSGRIVKTGGKELALDLET 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|288800580|ref|ZP_06406038.1| FeS assembly ATPase SufC [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332793|gb|EFC71273.1| FeS assembly ATPase SufC [Prevotella sp. oral taxon 299 str. F0039]
          Length = 251

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 175/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL A I   + EI+RG+NL V+  E  AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEVKNLHANI--GEKEILRGINLTVKDGETHAIMGPNGSGKSTLSAVLVGNPLFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              Y G+ +L+    +RA++G+FL+FQYPVEIPG+ M  F++ A+NE+RK + ++ L   
Sbjct: 59  SATYNGKDLLEMKPEDRANEGLFLSFQYPVEIPGVSMTNFMRAAINEKRKYQGKEPLNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+L ILDETDSGLD+
Sbjct: 119 DFLKLMREKRAIVELDSKLSNRSVNEGFSGGEKKRNEIFQMAMLEPTLRILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ + S ++ITHY RLL+ IKPD IHVL+ G+I+KT    +A  +EE
Sbjct: 179 DALRIVAEGVNKLKTPETSTIVITHYDRLLDIIKPDVIHVLYKGRIVKTAGPELAKQIEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|163849010|ref|YP_001637054.1| FeS assembly ATPase SufC [Chloroflexus aurantiacus J-10-fl]
 gi|222526972|ref|YP_002571443.1| FeS assembly ATPase SufC [Chloroflexus sp. Y-400-fl]
 gi|163670299|gb|ABY36665.1| FeS assembly ATPase SufC [Chloroflexus aurantiacus J-10-fl]
 gi|222450851|gb|ACM55117.1| FeS assembly ATPase SufC [Chloroflexus sp. Y-400-fl]
          Length = 259

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 175/250 (70%), Gaps = 6/250 (2%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           IK+L A+I   D EI+RG+NL V    V AIMGPNGSGKSTLSY+++GH  YE+T G+I 
Sbjct: 7   IKDLYARI--GDKEILRGVNLTVRQGTVHAIMGPNGSGKSTLSYIIAGHPSYEVTGGEIW 64

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQR--KARNEKELLIP- 120
           YKG ++L+    ER+  G+FLAFQYPV +PG+ +  FL+ A+N  R  + ++ KE  IP 
Sbjct: 65  YKGHNLLELEPDERSRLGVFLAFQYPVAVPGVTVANFLRSAINAHRAEEGKDPKETAIPA 124

Query: 121 -DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD 179
            +F + +R+    L ++    +R LN GFSGGEKK  EILQM LL+P++ +LDETDSGLD
Sbjct: 125 AEFRKLLREGLNLLDMDESFARRYLNDGFSGGEKKRLEILQMMLLKPTMAVLDETDSGLD 184

Query: 180 IDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           IDAL+I A GVN L       L+ITHYQRLLNYIKPD + V+ +G+I++ G   +AL+LE
Sbjct: 185 IDALRIVANGVNRLAGPHMGVLVITHYQRLLNYIKPDVVSVMMDGRIVREGGPELALELE 244

Query: 240 ENGYAELIKE 249
           E GY  L +E
Sbjct: 245 EKGYDWLREE 254


>gi|160887874|ref|ZP_02068877.1| hypothetical protein BACUNI_00277 [Bacteroides uniformis ATCC 8492]
 gi|270294863|ref|ZP_06201064.1| FeS assembly ATPase SufC [Bacteroides sp. D20]
 gi|317477851|ref|ZP_07937037.1| FeS assembly ATPase SufC [Bacteroides sp. 4_1_36]
 gi|156862560|gb|EDO55991.1| hypothetical protein BACUNI_00277 [Bacteroides uniformis ATCC 8492]
 gi|270274110|gb|EFA19971.1| FeS assembly ATPase SufC [Bacteroides sp. D20]
 gi|316905987|gb|EFV27755.1| FeS assembly ATPase SufC [Bacteroides sp. 4_1_36]
          Length = 251

 Score =  251 bits (640), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 175/249 (70%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL +   EV A+MG NG+GKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTIRDGEVHALMGQNGAGKSTLSNVLVGHPAYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ +L  S  +RA +GIFL+FQ PVEIPG+ M+ F++ A+NEQRK R+   L   
Sbjct: 59  SITFNGKDLLAMSPEDRAHEGIFLSFQAPVEIPGVSMVNFMRAAVNEQRKYRHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+  ILDETDSGLD+
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPTFAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G N L++ + S ++ITHYQRLL+YIKPDT+HVL  G+I+KTG   +A ++E 
Sbjct: 179 DALRIVADGFNKLKTAETSAMVITHYQRLLDYIKPDTVHVLLGGRIVKTGGPELAKEIET 238

Query: 241 NGYAELIKE 249
            G+  + KE
Sbjct: 239 RGFDWIRKE 247


>gi|309790994|ref|ZP_07685534.1| FeS assembly ATPase SufC [Oscillochloris trichoides DG6]
 gi|308226967|gb|EFO80655.1| FeS assembly ATPase SufC [Oscillochloris trichoides DG6]
          Length = 265

 Score =  251 bits (640), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 177/252 (70%), Gaps = 6/252 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L I++L+AKI   D EI++G+NL V+   V AIMGPNGSGKSTL+++++GH  YE+T G+
Sbjct: 11  LVIRDLQAKI--DDKEILKGVNLTVQHGTVHAIMGPNGSGKSTLAHIIAGHPGYEVTGGE 68

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQR--KARNEKELLI 119
           I YKG+++L+  + ER+  G+FLAFQYPV +PG+ +  FL+ A+N  R  + ++ KE  I
Sbjct: 69  IWYKGQNVLELDVDERSKLGLFLAFQYPVSVPGVTVANFLRAAMNAHRAEEGKDPKETSI 128

Query: 120 P--DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           P   F + +R+  A L ++    +R LN GFSGGEKK  EILQM LL P++ I+DETDSG
Sbjct: 129 PVAQFRKLMREGMATLEMDEGFARRYLNEGFSGGEKKRLEILQMTLLAPTMAIMDETDSG 188

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL+I A GVN L       L+ITHYQRLLNYIKP  + V+  G+I++ G   +AL+
Sbjct: 189 LDIDALRIVANGVNRLSGPQMGALVITHYQRLLNYIKPQFVSVMMEGRIVREGGPELALE 248

Query: 238 LEENGYAELIKE 249
           LEE GY  L +E
Sbjct: 249 LEEKGYDWLREE 260


>gi|296136903|ref|YP_003644145.1| FeS assembly ATPase SufC [Thiomonas intermedia K12]
 gi|295797025|gb|ADG31815.1| FeS assembly ATPase SufC [Thiomonas intermedia K12]
          Length = 270

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 125/246 (50%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I+ LRA+I      ++ G++L + P EVVAIMGPNGSGK+TL+ +L+G + Y +T G
Sbjct: 15  LLQIRGLRAEI--DGKRVLDGIDLDIAPGEVVAIMGPNGSGKTTLAQVLAGRELYRVTGG 72

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L     ERA  G+FLAFQYPVEIPG+  +  LK ALN QRK R   EL   
Sbjct: 73  TVRFDGQDLLALPPQERALAGLFLAFQYPVEIPGLSNVYLLKAALNAQRKHRGLPELDAM 132

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+ +  ELG++   L+R +N GFSGGEKK  ++LQM LL+P L ILDETDSGLD+
Sbjct: 133 EFLQQVKALMRELGMDEKFLQRGVNEGFSGGEKKRNDMLQMALLQPRLAILDETDSGLDV 192

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ AQ VNA+RS +R+ ++ITHY+RLL  I PD +HVL  G+I+ +G   +A  +E 
Sbjct: 193 DALKVVAQAVNAMRSPERALVLITHYERLLEVIVPDRVHVLWQGRIVASGGAELARRIER 252

Query: 241 NGYAEL 246
            GYA L
Sbjct: 253 EGYAWL 258


>gi|118411106|ref|YP_874500.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Thalassiosira pseudonana]
 gi|224015808|ref|XP_002297552.1| plastid protein [Thalassiosira pseudonana CCMP1335]
 gi|116739853|gb|ABK20723.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Thalassiosira pseudonana]
 gi|220967816|gb|EED86192.1| plastid protein [Thalassiosira pseudonana CCMP1335]
          Length = 251

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 172/246 (69%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL+A I   +TEI++ LNL +   E+ AIMGPNGSGKST S +++GH  YE+ +G
Sbjct: 7   ILEIKNLKASI--NNTEILKNLNLTINRGEIHAIMGPNGSGKSTFSKIIAGHPAYEVLSG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI +KG SILD    +R+  GIFLAFQYP+EIPG+    FL++A N ++K  N+ E+   
Sbjct: 65  DIFFKGSSILDLDPEKRSHLGIFLAFQYPIEIPGVSNEDFLRLAYNSKQKFYNKPEVDPI 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +    + ++   L R +N GFSGGEKK  EILQM LLE  L ILDETDSGLDI
Sbjct: 125 EFFSIINEKLNLVNMSSVFLSRNVNEGFSGGEKKRNEILQMILLESELSILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + G+N     +++ ++ITHYQRLL+YIKPD +HV+ NGKIIKTG   +A +LE 
Sbjct: 185 DALKIISNGINTFMDSNKAIILITHYQRLLDYIKPDYVHVMQNGKIIKTGTADLAKELEI 244

Query: 241 NGYAEL 246
            GY  L
Sbjct: 245 KGYEWL 250


>gi|116327450|ref|YP_797170.1| ATP-binding component of an ABC transporter complex, Fe-S cluster
           assembly [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116331937|ref|YP_801655.1| ATP-binding component of an ABC transporter complex, Fe-S cluster
           assembly [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116120194|gb|ABJ78237.1| ATP-binding component of an ABC transporter complex, Fe-S cluster
           assembly [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116125626|gb|ABJ76897.1| ATP-binding component of an ABC transporter complex, Fe-S cluster
           assembly [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 255

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 176/253 (69%), Gaps = 8/253 (3%)

Query: 1   MLEIKNLRAKIVDTDT----EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYE 56
           +L+I++LRA I   D+    EI++G+NL +   E+ AIMGPNGSGKSTLS ++ GH  Y+
Sbjct: 4   ILKIQDLRAGIQIGDSGEIKEIVKGVNLTIRSGEIHAIMGPNGSGKSTLSNVIMGHPKYQ 63

Query: 57  ITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
           + +GDIL++G+SILD    ERA  GIFL FQYP  IPG+ +  FLK  +   R     KE
Sbjct: 64  VLSGDILFEGKSILDLPTNERARLGIFLCFQYPTSIPGVTIGSFLKTVIKSVRG----KE 119

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
           L + +F ++++   A L I    + R +N GFSGGEKK  EILQM LL+P L +LDETDS
Sbjct: 120 LPVREFRKELKDAMAALDIPESFIARYVNDGFSGGEKKRNEILQMSLLKPKLSVLDETDS 179

Query: 177 GLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIAL 236
           GLDIDAL+I ++G+N  ++ ++S L+ITHYQR+LNY+ PD +HV   GKI+KTG   +AL
Sbjct: 180 GLDIDALRIVSEGINRNKTPEKSILLITHYQRMLNYVAPDFVHVFAKGKILKTGTRELAL 239

Query: 237 DLEENGYAELIKE 249
           +LEE GY  ++ E
Sbjct: 240 ELEEKGYDRVLVE 252


>gi|91216151|ref|ZP_01253119.1| ABC transporter, ATP-binding protein [Psychroflexus torquis ATCC
           700755]
 gi|91185668|gb|EAS72043.1| ABC transporter, ATP-binding protein [Psychroflexus torquis ATCC
           700755]
          Length = 252

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 186/249 (74%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL A +     +I++G++L++   EV AIMGPNGSGKSTL+ +++G++D+E+T G
Sbjct: 1   MLKIKNLHASV--DGVKILKGIDLEINAGEVHAIMGPNGSGKSTLASVIAGNEDFEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL++  +I + S  ERA KGIFL+FQYP+EIPG+ +  F+K ++N+ RK+R +K++   
Sbjct: 59  DILFEKANISELSPEERAHKGIFLSFQYPIEIPGVSVTNFIKTSINQVRKSRGQKDMPAN 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +  +K+R+ +A L ++   L R LN GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 EMLKKIREKSALLDMDRKFLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + GVN LR++  + L+ITHYQRLL+Y+ PD +HVL +GKI+KTG   +A +LEE
Sbjct: 179 DALRIVSDGVNRLRNKGNATLVITHYQRLLDYVVPDVVHVLVDGKIVKTGGKELAKELEE 238

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 239 RGYDWLKEE 247


>gi|320547992|ref|ZP_08042273.1| FeS assembly ATPase SufC [Streptococcus equinus ATCC 9812]
 gi|320447338|gb|EFW88100.1| FeS assembly ATPase SufC [Streptococcus equinus ATCC 9812]
          Length = 256

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 180/249 (72%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GE+ILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +++++ + 
Sbjct: 61  EILLDGENILDLEVDERARLGLFLAMQYPAEIPGITNAEFIRAAMNAGKE--DDEKISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMEFLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R ++   +IITHYQRLLNYIKPD +H++ +G+++ +G   +A  LE+
Sbjct: 179 DALKVVSKGVNAMRGENFGAMIITHYQRLLNYIKPDVVHIMMDGRVVLSGGEELAARLEK 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAKIAEE 247


>gi|322381723|ref|ZP_08055680.1| sulfur mobilizing ABC protein ATPase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154313|gb|EFX46632.1| sulfur mobilizing ABC protein ATPase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 277

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 172/248 (69%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L I+ L+A I     EI++GL+L+V+  E+ AIMGPNG+GKSTL+  L GH  YE+T G 
Sbjct: 7   LTIEGLKATI--EGKEILKGLDLEVKGGEIHAIMGPNGTGKSTLASTLMGHPKYEVTEGS 64

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +   GE +LD ++ ERA  G+FLA QYP EI G+    FL+ A+N +R   NE  L+   
Sbjct: 65  VTLDGEDVLDMAVDERARAGLFLAMQYPSEIAGVTNADFLRSAINVRRGEGNEISLI--K 122

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R++     +L +N +   R LN GFSGGEKK  EILQM +LEP + ILDE DSGLDID
Sbjct: 123 FIRQLEAKMKDLEMNPEFAHRYLNEGFSGGEKKRNEILQMMMLEPRVVILDEIDSGLDID 182

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL+I A+GVNALRS+DR FLIITHYQRLLNY+KPD +HV+  G+I+K+G   +A  LE  
Sbjct: 183 ALRIVAEGVNALRSEDRGFLIITHYQRLLNYVKPDFVHVMMQGRIVKSGGPELAERLENE 242

Query: 242 GYAELIKE 249
           GY + +KE
Sbjct: 243 GY-DWVKE 249


>gi|303235700|ref|ZP_07322307.1| FeS assembly ATPase SufC [Prevotella disiens FB035-09AN]
 gi|302484147|gb|EFL47135.1| FeS assembly ATPase SufC [Prevotella disiens FB035-09AN]
          Length = 250

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL A I D   EI++G++L ++  E+ AIMGPNGSGKSTLS +L+G+  Y +T G
Sbjct: 1   MLEVKNLHATIADK--EILKGIDLTIKDGEIHAIMGPNGSGKSTLSAVLTGNPLYTVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++ G+ +L+    ERA++GIFL+FQYPVEIPG+ M  F+K A+N +RK +  + L   
Sbjct: 59  SAVFNGKDLLEMGADERANEGIFLSFQYPVEIPGVSMTNFMKAAINAKRKYQGLEPLKAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    +G++  +  R +N GFSGGEKK  EI QM +L+P L ILDETDSGLD+
Sbjct: 119 DFMKLMREKRDLVGLDSKLSHRSVNEGFSGGEKKRNEIFQMAMLQPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A GVN + + + S ++ITHY RLL+ IKPD +H+L+ G+I+KTG   +A ++E+
Sbjct: 179 DAMRIVADGVNKMHTSETSTIVITHYDRLLDMIKPDVVHILYKGRIVKTGTAELAREIEK 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|215400780|ref|YP_002327541.1| ABC ATPase [Vaucheria litorea]
 gi|194441230|gb|ACF70958.1| ABC ATPase [Vaucheria litorea]
          Length = 250

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 172/246 (69%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL   I   + EI++G+N  +   E+ AIMGPNGSGKST S +L+GH  Y+IT+G
Sbjct: 6   MLEVKNLHVTI--DNIEILKGVNFSLNSGEIHAIMGPNGSGKSTFSKILAGHPSYKITSG 63

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILY GE+I D+    RA KGIFLAFQYPVEIPG+    FL++A N ++KA  + EL   
Sbjct: 64  EILYNGENICDFDPDIRAHKGIFLAFQYPVEIPGVNNEDFLRLAYNSRQKALQQNELEPL 123

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   + +    + ++   L R +N GFSGGEKK  EILQ  LL   L ILDE DSGLDI
Sbjct: 124 KFLEVLVEKLKLVNLDPIFLSRNVNEGFSGGEKKRNEILQFALLNSELGILDEMDSGLDI 183

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  ++ VN L+++D+S ++ITHY+RLL YIKPD IHV+ NGKIIKTGD ++A  LE+
Sbjct: 184 DALKTISEAVNLLKTKDKSIILITHYKRLLEYIKPDFIHVMMNGKIIKTGDITLANLLEK 243

Query: 241 NGYAEL 246
           NGY  L
Sbjct: 244 NGYEWL 249


>gi|187734994|ref|YP_001877106.1| FeS assembly ATPase SufC [Akkermansia muciniphila ATCC BAA-835]
 gi|187425046|gb|ACD04325.1| FeS assembly ATPase SufC [Akkermansia muciniphila ATCC BAA-835]
          Length = 252

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 175/248 (70%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L IKNL A +    TEI++G+NL++   EV AIMGPNGSGKSTLS +L GH DYE+T G+
Sbjct: 3   LVIKNLHANV--QGTEILKGINLEIPKGEVHAIMGPNGSGKSTLSKVLCGHPDYEVTEGE 60

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
               G+++LD SI ER+  G+FLAFQYP+E+PG+    FL+ A+  Q +  + +EL    
Sbjct: 61  AWLDGQNLLDMSIDERSRAGLFLAFQYPMEVPGVSNANFLRAAM--QARMPHGEELDAVT 118

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F + +     +LG+      R +N GFSGGEKK  E+LQM LL+P   ILDETDSGLDID
Sbjct: 119 FYKTLYAKMDQLGMARKFTSRAVNEGFSGGEKKRNEVLQMLLLDPLYAILDETDSGLDID 178

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL+I ++GVN++RS  RSFL+ITHY+RLL+YI+PD +HVL +G+I++TG   +  +LE  
Sbjct: 179 ALRIVSEGVNSMRSPFRSFLVITHYKRLLDYIRPDVVHVLADGRIVRTGGGELVDELESR 238

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 239 GY-EFLKE 245


>gi|329964516|ref|ZP_08301570.1| FeS assembly ATPase SufC [Bacteroides fluxus YIT 12057]
 gi|328524916|gb|EGF51968.1| FeS assembly ATPase SufC [Bacteroides fluxus YIT 12057]
          Length = 251

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 175/249 (70%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL +   EV A+MG NG+GKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTIRDGEVHALMGQNGAGKSTLSNVLVGHPAYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L  S  +RA +G+FL+FQ PVEIPG+ M+ F++ A+NEQRK R+   L   
Sbjct: 59  SVTFNGKDLLAMSPEDRAHEGVFLSFQSPVEIPGVSMVNFMRAAVNEQRKYRHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+  ILDETDSGLD+
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPTFAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G N L++   S ++ITHYQRLL+Y+KPDT+HVL  G+I+KTG   +A ++E+
Sbjct: 179 DALRIVADGFNKLKTPQTSAMVITHYQRLLDYLKPDTVHVLLGGRIVKTGGPELAQEIEK 238

Query: 241 NGYAELIKE 249
            G+  + KE
Sbjct: 239 RGFDWIKKE 247


>gi|251798588|ref|YP_003013319.1| FeS assembly ATPase SufC [Paenibacillus sp. JDR-2]
 gi|247546214|gb|ACT03233.1| FeS assembly ATPase SufC [Paenibacillus sp. JDR-2]
          Length = 259

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 171/246 (69%), Gaps = 5/246 (2%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           I  L+A+I     EI++G+NL+++  E+ AIMGPNG+GKSTL+  L GH  YE+T G   
Sbjct: 7   IDGLKAEI--EGKEILKGINLEIKGGEIHAIMGPNGTGKSTLASALMGHPKYEVTEGSAT 64

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFT 123
             GE +L+ S+ ERA  G+FLA QYP EIPG+    FL+ A+N +R+  +E  L+   F 
Sbjct: 65  IDGEDLLEMSVDERARAGLFLAMQYPSEIPGVTNSDFLRSAINARREEGSEISLI--KFI 122

Query: 124 RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDAL 183
           R++ K   EL +N +   R LN GFSGGEKK  EILQM +LEP + +LDE DSGLDIDAL
Sbjct: 123 RQMEKKMKELEMNPEFAHRYLNEGFSGGEKKRNEILQMAMLEPKIVVLDEIDSGLDIDAL 182

Query: 184 KIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGY 243
           KI + GVNA+RS+DR FLIITHYQRLLNYI PD +HV+  G+I+K+G   +A  LE  GY
Sbjct: 183 KIVSNGVNAMRSEDRGFLIITHYQRLLNYITPDFVHVMMQGRIVKSGGPELAERLENEGY 242

Query: 244 AELIKE 249
            + +KE
Sbjct: 243 -DWVKE 247


>gi|294341074|emb|CAZ89471.1| ATP-dependent transporter sufC [Thiomonas sp. 3As]
          Length = 259

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/246 (50%), Positives = 171/246 (69%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+I+ L+A+I      ++ G++L V P EV AIMGPNGSGKSTL+ +L+G   Y ++ G
Sbjct: 1   MLQIRGLQAEI--DGKRVLDGIDLDVAPGEVAAIMGPNGSGKSTLAQVLAGRDLYRVSGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L     ERA  G+FLAFQYPVEIPG+  +  LK ALN QRK R   EL   
Sbjct: 59  SVRFDGQDLLALPPQERALAGLFLAFQYPVEIPGLSNVYLLKAALNAQRKHRGLPELDAM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++V+ +  ELG++   L+R +N GFSGGEKK  ++LQM LL+P L ILDETDSGLD+
Sbjct: 119 EFLQRVKALMRELGMDEKFLQRGVNEGFSGGEKKRNDMLQMALLQPRLAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  AQ VNA+RS +R+F++ITHY+RLL +I PD +HVL  G+ + +G   +A  +E 
Sbjct: 179 DALKAVAQAVNAMRSPERAFVLITHYERLLEHIVPDRVHVLWQGRFVASGGPELARRIER 238

Query: 241 NGYAEL 246
            GYA L
Sbjct: 239 EGYAWL 244


>gi|297620330|ref|YP_003708467.1| FeS assembly ATPase SufC [Waddlia chondrophila WSU 86-1044]
 gi|297375631|gb|ADI37461.1| FeS assembly ATPase SufC [Waddlia chondrophila WSU 86-1044]
          Length = 255

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 175/248 (70%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL A I      +++G++L+V P E+ AIMGPNG+GKSTL+ +L+GH  YE+T G
Sbjct: 2   LLEIKNLSASI--DGKPLLKGVDLEVNPGEIHAIMGPNGAGKSTLAKVLAGHPSYEVTGG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG++IL+    ERA  G+F++FQYPVEIPG+  MQFL  + N  +KA N+ EL   
Sbjct: 60  EVWFKGQNILEMEPDERAQLGLFMSFQYPVEIPGVSNMQFLHASYNAIKKASNQPELEEG 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + + +    + I  +  +R LN GFSGGEKK  EILQM ++ PSL ILDETDSGLDI
Sbjct: 120 DFEKLLDEKMKIMDIRPEFKQRNLNEGFSGGEKKRNEILQMAVINPSLAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++  A GVN L + D   ++ITHYQRLL++I+P  +HV+ NGK+I++G   +A+ LE 
Sbjct: 180 DAMRTVAGGVNHLMNDDMGLILITHYQRLLDHIRPHKVHVMVNGKLIESGGPELAIKLEN 239

Query: 241 NGYAELIK 248
            GY  L+K
Sbjct: 240 EGYDWLVK 247


>gi|218289789|ref|ZP_03493989.1| FeS assembly ATPase SufC [Alicyclobacillus acidocaldarius LAA1]
 gi|258510979|ref|YP_003184413.1| FeS assembly ATPase SufC [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218240080|gb|EED07265.1| FeS assembly ATPase SufC [Alicyclobacillus acidocaldarius LAA1]
 gi|257477705|gb|ACV58024.1| FeS assembly ATPase SufC [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 261

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 170/246 (69%), Gaps = 4/246 (1%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           ++ LR ++     EI++G++L +   E+ AIMGPNG+GKSTL+  + GH  YE+TAG+I 
Sbjct: 8   VRGLRVQV--EGKEILKGVDLHIRGGEIHAIMGPNGTGKSTLASAIMGHPHYEVTAGEIW 65

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFT 123
             G+++L+ S+ ERA  G+FLA QYP E+PG+    F++ ALN +R   NE  +L   F 
Sbjct: 66  LDGQNVLEMSVDERARAGLFLAMQYPAEVPGVSNANFIRTALNARRGEGNEIPVL--QFH 123

Query: 124 RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDAL 183
           R++ +   EL I+    +R LN GFSGGEKK  EILQM +LEP + ILDE DSGLDIDAL
Sbjct: 124 RRLVQKMKELSIDPSFAERYLNEGFSGGEKKRNEILQMAMLEPRIAILDEIDSGLDIDAL 183

Query: 184 KIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGY 243
           KI A GVN LRS +  FLIITHYQRLLNYI PD +HV+  G+I+K+GD  +A +LE  GY
Sbjct: 184 KIVANGVNQLRSDNIGFLIITHYQRLLNYIVPDVVHVMMQGRIVKSGDAKLAEELEAKGY 243

Query: 244 AELIKE 249
             L +E
Sbjct: 244 DWLKQE 249


>gi|46445824|ref|YP_007189.1| ABC transporter ATP-binding protein [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|46399465|emb|CAF22914.1| probable ABC transporter ATP-binding protein sufC [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 254

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 177/248 (71%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IK L A +    T I++G+NL ++  E+ AIMGPNG+GKSTL+ +L+GH  YE+T G
Sbjct: 1   MLKIKELTATV--EGTPILKGVNLHIKTGEIHAIMGPNGAGKSTLAKVLAGHPAYEVTGG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ +KG+++L+    ERA  G+F++FQYPVEIPG+   QFL+IALN + KA  + EL   
Sbjct: 59  EVWFKGQNLLELEPEERAHLGLFMSFQYPVEIPGVSNSQFLQIALNAKLKAEGKSELTTA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R + +   ++ I  ++  R +N  FSGGEKK  EILQM +L P+L +LDETDSGLDI
Sbjct: 119 EFERLLNEKMKQMEIKPELRSRNVNENFSGGEKKRNEILQMAVLNPNLALLDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+++ A+GVN L + +   L+ITHYQRLL+YIKP  +HV+  GKI+++G   +AL+LE 
Sbjct: 179 DAMRVVAKGVNQLMNPEMGLLLITHYQRLLDYIKPHFVHVMLGGKIVQSGGPELALELES 238

Query: 241 NGYAELIK 248
            GY  L++
Sbjct: 239 KGYDWLVQ 246


>gi|269837551|ref|YP_003319779.1| FeS assembly ATPase SufC [Sphaerobacter thermophilus DSM 20745]
 gi|269786814|gb|ACZ38957.1| FeS assembly ATPase SufC [Sphaerobacter thermophilus DSM 20745]
          Length = 262

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 175/249 (70%), Gaps = 5/249 (2%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           I+NL A I     EI+RG+NL +   E+ A+MGPNGSGKSTL+Y ++GH +YE+  G +L
Sbjct: 10  IENLHAGI--EGQEILRGVNLTINRGEIHALMGPNGSGKSTLAYAVAGHPNYEVYEGRVL 67

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARN--EKELLIP- 120
           +KGE++L+    ERA  G+FLAFQYP  IPG+ M  FL++A+N  R+AR   E + L P 
Sbjct: 68  FKGENVLEMGPDERAQLGMFLAFQYPTAIPGVTMANFLRLAVNSVRQARGNGEGKPLTPR 127

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F R +R+    L I+     R LN GFSGGEKK AEILQM +LEP   ILDETDSGLDI
Sbjct: 128 EFRRLLREKMELLRIDESFASRYLNEGFSGGEKKRAEILQMAMLEPEFAILDETDSGLDI 187

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  ++GVN++ + + + L+ITHYQRLLNYIKP  +HV+ +G+I+++G   +A  LEE
Sbjct: 188 DALRTVSEGVNSIFNPNMAMLLITHYQRLLNYIKPHFVHVMLDGRIVESGGPELAEALEE 247

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 248 RGYDWLKEE 256


>gi|158334402|ref|YP_001515574.1| FeS assembly ATPase SufC [Acaryochloris marina MBIC11017]
 gi|158304643|gb|ABW26260.1| FeS assembly ATPase SufC [Acaryochloris marina MBIC11017]
          Length = 262

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 171/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++NL A +    T I++GLNL+++  E+ AIMGPNGSGKST S +L+GH  Y +T G
Sbjct: 9   ILSVRNLTADV--DGTPILKGLNLEIKAGEIHAIMGPNGSGKSTFSKVLAGHPAYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +++YKG+++L+    ER+  G+FLAFQYP+EIPG+  + FL+++ N +R+    +EL   
Sbjct: 67  EVIYKGQNLLELEPEERSRSGVFLAFQYPLEIPGVSNLDFLRVSFNSKRQHEGLEELDAF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L R +N GFSGGEKK  EILQM LLEP+L ILDETDSGLDI
Sbjct: 127 DFDDLVRERLDVVKMDPAFLDRSVNEGFSGGEKKRNEILQMALLEPTLAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVN L   + + L+ITHYQRLL+YI PD +HV+  GKI+ TG   +A +LE 
Sbjct: 187 DALKIVANGVNQLAKPENATLMITHYQRLLDYIVPDFVHVMAEGKILTTGGKELAQELEA 246

Query: 241 NGY 243
            GY
Sbjct: 247 KGY 249


>gi|317967991|ref|ZP_07969381.1| FeS assembly ATPase SufC [Synechococcus sp. CB0205]
          Length = 258

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 172/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI++L A++   D EI++G+NL +   E+ A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 2   LLEIRDLHARV--EDKEILKGVNLTIRAGEIHAVMGRNGSGKSTLSKVLAGHPAYTVTGG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+GE++L+    +RA  G+FL FQYPVEIPG+  ++FL++A N +R  + E+EL   
Sbjct: 60  SVTYRGENLLELDPEQRARTGVFLGFQYPVEIPGVSNLEFLRVATNARRAQKGEEELDTF 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   VR+    + ++   L R +N GFSGGEKK  EILQM LL+P + ILDETDSGLDI
Sbjct: 120 AFEDLVRERLQVVQMDPAFLDRSVNEGFSGGEKKRNEILQMALLDPLVAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S D + L+ITHYQRLL+ I PD +HV+  G++++TG   +AL+LEE
Sbjct: 180 DALRIVAGGVNQLASPDNATLLITHYQRLLDAITPDYVHVMAAGRMLRTGGKELALELEE 239

Query: 241 NGY 243
            GY
Sbjct: 240 RGY 242


>gi|312865590|ref|ZP_07725815.1| FeS assembly ATPase SufC [Streptococcus downei F0415]
 gi|311098858|gb|EFQ57077.1| FeS assembly ATPase SufC [Streptococcus downei F0415]
          Length = 256

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 177/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   I     EI++GLNL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVSI--EGKEILKGLNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+ G+ IL+ +  ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +++++ I 
Sbjct: 61  QILFDGQDILELATDERARLGLFLAMQYPAEIPGITNAEFIRAAMNAGKE--DDEKVSIR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 QFITKLDEKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYIKPD +H++ +G+I+ TGD  +A  LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYIKPDVVHIMMDGRIVMTGDAQLAARLEK 238

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 239 EGYAQLAEE 247


>gi|251781769|ref|YP_002996071.1| ATP-dependent transporter [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390398|dbj|BAH80857.1| ATP-dependent transporter [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 256

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEINNLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  +   +E ++ + 
Sbjct: 61  EILLDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFMRAAMNAGKA--DEDKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+    A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDDKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD S+A+ LE+
Sbjct: 179 DALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDASLAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 239 EGYAGIAQE 247


>gi|332522483|ref|ZP_08398735.1| FeS assembly ATPase SufC [Streptococcus porcinus str. Jelinkova
           176]
 gi|332313747|gb|EGJ26732.1| FeS assembly ATPase SufC [Streptococcus porcinus str. Jelinkova
           176]
          Length = 256

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  +   +E+++ + 
Sbjct: 61  EVLFDGINILELEVDERARMGLFLAMQYPSEIPGITNAEFMRAAMNAGKD--DEQKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDQKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRQKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALAARLEK 238

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 239 EGYAGIAEE 247


>gi|171910583|ref|ZP_02926053.1| ABC transporter ATP-binding protein [Verrucomicrobium spinosum DSM
           4136]
          Length = 246

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 126/240 (52%), Positives = 169/240 (70%), Gaps = 4/240 (1%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           I++L A I   D EI++G +L+V+P EV AIMGPNGSGKSTLS +L GH+DYE+T+G + 
Sbjct: 5   IQDLHACI--PDREILKGFSLEVKPGEVHAIMGPNGSGKSTLSKVLCGHEDYEVTSGSVT 62

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFT 123
             GE +L   +  R+  G+FLAFQYP EIPG+    F++ AL  Q +    +EL    + 
Sbjct: 63  LDGEDLLAMEVDARSRAGLFLAFQYPFEIPGVSNANFIRAAL--QARLPKGEELDAVAYY 120

Query: 124 RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDAL 183
           +K+     EL ++     R +N GFSGGEKK  EILQ+ +LEP   ILDETDSGLDIDAL
Sbjct: 121 KKLYSRMDELEMSRSFTARSVNEGFSGGEKKRNEILQLMMLEPKYSILDETDSGLDIDAL 180

Query: 184 KIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGY 243
           K+ +QGVN++RS +R FL+ITHYQRLL+YIKPD +HV+  G+II++G   +AL+LE  GY
Sbjct: 181 KVVSQGVNSMRSPERGFLVITHYQRLLDYIKPDIVHVMVEGRIIRSGGPELALELEAKGY 240


>gi|183221303|ref|YP_001839299.1| ABC transporter ATP binding protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189911394|ref|YP_001962949.1| ABC transporter ATP-binding protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167776070|gb|ABZ94371.1| ATP-binding component of an ABC transporter complex, Fe-S cluster
           assembly [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167779725|gb|ABZ98023.1| ABC-type transport system associated with Fe-S cluster assembly,
           ATPase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 250

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 174/243 (71%), Gaps = 6/243 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI++L A +   D +I+RG+NL +   EV AIMGPNGSGKSTLS ++ GH  Y IT+G
Sbjct: 4   ILEIQSLHANV--GDKQILRGVNLTIGAGEVHAIMGPNGSGKSTLSNVILGHPKYTITSG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL++GESIL  S  ERA  G+FL+FQYP  +PG+ +  FLK  L    KA   K++ + 
Sbjct: 62  DILFRGESILKLSTDERARLGLFLSFQYPTALPGVTIGNFLKSIL----KAHRGKDVPVK 117

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F ++++     L +    + R +N GFSGGEKK AEILQM LL+P L ILDETDSGLDI
Sbjct: 118 EFKQELKTAMDLLEVPQSFIGRYVNDGFSGGEKKRAEILQMNLLKPVLSILDETDSGLDI 177

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I ++G+NA R+ +RS L+ITHYQR+LNYI PD +HV  +G+I++TG   ++L LEE
Sbjct: 178 DALRIVSEGINANRNPERSILLITHYQRMLNYIVPDFVHVFADGRILETGGKDLSLKLEE 237

Query: 241 NGY 243
            GY
Sbjct: 238 VGY 240


>gi|254442610|ref|ZP_05056086.1| FeS assembly ATPase SufC [Verrucomicrobiae bacterium DG1235]
 gi|198256918|gb|EDY81226.1| FeS assembly ATPase SufC [Verrucomicrobiae bacterium DG1235]
          Length = 255

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 177/248 (71%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL   I   D +I++  +L V   EV AIMGPNG+GKSTL+  ++GH +YE+T+G+
Sbjct: 5   LEIKNLNVSI--GDKQILKDFSLTVPKGEVHAIMGPNGTGKSTLAKAMAGHPEYEVTSGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           ++  GE+I++    ER+  G+FLAFQYP+EIPG+ +  F++ ALN   +  +++EL  PD
Sbjct: 63  VIIDGENIMEMEADERSRAGLFLAFQYPMEIPGVTIANFIRAALNA--RLPDDEELNAPD 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           + +++      L I+     R +N GFSGGEKK  EILQM +L P   +LDETDSGLDID
Sbjct: 121 YYKELYAKMDLLKIDRKFTARAVNDGFSGGEKKRCEILQMAMLNPKYAVLDETDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVN++R  +   L+ITHYQRLL+YI PD +HV+++G+I+K+GD ++AL+LE  
Sbjct: 181 ALKVVAEGVNSMRGPNLGALVITHYQRLLDYIVPDVVHVMYDGRIVKSGDKNLALELESK 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|11467510|ref|NP_043656.1| sulfate ABC transporter protein [Odontella sinensis]
 gi|267152|sp|Q00830|ABCX_ODOSI RecName: Full=Probable ATP-dependent transporter ycf16
 gi|11938|emb|CAA43151.1| unnamed protein product [Odontella sinensis]
 gi|1185205|emb|CAA91688.1| ORF251 [Odontella sinensis]
          Length = 251

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 174/246 (70%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL+A I   + EI++ LNLK+   E+ AIMGPNGSGKST S +L+GH  Y I +G
Sbjct: 7   ILEIKNLKACI--NENEILKDLNLKIHKGEIHAIMGPNGSGKSTFSKVLAGHPAYNILSG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+KG SIL+    ER+  GIFLAFQYP+EIPG+    FL++A N ++K  N+ E+   
Sbjct: 65  DILFKGSSILNLDPEERSHMGIFLAFQYPIEIPGVSNEDFLRLAYNSKQKFLNKDEVDPI 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   + +    + ++   L R +N GFSGGEKK  EILQM LL+  L ILDETDSGLDI
Sbjct: 125 SFFTIINEKLKLVDMSPVFLSRNVNEGFSGGEKKRNEILQMILLDSELSILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++G+N   +Q+++ ++ITHYQRLL+Y++P+ +HV+ NGKIIKTG   +A +LE 
Sbjct: 185 DALKIISKGINTFMNQNKAIILITHYQRLLDYVQPNYVHVMQNGKIIKTGTADLAKELES 244

Query: 241 NGYAEL 246
            GY  L
Sbjct: 245 KGYEWL 250


>gi|189220478|ref|YP_001941118.1| cysteine desulfurase activator ATPase [Methylacidiphilum infernorum
           V4]
 gi|189187336|gb|ACD84521.1| Cysteine desulfurase activator ATPase [Methylacidiphilum infernorum
           V4]
          Length = 252

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 131/248 (52%), Positives = 170/248 (68%), Gaps = 4/248 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L+I+NL   I     EI++G++L++ P EV AIMGPNGSGKSTLS LL+GH DYEI +G 
Sbjct: 3   LKIENLHGGI--GGKEIVQGVSLEIAPGEVHAIMGPNGSGKSTLSKLLTGHPDYEIYSGS 60

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           I   GES+L+    ERA KG+F+AFQYP EIPG+ +  FL+ AL  Q +    K + + D
Sbjct: 61  IEMDGESLLEMEPDERARKGLFMAFQYPCEIPGVTVANFLRAAL--QARLPEGKTINVTD 118

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +++     +L ++     R +N GFSGGEKK  EILQM +L+P   ILDETDSGLDID
Sbjct: 119 FYKELYAAMEKLSMDRKFSSRYVNEGFSGGEKKRNEILQMAVLKPKYAILDETDSGLDID 178

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALKI A GVNAL+      L+ITHYQRLLNYI PD +HV+  GKI+ +G   +AL LEE 
Sbjct: 179 ALKIVANGVNALKGPQLGILLITHYQRLLNYIIPDYVHVMVKGKIVASGTKELALRLEEK 238

Query: 242 GYAELIKE 249
           GY++  +E
Sbjct: 239 GYSQFEEE 246


>gi|167764127|ref|ZP_02436254.1| hypothetical protein BACSTE_02510 [Bacteroides stercoris ATCC
           43183]
 gi|167698243|gb|EDS14822.1| hypothetical protein BACSTE_02510 [Bacteroides stercoris ATCC
           43183]
          Length = 251

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL +   EV A+MG NG+GKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTIRDGEVHALMGQNGAGKSTLSNVLVGHPAYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L  S  +RA +G+FL+FQ PVEIPG+ M+ F++ A+NEQRK R+   L   
Sbjct: 59  TVTFNGKDLLAMSPEDRAHEGVFLSFQTPVEIPGVSMVNFMRAAVNEQRKYRHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+  ILDETDSGLD+
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPTFAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G N L++   S ++ITHYQRLL+Y+KPDT+HVL  G+I+KTG   +A ++E 
Sbjct: 179 DALRIVADGFNKLKTPQTSAMVITHYQRLLDYLKPDTVHVLLGGRIVKTGGPELAKEIEA 238

Query: 241 NGYAELIKE 249
            G+  + KE
Sbjct: 239 RGFDWIKKE 247


>gi|219847881|ref|YP_002462314.1| FeS assembly ATPase SufC [Chloroflexus aggregans DSM 9485]
 gi|219542140|gb|ACL23878.1| FeS assembly ATPase SufC [Chloroflexus aggregans DSM 9485]
          Length = 259

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/250 (51%), Positives = 176/250 (70%), Gaps = 6/250 (2%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           IK+L A+I   D EI+RG+NL V    + AIMGPNGSGKSTLSY+++GH  YE+T+G+I 
Sbjct: 7   IKDLYARI--GDKEILRGVNLTVRQGTIHAIMGPNGSGKSTLSYIIAGHPAYEVTSGEIW 64

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQR--KARNEKELLIP- 120
           YKG ++L+    ER+  G+FLAFQYPV +PG+ +  FL+ A+N  R  + ++ KE  IP 
Sbjct: 65  YKGHNLLELEPDERSRLGVFLAFQYPVAVPGVTVANFLRSAINAHRAEEGKDPKETAIPA 124

Query: 121 -DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD 179
            +F + +R+    L ++    +R LN GFSGGEKK  EILQM LL+PS+ +LDETDSGLD
Sbjct: 125 AEFRKLLREGLNLLEMDESFARRYLNDGFSGGEKKRLEILQMMLLKPSMAVLDETDSGLD 184

Query: 180 IDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLE 239
           IDAL+I A GVN +       L+ITHYQRLLNYIKP+ + V+ +G+I++ G   +AL+LE
Sbjct: 185 IDALRIVANGVNRMAGPHMGVLVITHYQRLLNYIKPNVVSVMMDGRIVREGGPELALELE 244

Query: 240 ENGYAELIKE 249
           E GY  L +E
Sbjct: 245 EKGYDWLREE 254


>gi|148654869|ref|YP_001275074.1| FeS assembly ATPase SufC [Roseiflexus sp. RS-1]
 gi|148566979|gb|ABQ89124.1| FeS assembly ATPase SufC [Roseiflexus sp. RS-1]
          Length = 260

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 132/254 (51%), Positives = 174/254 (68%), Gaps = 8/254 (3%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L IK+L   +   + EI++G+NL V    + AIMGPNGSGKSTL+Y L GH  Y +T G+
Sbjct: 5   LVIKDLHVSV--EEKEILKGVNLTVRAGTIHAIMGPNGSGKSTLAYTLMGHPGYIVTGGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQR--KARNEKELLI 119
             Y+G++IL+    ER+  G+FLAFQYPV IPG+ +  FL+ A+N  R  + ++ KE  I
Sbjct: 63  AWYRGQNILELEPDERSKLGLFLAFQYPVAIPGVTVANFLRAAINAHRAEEGKDPKETAI 122

Query: 120 P--DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           P   F +++R+    LGI+    +R LN GFSGGEKK  EILQM +LEPS+ I+DETDSG
Sbjct: 123 PMAQFRKQLREQMTALGIDESFARRYLNEGFSGGEKKRIEILQMAMLEPSMAIMDETDSG 182

Query: 178 LDIDALKIAAQGVNAL--RSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIA 235
           LDIDALKI AQGVN L  R  +   L+ITHYQRLLNYIKP  + VL +G+I++ G   +A
Sbjct: 183 LDIDALKIVAQGVNTLYERHPEMGVLVITHYQRLLNYIKPHFVSVLMDGRIVREGGPELA 242

Query: 236 LDLEENGYAELIKE 249
           L+LEE GY  L +E
Sbjct: 243 LELEEKGYDFLREE 256


>gi|329901920|ref|ZP_08272988.1| Iron-sulfur cluster assembly ATPase protein SufC [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548919|gb|EGF33541.1| Iron-sulfur cluster assembly ATPase protein SufC [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 268

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 168/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE++ L A I    T I++ L+  V   EV AIMG NGSGKST + +L+GH  YE+T G
Sbjct: 13  LLEVRGLCASI--NGTPILKDLDFTVRSGEVHAIMGQNGSGKSTFAKVLAGHPAYEVTGG 70

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +L++G  +   +  +RA  G+FLAFQYP+EIPG++  QFL++  N  +K R  +EL   
Sbjct: 71  TVLFEGRDLFALTPEQRARAGMFLAFQYPIEIPGVVNSQFLRLTYNTVQKERGNEELDPL 130

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR     L ++ D L R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 131 EFDDFVRDKMQLLDMSPDFLDRSVNEGFSGGEKKRNEILQMALLEPRLAILDETDSGLDI 190

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+N L ++D + +++THYQRLLNYI PD +HV+  G+IIKTG  ++AL+LE+
Sbjct: 191 DALRIVAHGINQLSTRDNAIVMVTHYQRLLNYIVPDFVHVMDAGRIIKTGGKALALELEQ 250

Query: 241 NGY 243
            GY
Sbjct: 251 RGY 253


>gi|329954147|ref|ZP_08295242.1| FeS assembly ATPase SufC [Bacteroides clarus YIT 12056]
 gi|328528124|gb|EGF55104.1| FeS assembly ATPase SufC [Bacteroides clarus YIT 12056]
          Length = 251

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL +   EV A+MG NG+GKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTIRDGEVHALMGQNGAGKSTLSNVLVGHPAYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L  S  +RA +GIFL+FQ PVEIPG+ M+ F++ A+NEQRK R+   L   
Sbjct: 59  TVTFNGKDLLAMSPEDRAHEGIFLSFQMPVEIPGVSMVNFMRAAVNEQRKYRHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+  ILDETDSGLD+
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPTFAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G N L++   S ++ITHYQRLL+Y+KPDT+HVL  G+I+KTG   +A ++E 
Sbjct: 179 DALRIVADGFNKLKTPRTSAMVITHYQRLLDYLKPDTVHVLLGGRIVKTGGPELAKEIEA 238

Query: 241 NGYAELIKE 249
            G+  + KE
Sbjct: 239 RGFDWIKKE 247


>gi|227539030|ref|ZP_03969079.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770538|ref|ZP_07080417.1| FeS assembly ABC superfamily ATP binding cassette transporter, ABC
           protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|227241086|gb|EEI91101.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|300763014|gb|EFK59831.1| FeS assembly ABC superfamily ATP binding cassette transporter, ABC
           protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 256

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 174/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL A +   D +I++GLNL+V+  EV AIMGPNG+GKSTL  +L+G + YE+T G
Sbjct: 5   MLSIKNLHASV--EDKQILKGLNLEVKAGEVHAIMGPNGAGKSTLGNVLAGRESYEVTDG 62

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             L  G  +LD S  +RA +G+FLAFQYPVEIPG+  + FLK A+N+ R  +    +   
Sbjct: 63  TALLDGVDLLDLSPEDRAREGLFLAFQYPVEIPGVSNINFLKTAVNDIRAYKGLAPMEAK 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V++    +  + ++  R LN GFSGGEKK  EI Q+ +L P L ILDETDSGLDI
Sbjct: 123 EFLQMVKEKQKLVEFSANLANRSLNEGFSGGEKKRNEIFQLAMLNPKLSILDETDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN LRS+D +F++ITHYQRLL+YI PD +HVL+NG+I+K+G   +AL+LEE
Sbjct: 183 DALRVVANGVNQLRSKDNAFVVITHYQRLLDYIVPDFVHVLYNGRIVKSGPKELALELEE 242

Query: 241 NGY 243
            GY
Sbjct: 243 KGY 245


>gi|313890321|ref|ZP_07823953.1| FeS assembly ATPase SufC [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121307|gb|EFR44414.1| FeS assembly ATPase SufC [Streptococcus pseudoporcinus SPIN 20026]
          Length = 256

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+ G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +++++ + 
Sbjct: 61  QILFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFMRAAMNAGKE--DDQKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDQKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRQKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALAARLEK 238

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 239 EGYAGIAEE 247


>gi|148544121|ref|YP_001271491.1| FeS assembly ATPase SufC [Lactobacillus reuteri DSM 20016]
 gi|194467982|ref|ZP_03073968.1| FeS assembly ATPase SufC [Lactobacillus reuteri 100-23]
 gi|148531155|gb|ABQ83154.1| Iron-regulated ABC transporter ATPase subunit SufC [Lactobacillus
           reuteri DSM 20016]
 gi|194452835|gb|EDX41733.1| FeS assembly ATPase SufC [Lactobacillus reuteri 100-23]
          Length = 265

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 177/252 (70%), Gaps = 6/252 (2%)

Query: 2   LEIKNLRAKIVDTDTE----IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           LEIK+L   + D +++    I++G+NLK++  E+ AIMGPNG+GKSTLS  + GH +Y +
Sbjct: 4   LEIKDLHVSVKDEESKEEKEILKGVNLKMKTGEIHAIMGPNGTGKSTLSQTIMGHPNYHV 63

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T GDIL  GESI+D  + ERA KG+FLA QYP EI G+   +FL+ A+N +R    + ++
Sbjct: 64  TQGDILLDGESIVDMPVDERARKGLFLAMQYPAEIQGVTNAEFLRAAINARRP--EDDQI 121

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            + DF +K+ K    L ++  M +R LN GFSGGEKK  EILQ+ ++EPS  ILDE DSG
Sbjct: 122 SVMDFIKKLDKNLELLDMSQSMTERYLNEGFSGGEKKRNEILQLLMIEPSFAILDEIDSG 181

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN++R  +   LIITHYQRLLNYI PDT+HV+  G+I+KTG   +A  
Sbjct: 182 LDIDALKVVSKGVNSMRGDNFGSLIITHYQRLLNYIVPDTVHVMMGGRIVKTGGPDLAKK 241

Query: 238 LEENGYAELIKE 249
           LE+ GYA L  E
Sbjct: 242 LEDEGYAGLRDE 253


>gi|318040528|ref|ZP_07972484.1| FeS assembly ATPase SufC [Synechococcus sp. CB0101]
          Length = 256

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 172/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI++L A++   D  I++G+NL +   E+ A+MG NGSGKSTLS +L+GH  Y +T+G
Sbjct: 1   MLEIRDLHARV--EDKAILKGVNLTIRAGEIHAVMGRNGSGKSTLSKVLAGHPAYTVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+GE++LD    +RA  G+FL FQYPVEIPG+  ++FL++A N +R+ +  +EL   
Sbjct: 59  SVHYRGENLLDLDPEQRARIGVFLGFQYPVEIPGVSNLEFLRVATNARRQEQGHEELDTF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   VR+    + ++   L R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 119 AFEDLVRERLKVVQMDPAFLDRSVNEGFSGGEKKRNEILQMALLEPLVAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L + D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LEE
Sbjct: 179 DALRIVAGGVNQLANADNATLLITHYQRLLDAITPDYVHVMAAGRILRTGGKELALELEE 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|227544251|ref|ZP_03974300.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus reuteri CF48-3A]
 gi|300910224|ref|ZP_07127684.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus reuteri SD2112]
 gi|227185764|gb|EEI65835.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus reuteri CF48-3A]
 gi|300892872|gb|EFK86232.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus reuteri SD2112]
          Length = 268

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 177/252 (70%), Gaps = 6/252 (2%)

Query: 2   LEIKNLRAKIVDTDTE----IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           LEIK+L   + D +++    I++G+NLK++  E+ AIMGPNG+GKSTLS  + GH +Y +
Sbjct: 7   LEIKDLHVSVKDEESKEEKEILKGVNLKMKTGEIHAIMGPNGTGKSTLSQTIMGHPNYHV 66

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T GDIL  GESI+D  + ERA KG+FLA QYP EI G+   +FL+ A+N +R    + ++
Sbjct: 67  TKGDILLDGESIVDMPVDERARKGLFLAMQYPAEIQGVTNAEFLRAAINARRP--EDDQI 124

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            + DF +K+ K    L ++  M +R LN GFSGGEKK  EILQ+ ++EPS  ILDE DSG
Sbjct: 125 SVMDFIKKLDKNLELLDMSQSMTERYLNEGFSGGEKKRNEILQLLMIEPSFAILDEIDSG 184

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN++R  +   LIITHYQRLLNYI PDT+HV+  G+I+KTG   +A  
Sbjct: 185 LDIDALKVVSKGVNSMRGDNFGSLIITHYQRLLNYIVPDTVHVMMGGRIVKTGGPDLAKK 244

Query: 238 LEENGYAELIKE 249
           LE+ GYA L  E
Sbjct: 245 LEDEGYAGLRDE 256


>gi|154705564|gb|ABS84208.1| FeS assembly ATPase SufC [Lactobacillus reuteri]
          Length = 265

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 177/252 (70%), Gaps = 6/252 (2%)

Query: 2   LEIKNLRAKIVDTDTE----IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           LEIK+L   + D +++    I++G+NLK++  E+ AIMGPNG+GKSTLS  + GH +Y +
Sbjct: 4   LEIKDLHVSVKDEESKEEKEILKGVNLKMKTGEIHAIMGPNGTGKSTLSQTIMGHPNYHV 63

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T GDIL  GESI+D  + ERA KG+FLA QYP EI G+   +FL+ A+N +R    + ++
Sbjct: 64  TKGDILLDGESIVDMPVDERARKGLFLAMQYPAEIQGVTNAEFLRAAINARRP--EDDQI 121

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            + DF +K+ K    L ++  M +R LN GFSGGEKK  EILQ+ ++EPS  ILDE DSG
Sbjct: 122 SVMDFIKKLDKNLELLDMSQSMTERYLNEGFSGGEKKRNEILQLLMIEPSFAILDEIDSG 181

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN++R  +   LIITHYQRLLNYI PDT+HV+  G+I+KTG   +A  
Sbjct: 182 LDIDALKVVSKGVNSMRGDNFGSLIITHYQRLLNYIVPDTVHVMMGGRIVKTGGPDLAKK 241

Query: 238 LEENGYAELIKE 249
           LE+ GYA L  E
Sbjct: 242 LEDEGYAGLRDE 253


>gi|261855793|ref|YP_003263076.1| FeS assembly ATPase SufC [Halothiobacillus neapolitanus c2]
 gi|261836262|gb|ACX96029.1| FeS assembly ATPase SufC [Halothiobacillus neapolitanus c2]
          Length = 252

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 176/247 (71%), Gaps = 2/247 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL A I   +  I+RG+NL +   EV AIMGPNGSGKSTL  +L G + +E+T G
Sbjct: 4   LLEINNLHANI--GEKPILRGINLSINAGEVHAIMGPNGSGKSTLCQVLGGREGFEVTEG 61

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y G+ +L+ S  ERA+ G+ L FQ+PVEIPG+  +  LK ALN QR A    ++   
Sbjct: 62  SVQYDGQDLLELSTEERATAGLLLGFQHPVEIPGVKNIYLLKEALNAQRAALGLDDIDTF 121

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F ++VR++T  +G++   L R +N GFSGGEKK  EILQM LL+P L +LDETDSGLDI
Sbjct: 122 AFMKQVRELTKTMGMDDAFLHRGVNAGFSGGEKKRNEILQMLLLQPKLALLDETDSGLDI 181

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++G+N LR  DR  +++THYQRLL+Y++PD +H+L+ GKIIK+GD S+AL LE 
Sbjct: 182 DALKIVSEGINRLRGGDRGIVLVTHYQRLLSYVEPDFVHILYQGKIIKSGDKSLALQLEA 241

Query: 241 NGYAELI 247
            GY +++
Sbjct: 242 EGYQDIL 248


>gi|288928615|ref|ZP_06422461.1| FeS assembly ATPase SufC [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329599|gb|EFC68184.1| FeS assembly ATPase SufC [Prevotella sp. oral taxon 317 str. F0108]
          Length = 251

 Score =  247 bits (631), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL AKI   D EI++G+NL ++  E  AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEVRNLHAKI--GDKEILKGINLTIKDGETHAIMGPNGSGKSTLSAVLVGNPMFEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++ G+ +L+    +RA++GIFL+FQYPVEIPG+ M  F++ A+NE+RK +  + +   
Sbjct: 59  TAVFNGKDLLEMKPEDRANEGIFLSFQYPVEIPGVSMTNFMRTAINEKRKYQGLEPMSAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +++    + ++  + +R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 DFIKLMKEKRQIVELDAKLSQRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L+S   S ++ITHY RLL+ I+PD IHVL+ GKI+KT    +A ++E 
Sbjct: 179 DALRIVAEGVNKLKSPSTSTIVITHYDRLLDIIRPDVIHVLYKGKIVKTAGPELAKEIEA 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|260584062|ref|ZP_05851810.1| FeS assembly ATPase SufC [Granulicatella elegans ATCC 700633]
 gi|260158688|gb|EEW93756.1| FeS assembly ATPase SufC [Granulicatella elegans ATCC 700633]
          Length = 256

 Score =  247 bits (631), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 175/248 (70%), Gaps = 4/248 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL   I   D EI++G+NL +   E+ A+MGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 4   LEIKNLHVSI--EDKEILKGVNLTINTGEIHAVMGPNGTGKSTLSAAIMGHPSYEVTEGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  GE++L+  + ERA  G+FLA QYP EI G+   +F++ A+N +R   N+  + + +
Sbjct: 62  ILLDGENVLEMEVDERARAGLFLAMQYPSEIAGVTNAEFMRSAINARRDEDNK--MGVRE 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ +  A L +  +M +R LN GFSGGEKK  EILQ+ ++EPS  ILDE DSGLDID
Sbjct: 120 FIKKLDEKMAILDMPEEMAERYLNEGFSGGEKKRNEILQLMMIEPSFAILDEIDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++GVNA+R ++   LIITHYQRLLNYI+PD +H++ +G+++ TGD ++A  LE  
Sbjct: 180 ALKVVSRGVNAMRGENFGSLIITHYQRLLNYIEPDVVHIMMDGRVVMTGDAALAKRLEAE 239

Query: 242 GYAELIKE 249
           GY  + +E
Sbjct: 240 GYKGISEE 247


>gi|323126575|gb|ADX23872.1| Iron-sulfur cluster assembly ATPase protein SufC [Streptococcus
           dysgalactiae subsp. equisimilis ATCC 12394]
          Length = 256

 Score =  247 bits (631), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEINNLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  +   +E ++ + 
Sbjct: 61  EILLDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFMRAAMNAGKA--DEDKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+    A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDDKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A+ LE+
Sbjct: 179 DALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 239 EGYAGIAQE 247


>gi|218294674|ref|ZP_03495528.1| FeS assembly ATPase SufC [Thermus aquaticus Y51MC23]
 gi|218244582|gb|EED11106.1| FeS assembly ATPase SufC [Thermus aquaticus Y51MC23]
          Length = 250

 Score =  247 bits (631), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 176/249 (70%), Gaps = 9/249 (3%)

Query: 2   LEIKNLRAKIVDTDTE-IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           LEI++L A I   D E I++G+NL V   +V A+MGPNG+GKSTL  +L+G  +Y++  G
Sbjct: 4   LEIRDLWASI---DGEMILKGVNLVVPKGQVHALMGPNGAGKSTLGKILAGDPEYQVEKG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL  GESILD S  ERA KG+FLAFQYPVE+PG+ M  FL++AL    +AR  +E+ + 
Sbjct: 61  DILLDGESILDLSPDERARKGLFLAFQYPVEVPGVTMANFLRLAL----QARLGREVGVA 116

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F  KV+K    L  +   L R LN GFSGGEKK  EILQ+ +LEP+  ILDETDSGLDI
Sbjct: 117 EFWTKVKKALELLDWDEGYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAILDETDSGLDI 176

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVNA+R      L+ITHYQRLLNYI PD +HV+ +G+++  G   +AL+LE 
Sbjct: 177 DALKVVARGVNAMRGPGFGALVITHYQRLLNYIVPDRVHVMMDGRVVAEGGPELALELEA 236

Query: 241 NGYAELIKE 249
            GY E ++E
Sbjct: 237 RGY-EWLRE 244


>gi|260910873|ref|ZP_05917517.1| FeS assembly ATPase SufC [Prevotella sp. oral taxon 472 str. F0295]
 gi|260635024|gb|EEX53070.1| FeS assembly ATPase SufC [Prevotella sp. oral taxon 472 str. F0295]
          Length = 251

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL AKI   D EI++G+NL V+  E  AIMGPNGSGKSTLS +L G+  +E+T G
Sbjct: 1   MLEVRNLHAKI--GDKEILKGINLTVKDGETHAIMGPNGSGKSTLSAVLVGNPMFEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++ G+ +L+    +RA++GIFL+FQYPVEIPG+ M  F++ A+NE+RK +  + +   
Sbjct: 59  TAVFNGKDLLEMKPEDRANEGIFLSFQYPVEIPGVSMTNFMRTAINEKRKYQGLEPMSAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +++    + ++  + +R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 DFIKLMKEKRQIVELDAKLSQRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L+S   S ++ITHY RLL+ I+PD IHVL+ G+I+KT    +A ++E 
Sbjct: 179 DALRIVAEGVNKLKSPSTSTIVITHYDRLLDIIRPDVIHVLYKGRIVKTAGPELAKEIEA 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|171777443|ref|ZP_02919193.1| hypothetical protein STRINF_00020 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283261|gb|EDT48685.1| hypothetical protein STRINF_00020 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 256

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GE+ILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  +++++ + 
Sbjct: 61  EILLDGENILDLEVDERARLGLFLAMQYPSEIPGITNAEFIRAAMNAGKE--DDEKIPVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMEFLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++G+NA+R  D   +IITHYQRLLNYI PD +H++ +G+++ TG   +A  LE+
Sbjct: 179 DALKVVSKGINAMRGNDFGAMIITHYQRLLNYITPDVVHIMMDGRVVLTGGAELAARLEK 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAKIAEE 247


>gi|317474556|ref|ZP_07933830.1| FeS assembly ATPase SufC [Bacteroides eggerthii 1_2_48FAA]
 gi|316909237|gb|EFV30917.1| FeS assembly ATPase SufC [Bacteroides eggerthii 1_2_48FAA]
          Length = 251

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G++L +   EV A+MG NG+GKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGIDLTIRDGEVHALMGQNGAGKSTLSNVLVGHPAYEVTRG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ +L  S  +RA +GIFL+FQ PVEIPG+ M+ F++ A+NEQRK R+   L   
Sbjct: 59  TITFNGKDLLAMSPEDRAHEGIFLSFQTPVEIPGVSMVNFMRAAVNEQRKYRHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+  ILDETDSGLD+
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPTFAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G N L++   S ++ITHYQRLL+Y+KPDT+HVL  G+I+KTG   +A ++E 
Sbjct: 179 DALRIVADGFNKLKTPQTSAMVITHYQRLLDYLKPDTVHVLLGGRIVKTGGPELAKEIEA 238

Query: 241 NGYAELIKE 249
            G+  + KE
Sbjct: 239 RGFDWIKKE 247


>gi|322411110|gb|EFY02018.1| Iron-sulfur cluster assembly ATPase protein SufC [Streptococcus
           dysgalactiae subsp. dysgalactiae ATCC 27957]
          Length = 256

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEINNLHVSI--EDKEILKGVNLTLKTDEIAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  +   +E ++ + 
Sbjct: 61  EILLDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFMRAAMNAGKA--DEDKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+    A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDDKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALATRLEK 238

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 239 EGYAGIAQE 247


>gi|33519820|ref|NP_878652.1| ATP-dependent transporter sufC [Candidatus Blochmannia floridanus]
 gi|33504165|emb|CAD83427.1| probable ATP-dependent transporter sufC [Candidatus Blochmannia
           floridanus]
          Length = 245

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 171/246 (69%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I NL   +    + I+  LNL++ P E+  IMGPNGSGKSTLS ++SG  DY +T G
Sbjct: 1   MLSIHNLNVSV--KGSSILNKLNLEISPGEIHIIMGPNGSGKSTLSAVISGQPDYIVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+K + +L     ERA +GIF+AFQYP+EIPGI    FL  A+N  RK RN+  +   
Sbjct: 59  TILFKKKDLLLLKPEERAGEGIFVAFQYPIEIPGISNQLFLYSAINAIRKYRNQPPVERF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + V+K    L I  D+L R +N+GFSGGEKK  +ILQM +LEP+LCILDETDSGLDI
Sbjct: 119 EFLQSVQKKMQLLHIPDDLLTRSVNVGFSGGEKKRNDILQMMMLEPTLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+KI   G+N LR+  RSF+IITHY+R+L YIKPD +H+LH G IIK+GD ++   LEE
Sbjct: 179 DAIKIVYNGLNLLRNTTRSFIIITHYERILEYIKPDYVHILHKGCIIKSGDLTLVKKLEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|218131828|ref|ZP_03460632.1| hypothetical protein BACEGG_03449 [Bacteroides eggerthii DSM 20697]
 gi|217986131|gb|EEC52470.1| hypothetical protein BACEGG_03449 [Bacteroides eggerthii DSM 20697]
          Length = 270

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G++L +   EV A+MG NG+GKSTLS +L GH  YE+T G
Sbjct: 20  MLEIKDLHASI--NGKEILKGIDLTIRDGEVHALMGQNGAGKSTLSNVLVGHPAYEVTRG 77

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I + G+ +L  S  +RA +GIFL+FQ PVEIPG+ M+ F++ A+NEQRK R+   L   
Sbjct: 78  TITFNGKDLLAMSPEDRAHEGIFLSFQTPVEIPGVSMVNFMRAAVNEQRKYRHLPALSAS 137

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+  ILDETDSGLD+
Sbjct: 138 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPTFAILDETDSGLDV 197

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G N L++   S ++ITHYQRLL+Y+KPDT+HVL  G+I+KTG   +A ++E 
Sbjct: 198 DALRIVADGFNKLKTPQTSAMVITHYQRLLDYLKPDTVHVLLGGRIVKTGGPELAKEIEA 257

Query: 241 NGYAELIKE 249
            G+  + KE
Sbjct: 258 RGFDWIKKE 266


>gi|227364548|ref|ZP_03848609.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus reuteri MM2-3]
 gi|325682337|ref|ZP_08161854.1| FeS assembly ATPase SufC [Lactobacillus reuteri MM4-1A]
 gi|227070385|gb|EEI08747.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus reuteri MM2-3]
 gi|324978176|gb|EGC15126.1| FeS assembly ATPase SufC [Lactobacillus reuteri MM4-1A]
          Length = 304

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 177/252 (70%), Gaps = 6/252 (2%)

Query: 2   LEIKNLRAKIVDTDTE----IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           LEIK+L   + D +++    I++G+NLK++  E+ AIMGPNG+GKSTLS  + GH +Y +
Sbjct: 43  LEIKDLHVSVKDEESKEEKEILKGVNLKMKTGEIHAIMGPNGTGKSTLSQTIMGHPNYHV 102

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T GDIL  GESI+D  + ERA KG+FLA QYP EI G+   +FL+ A+N +R    + ++
Sbjct: 103 TQGDILLDGESIVDMPVDERARKGLFLAMQYPAEIQGVTNAEFLRAAINARRPE--DDQI 160

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            + DF +K+ K    L ++  M +R LN GFSGGEKK  EILQ+ ++EPS  ILDE DSG
Sbjct: 161 SVMDFIKKLDKNLELLDMSQSMTERYLNEGFSGGEKKRNEILQLLMIEPSFAILDEIDSG 220

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDALK+ ++GVN++R  +   LIITHYQRLLNYI PDT+HV+  G+I+KTG   +A  
Sbjct: 221 LDIDALKVVSKGVNSMRGDNFGSLIITHYQRLLNYIVPDTVHVMMGGRIVKTGGPDLAKK 280

Query: 238 LEENGYAELIKE 249
           LE+ GYA L  E
Sbjct: 281 LEDEGYAGLRDE 292


>gi|284006307|emb|CBA71543.1| cysteine desulfurase ATPase component [Arsenophonus nasoniae]
          Length = 216

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 161/215 (74%)

Query: 35  MGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPG 94
           MGPNGSGKSTLS  L+G ++Y+I  G+IL+K +++L+ S  ERA +GIFLAFQYPVEIPG
Sbjct: 1   MGPNGSGKSTLSATLAGREEYQIEQGEILFKNKNLLELSPEERAGEGIFLAFQYPVEIPG 60

Query: 95  IIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKK 154
           +    FL+ ++N  R+ R +  L   DF   +      L +  D+L R +N+GFSGGEKK
Sbjct: 61  VSNQFFLQTSVNAVREYRQQPPLDRFDFQDFIEDKIELLDMPKDLLTRSVNVGFSGGEKK 120

Query: 155 IAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIK 214
             +ILQM  LEP+LCILDETDSGLDIDALK+ A GVN+LR+ +R+F+I+THYQR+L+Y++
Sbjct: 121 RNDILQMAALEPALCILDETDSGLDIDALKVVANGVNSLRTAERAFIIVTHYQRILDYVQ 180

Query: 215 PDTIHVLHNGKIIKTGDYSIALDLEENGYAELIKE 249
           PD +HVLH GKII++GD+++A  LE  GY  LI +
Sbjct: 181 PDFVHVLHQGKIIESGDFTLAKKLEVQGYGWLIDQ 215


>gi|116071399|ref|ZP_01468668.1| FeS assembly ATPase SufC [Synechococcus sp. BL107]
 gi|116066804|gb|EAU72561.1| FeS assembly ATPase SufC [Synechococcus sp. BL107]
          Length = 262

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I +L A +   D  I++G+NL+V   E+ A+MG NGSGKSTLS +L+GH  Y +T+G
Sbjct: 9   LLDITDLHASV--EDQPILKGVNLQVRAGEIHAVMGRNGSGKSTLSKVLAGHPAYRVTSG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+GE++ +    ERA  G+FL FQYPVEIPG+  ++FL++A N +R  +N +EL   
Sbjct: 67  TVRYRGENLFELEAEERARLGVFLGFQYPVEIPGVSNLEFLRVATNARRLKQNLEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 DFEDHVHERLKVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLEPVVAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L + D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVAGGVNQLANADNAMLLITHYQRLLDEITPDYVHVMAAGRILRTGGRELALELEQ 246

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 247 TGYDWVDKE 255


>gi|310641148|ref|YP_003945906.1| abc-type transport system atpase component [Paenibacillus polymyxa
           SC2]
 gi|309246098|gb|ADO55665.1| ABC-type transport system ATPase component [Paenibacillus polymyxa
           SC2]
          Length = 260

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 171/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
            +I+ L+A I     EI++G+NL+++  E+ AIMGPNG+GKSTL+  L GH  YE+T G 
Sbjct: 5   FKIEGLKATI--EGKEILKGINLEMKGGEIHAIMGPNGTGKSTLASALMGHPKYEVTDGK 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +   GE +LD  + ERA  G+FLA QYP EI G+    FL+ A+N +R+   E  L+   
Sbjct: 63  VTLDGEDVLDMEVDERARAGLFLAMQYPSEIAGVTNSDFLRSAINARREEGQEISLI--K 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R++     EL +N +   R LN GFSGGEKK  EILQM +L+P + +LDE DSGLDID
Sbjct: 121 FIRQMESKMKELEMNPEFAHRYLNEGFSGGEKKRNEILQMMMLDPKIVVLDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL+I A GVNA+RS+DR FL+ITHYQRLLNYIKPD +HV+  G+I+K+G   +A  LE +
Sbjct: 181 ALRIVANGVNAMRSEDRGFLVITHYQRLLNYIKPDYVHVMMQGRIVKSGGPELAERLEAD 240

Query: 242 GYAELIKE 249
           GY + IKE
Sbjct: 241 GY-DWIKE 247


>gi|30249420|ref|NP_841490.1| Iron-regulated ABC transporter ATPase subunit SufC [Nitrosomonas
           europaea ATCC 19718]
 gi|30138783|emb|CAD85360.1| Iron-regulated ABC transporter ATPase subunit SufC [Nitrosomonas
           europaea ATCC 19718]
          Length = 263

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 169/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+++L A +     EI++G+NL V   E+ AIMG NGSGKST + +L+GH  YE+T G
Sbjct: 9   LLEVRDLHATV--GGAEILKGVNLTVRSGEIHAIMGLNGSGKSTFAKVLAGHPSYEVTQG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +L+ G+ +   +  ERA  G+FLAFQYPVEIPG+   QFL++A N  +  R ++EL   
Sbjct: 67  TVLFDGQDLSVLAPEERAQAGLFLAFQYPVEIPGVANDQFLRLAYNTVQGHRGKEELDPL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR+    L +N D L R +N GFSGGEKK  EILQM LLEP L +LDETDSGLDI
Sbjct: 127 EFDDFVREKMKLLKMNPDFLDRSVNEGFSGGEKKRNEILQMALLEPRLALLDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S+D + +++THYQRLL+YI PD +HV+  G+II+T    +AL LE 
Sbjct: 187 DALRIVANGVNQLSSKDNAMILVTHYQRLLDYIVPDYVHVMEAGRIIRTSGKELALALET 246

Query: 241 NGY 243
           +GY
Sbjct: 247 HGY 249


>gi|15673775|ref|NP_267950.1| ABC transporter ATP-binding protein [Lactococcus lactis subsp.
           lactis Il1403]
 gi|281492386|ref|YP_003354366.1| SUF system FeS cluster assembly protein ATP-dependent transporter
           SufC [Lactococcus lactis subsp. lactis KF147]
 gi|12724818|gb|AAK05891.1|AE006409_1 ABC transporter ATP-binding protein [Lactococcus lactis subsp.
           lactis Il1403]
 gi|281376050|gb|ADA65541.1| SUF system FeS cluster assembly protein, ATP-dependent transporter
           SufC [Lactococcus lactis subsp. lactis KF147]
 gi|326407281|gb|ADZ64352.1| Fe-S cluster assembly ATP-binding protein [Lactococcus lactis
           subsp. lactis CV56]
          Length = 256

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 177/248 (71%), Gaps = 4/248 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL   I   D EI++G+NL +  +E+ AIMGPNG+GKSTLS  + G+ +Y +T G+
Sbjct: 4   LEIKNLHVAI--EDKEILKGVNLVINTNEIHAIMGPNGTGKSTLSAAIMGNPNYSVTQGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L+ G+++L+ S+ ERA  G+FLA QYP EIPGI   +FL+ A+N +R A ++K + + +
Sbjct: 62  VLFDGQNVLEMSVDERARLGLFLAMQYPSEIPGITNAEFLRAAMNAKR-AEDDK-VSVME 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDID
Sbjct: 120 FIKKLDKNMEVLSMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVN++R +    LIITHYQRLL+YI PD +H++ +G+++KTG   +A  LE  
Sbjct: 180 ALKVVAKGVNSMRGEKFGALIITHYQRLLDYITPDVVHIMMDGRVVKTGGAELAKRLETE 239

Query: 242 GYAELIKE 249
           GY  + +E
Sbjct: 240 GYVNIAEE 247


>gi|330850940|ref|YP_004376690.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Fistulifera sp. JPCC DA0580]
 gi|328835760|dbj|BAK19056.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Fistulifera sp. JPCC DA0580]
          Length = 252

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 170/246 (69%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   + +I++ LNL VE  E+ AIMGPNGSGKST S +L+GH  Y I  G
Sbjct: 7   ILEIKNLEVSI--NENQILKKLNLSVEKGEIHAIMGPNGSGKSTFSKVLAGHPSYSIING 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DI++KGESIL     ER+  GIFLAFQYP+EIPG+    FL+++ N ++K  N+ E+   
Sbjct: 65  DIIFKGESILALEPEERSHLGIFLAFQYPIEIPGVSNEDFLRLSYNSKQKFYNKPEVDPI 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +    + ++   L R +N GFSGGEKK  EILQM LL+  LCILDETDSGLDI
Sbjct: 125 EFLSIINEKLKLVNMSPAFLGRNVNEGFSGGEKKRNEILQMILLDSELCILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + G+N   + D++ ++ITHYQRLL+YI P  +HV+ NGKII+TG   +A +LE+
Sbjct: 185 DALKIISNGINKFMTPDKAIILITHYQRLLDYINPTYVHVMQNGKIIRTGSAELAKELED 244

Query: 241 NGYAEL 246
            GY  L
Sbjct: 245 KGYEWL 250


>gi|22536326|ref|NP_687177.1| ABC transporter ATP-binding protein [Streptococcus agalactiae
           2603V/R]
 gi|25010212|ref|NP_734607.1| hypothetical protein gbs0137 [Streptococcus agalactiae NEM316]
 gi|76786975|ref|YP_328872.1| FeS assembly ATPase SufC [Streptococcus agalactiae A909]
 gi|76799310|ref|ZP_00781475.1| FeS assembly ATPase SufC [Streptococcus agalactiae 18RS21]
 gi|77405146|ref|ZP_00782245.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae
           H36B]
 gi|77409051|ref|ZP_00785769.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae
           COH1]
 gi|77411812|ref|ZP_00788147.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae
           CJB111]
 gi|77414651|ref|ZP_00790788.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae 515]
 gi|22533149|gb|AAM99049.1|AE014197_17 ABC transporter, ATP-binding protein [Streptococcus agalactiae
           2603V/R]
 gi|23094564|emb|CAD45782.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562032|gb|ABA44616.1| FeS assembly ATPase SufC [Streptococcus agalactiae A909]
 gi|76585337|gb|EAO61930.1| FeS assembly ATPase SufC [Streptococcus agalactiae 18RS21]
 gi|77159293|gb|EAO70467.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae 515]
 gi|77162147|gb|EAO73123.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae
           CJB111]
 gi|77172345|gb|EAO75496.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae
           COH1]
 gi|77176289|gb|EAO79059.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae
           H36B]
 gi|319744061|gb|EFV96438.1| FeS assembly ATPase SufC [Streptococcus agalactiae ATCC 13813]
          Length = 256

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 177/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   D EI++GLNL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+TAG
Sbjct: 3   VLEIKNLHVSI--EDKEILKGLNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE IL+  + ERA  G+FLA QYP E+PGI   +F++ A+N   KA ++K + I 
Sbjct: 61  EILFDGEDILELEVDERARLGLFLAMQYPSEVPGITNAEFIRAAMN-AGKADDDK-ISIR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 QFITKLDEKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 179 DALKVVSKGVNEMRGEGFGAMIITHYQRLLNYITPDKVHVMMDGKVVLSGGPELAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAQIAEE 247


>gi|317504203|ref|ZP_07962197.1| FeS assembly ATPase SufC [Prevotella salivae DSM 15606]
 gi|315664692|gb|EFV04365.1| FeS assembly ATPase SufC [Prevotella salivae DSM 15606]
          Length = 254

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 177/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A I     EI++G+NL V+  E  AIMGPNGSGKSTLS +L+G+  Y +TAG
Sbjct: 1   MLEVRNLHATIAGK--EILKGINLTVKDGETHAIMGPNGSGKSTLSAVLTGNPLYTVTAG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           + ++ G+ +L     +RA  GIFL+FQYPVEIPG+ M  F++ A+N +R+   ++ L   
Sbjct: 59  EAIFNGQDLLQMKPEDRARAGIFLSFQYPVEIPGVSMTNFMRAAINAKREYLGQEPLNTA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP+L ILDETDSGLD+
Sbjct: 119 DFMKLMREKRKLVDLDSKLSHRSVNEGFSGGEKKRNEIFQMAMLEPTLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A GVN + +   S ++ITHY+RLL+ IKP+ +HVL+NG+I+KT  + +A ++E+
Sbjct: 179 DAMRIVADGVNKMHTDKTSAIVITHYERLLDMIKPNFVHVLYNGRIVKTAGHELAKEIEQ 238

Query: 241 NGYAELIKE 249
           +GY + IKE
Sbjct: 239 HGY-DWIKE 246


>gi|289551295|ref|YP_003472199.1| Iron-sulfur cluster assembly ATPase protein SufC [Staphylococcus
           lugdunensis HKU09-01]
 gi|315658801|ref|ZP_07911668.1| FeS assembly ATPase SufC [Staphylococcus lugdunensis M23590]
 gi|289180827|gb|ADC88072.1| Iron-sulfur cluster assembly ATPase protein SufC [Staphylococcus
           lugdunensis HKU09-01]
 gi|315495925|gb|EFU84253.1| FeS assembly ATPase SufC [Staphylococcus lugdunensis M23590]
          Length = 253

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 171/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   EV AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTDEVHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K  A L I+ +M +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKTMAFLDIDENMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   LIITHYQRLLNYI PD +HV++ GK++KTG   +A  LE+ 
Sbjct: 181 ALKVVSKGINKMRGENFGALIITHYQRLLNYITPDQVHVMYGGKVVKTGGPELAKRLEDE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|242373060|ref|ZP_04818634.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus epidermidis M23864:W1]
 gi|242349214|gb|EES40815.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus epidermidis M23864:W1]
          Length = 253

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL V   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTVNTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKEMDFLDIDQDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R +D   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGEDFGALMITHYQRLLNYITPDKVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|223043019|ref|ZP_03613067.1| FeS assembly ATPase SufC [Staphylococcus capitis SK14]
 gi|222443873|gb|EEE49970.1| FeS assembly ATPase SufC [Staphylococcus capitis SK14]
          Length = 253

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL V   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTVNTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKEMDFLDIDQDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R +D   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGEDFGALMITHYQRLLNYITPDKVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|153003772|ref|YP_001378097.1| FeS assembly ATPase SufC [Anaeromyxobacter sp. Fw109-5]
 gi|152027345|gb|ABS25113.1| FeS assembly ATPase SufC [Anaeromyxobacter sp. Fw109-5]
          Length = 272

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 171/244 (70%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L +  LRAK+     EI++G+ L+V P EV AIMGPNGSGKSTL+ +L+G + +E+T G
Sbjct: 14  LLRVVGLRAKVAGAVGEILKGVELEVRPGEVHAIMGPNGSGKSTLAGVLAGREAFEVTGG 73

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              Y G+ +L  +   RA+ G+FL FQYPVEIPG+  + FL+ ALN  R+AR ++EL   
Sbjct: 74  SATYAGKDLLALAPEARAAAGVFLGFQYPVEIPGVANLYFLRTALNAIRRARGDEELDAM 133

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF    ++    + ++     R +N GFSGGEKK  EI QM +LEP L ILDE DSGLDI
Sbjct: 134 DFLALAKERMKLVELDPAFGSRSVNEGFSGGEKKRNEIFQMTVLEPRLAILDEIDSGLDI 193

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A+GVNA+RS DR+ L++THY+RLL YI+PD +HV+ NG+I+++G   +A +LE 
Sbjct: 194 DALRVIARGVNAVRSPDRALLLVTHYKRLLEYIRPDVVHVMANGRIVRSGGPELADELER 253

Query: 241 NGYA 244
            GYA
Sbjct: 254 TGYA 257


>gi|304406756|ref|ZP_07388411.1| FeS assembly ATPase SufC [Paenibacillus curdlanolyticus YK9]
 gi|304344289|gb|EFM10128.1| FeS assembly ATPase SufC [Paenibacillus curdlanolyticus YK9]
          Length = 259

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 168/246 (68%), Gaps = 5/246 (2%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           I  L+A +     EI++G+NL+++  E+ AIMGPNG+GKSTL+  L GH  YE+T G  L
Sbjct: 7   IDGLKASV--EGKEILKGINLEIKGGEIHAIMGPNGTGKSTLASALMGHPKYEVTGGTAL 64

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFT 123
             GE IL+  + ERA  G+FLA QYP EI G+    FL+ A+N +R   NE  L+   F 
Sbjct: 65  LDGEDILEMGVDERALAGMFLAMQYPSEITGVTNSDFLRSAINARRGEGNEISLI--KFI 122

Query: 124 RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDAL 183
           R++     EL +N +   R LN GFSGGEKK  EILQM LL+P + ILDE DSGLDIDAL
Sbjct: 123 RQMEGKMKELEMNTEFAHRYLNEGFSGGEKKRNEILQMMLLDPKIVILDEIDSGLDIDAL 182

Query: 184 KIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGY 243
           +I + GVNA+RS+DR FL+ITHYQRLLNYIKPD +HV+  G+I+K+G   +A  LE  GY
Sbjct: 183 RIVSNGVNAMRSEDRGFLVITHYQRLLNYIKPDFVHVMMQGRIVKSGGPELAERLENEGY 242

Query: 244 AELIKE 249
            + +KE
Sbjct: 243 -DWVKE 247


>gi|213965594|ref|ZP_03393788.1| FeS assembly ATPase SufC [Corynebacterium amycolatum SK46]
 gi|213951753|gb|EEB63141.1| FeS assembly ATPase SufC [Corynebacterium amycolatum SK46]
          Length = 253

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 174/252 (69%), Gaps = 10/252 (3%)

Query: 2   LEIKNLRAKIVDTD-----TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYE 56
           LEI+NL A+++ TD      EI++G+NL +   E  A+MGPNGSGKSTLSY ++GH  YE
Sbjct: 4   LEIRNLHAQVLPTDESAEPKEILKGVNLTINSGETHAVMGPNGSGKSTLSYTIAGHPRYE 63

Query: 57  ITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
           +T G+IL  GE++L+ S+ ERA  G+FLA QYPVE+ G+ M  FL+ A       R E  
Sbjct: 64  VTEGEILLDGENVLEMSVDERARAGLFLAMQYPVEVTGVSMSNFLRSAAT---AVRGEAP 120

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
            L   + ++VR+  A+L I+    +R +N GFSGGEKK  EILQ+ LL+P   ILDETDS
Sbjct: 121 KL-RHWVKEVREAMADLEIDSSFSERSVNEGFSGGEKKRHEILQLDLLKPKFAILDETDS 179

Query: 177 GLDIDALKIAAQGVNALRSQ-DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIA 235
           GLD+DAL++ ++G+N  + + D   LIITHYQR+LNY+KPD +HV H+G+ I +G   +A
Sbjct: 180 GLDVDALRVVSEGINRYQDENDGGILIITHYQRILNYVKPDFVHVFHDGRFITSGGPELA 239

Query: 236 LDLEENGYAELI 247
            +LEE+GY + I
Sbjct: 240 DELEEHGYEKYI 251


>gi|299830360|ref|YP_003734575.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Kryptoperidinium foliaceum]
 gi|297385062|gb|ADI40360.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Kryptoperidinium foliaceum]
          Length = 251

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 165/246 (67%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+ +LR  I   D EI++ LNL ++  E+ AIMGPNGSGKST S +L+GH  Y +  G
Sbjct: 7   LLEVNDLRVSI--DDNEILKNLNLTIQKGEIHAIMGPNGSGKSTFSKVLAGHPAYSVLNG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+KG SILD    ERA  GIFLAFQYP+EIPG+    FL++A N ++K  N+ E+   
Sbjct: 65  DILFKGSSILDLEPEERAHLGIFLAFQYPIEIPGVSNEDFLRLAYNSKQKFYNKPEIDPI 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   + +    + ++   L R +N GFSGGEKK  EILQM LL+  L ILDETDSGLDI
Sbjct: 125 QFLGIINEKLTLVNMSPTFLSRNVNEGFSGGEKKRNEILQMILLDSELAILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  + G+N      +S L+ITHYQRLL+YIKPD +HV  +GKIIKTG   +A +LE 
Sbjct: 185 DALKTISSGINTFMDSSKSILLITHYQRLLDYIKPDFVHVFQDGKIIKTGSADLAKELEN 244

Query: 241 NGYAEL 246
            GY  L
Sbjct: 245 KGYEWL 250


>gi|304383861|ref|ZP_07366318.1| FeS assembly ATPase SufC [Prevotella marshii DSM 16973]
 gi|304334939|gb|EFM01212.1| FeS assembly ATPase SufC [Prevotella marshii DSM 16973]
          Length = 251

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 179/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML++KNL A+I     EI+RG++L +   EV AIMGPNGSGKST S +L G+  +E+T G
Sbjct: 1   MLQVKNLHAEIAGK--EILRGIDLTIGKGEVHAIMGPNGSGKSTFSAVLVGNPLFEVTQG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++ + G+++L+    +RA++G+FL+FQYPVEIPG+ M  F++ A+NE+RK   ++ +   
Sbjct: 59  EVTFNGKNLLEMKPEDRANEGLFLSFQYPVEIPGVSMTNFMRAAINEKRKYHGQEPMNTA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +++    + ++  +  R +N GFSGGEKK  EI QM +LEP+L ILDETDSGLD+
Sbjct: 119 DFIKLMKEKRQIVELDAKLSNRSVNEGFSGGEKKRNEIFQMAMLEPTLAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN LR+ + S ++ITHY RLL+ IKPD IHVL+ G+I+KT    +A ++E 
Sbjct: 179 DALRIVAEGVNKLRTPETSTIVITHYDRLLDIIKPDIIHVLYKGRIVKTAGPELAKEIEA 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|314933127|ref|ZP_07840492.1| FeS assembly ATPase SufC [Staphylococcus caprae C87]
 gi|313653277|gb|EFS17034.1| FeS assembly ATPase SufC [Staphylococcus caprae C87]
          Length = 253

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL V   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTVNTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKEMDFLDIDQDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R +D   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGEDFGALMITHYQRLLNYITPDKVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|288904535|ref|YP_003429756.1| FeS assembly ATPase SufC [Streptococcus gallolyticus UCN34]
 gi|306830529|ref|ZP_07463697.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
 gi|306832766|ref|ZP_07465902.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Streptococcus bovis ATCC 700338]
 gi|288731260|emb|CBI12810.1| putative FeS assembly ATPase SufC [Streptococcus gallolyticus
           UCN34]
 gi|304425115|gb|EFM28245.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Streptococcus bovis ATCC 700338]
 gi|304427323|gb|EFM30427.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
          Length = 256

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GE+IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  ++ ++ + 
Sbjct: 61  EILLDGENILELEVDERARLGLFLAMQYPSEIPGITNAEFIRAAMNAGKE--DDDKISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMEFLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNA+R  +   +IITHYQRLLNYI PD +H++ +G+++ +GD  +A  LE+
Sbjct: 179 DALKIVSKGVNAMRGDNFGAMIITHYQRLLNYITPDVVHIMMDGRVVLSGDAELAARLEK 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAKIAEE 247


>gi|228474251|ref|ZP_04058986.1| FeS assembly ATPase SufC [Staphylococcus hominis SK119]
 gi|314936862|ref|ZP_07844209.1| FeS assembly ATPase SufC [Staphylococcus hominis subsp. hominis
           C80]
 gi|228271610|gb|EEK12957.1| FeS assembly ATPase SufC [Staphylococcus hominis SK119]
 gi|313655481|gb|EFS19226.1| FeS assembly ATPase SufC [Staphylococcus hominis subsp. hominis
           C80]
          Length = 253

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   EV AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTGEVHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKQMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R +D   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINEMRGEDFGALMITHYQRLLNYITPDKVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|116491134|ref|YP_810678.1| Fe-S cluster assembly ABC-type transport system, ATPase component
           [Oenococcus oeni PSU-1]
 gi|290890642|ref|ZP_06553713.1| hypothetical protein AWRIB429_1103 [Oenococcus oeni AWRIB429]
 gi|116091859|gb|ABJ57013.1| Iron-regulated ABC transporter ATPase subunit SufC [Oenococcus oeni
           PSU-1]
 gi|290479770|gb|EFD88423.1| hypothetical protein AWRIB429_1103 [Oenococcus oeni AWRIB429]
          Length = 256

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 169/247 (68%), Gaps = 4/247 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL  +       I++G+NL V   E+ AIMGPNG+GKSTLS  + G   Y++T GD
Sbjct: 4   LEIKNLHVQA--EGQHILKGVNLTVSTGEIHAIMGPNGTGKSTLSETIMGRSGYQVTEGD 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  G+SIL+W++ ERA  G+FLA QYP EIPGI  M+F++ A+N  R    EK + + D
Sbjct: 62  ILLDGKSILNWTVDERARHGLFLAMQYPQEIPGITNMEFIRAAVNAGRP--KEKAIKVRD 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +++ +  A L I  +M +R LN GFSGGEKK  EILQ+ +L+P   ILDE DSGLDID
Sbjct: 120 FLQQLDEKMALLKIPEEMAERYLNEGFSGGEKKRNEILQLLMLKPRFAILDEIDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL I A+GVN+LR  +   LIITHYQRLL YI PD +H++  G+I+KTG   +A +LE+ 
Sbjct: 180 ALTIVAKGVNSLRGTEFGSLIITHYQRLLKYIVPDVVHIMMGGRIVKTGGPDLAAELEKT 239

Query: 242 GYAELIK 248
           GY  L K
Sbjct: 240 GYEGLAK 246


>gi|118586902|ref|ZP_01544335.1| ABC transporter, ATP-binding protein [Oenococcus oeni ATCC
           BAA-1163]
 gi|118432629|gb|EAV39362.1| ABC transporter, ATP-binding protein [Oenococcus oeni ATCC
           BAA-1163]
          Length = 256

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 169/247 (68%), Gaps = 4/247 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL  +       I++G+NL V   E+ AIMGPNG+GKSTLS  + G   Y++T GD
Sbjct: 4   LEIKNLHVQA--EGQHILKGVNLTVSTGEIHAIMGPNGTGKSTLSETIMGRSGYQVTEGD 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  G+SIL+W++ ERA  G+FLA QYP EIPGI  M+F++ A+N  R    EK + + D
Sbjct: 62  ILLDGKSILNWTVDERARHGLFLAMQYPQEIPGITNMEFIRAAVNAGRP--KEKAIKVRD 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +++ +  A L I  +M +R LN GFSGGEKK  EILQ+ +L+P   ILDE DSGLDID
Sbjct: 120 FLQQLDEKMALLKIPEEMAERYLNEGFSGGEKKRNEILQLLMLKPRFAILDEIDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL I A+GVN+LR  +   LIITHYQRLL YI PD +H++  G+I+KTG   +A +LE+ 
Sbjct: 180 ALTIVAKGVNSLRGAEFGSLIITHYQRLLKYIVPDVVHIMMGGRIVKTGGPDLAAELEKT 239

Query: 242 GYAELIK 248
           GY  L K
Sbjct: 240 GYEGLAK 246


>gi|159468454|ref|XP_001692389.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|158278102|gb|EDP03867.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 284

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 167/246 (67%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+K+L A I  T T I++G+NL +   EV AIMG NGSGKSTLS +L GH DYE+T G
Sbjct: 39  MLEVKDLTASIAGTHTPILKGVNLTIRNGEVHAIMGKNGSGKSTLSKVLVGHPDYEVTGG 98

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++KG+++ +    ER+  G+FL+FQ P+E+PG+  + FL++A N +RKA    EL   
Sbjct: 99  TAVFKGKNLFEMEPEERSHAGLFLSFQTPIEVPGVSNVDFLRMACNSRRKALGHPELDPL 158

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +      L ++   L R +N GFSGGEKK  EILQ+ +LE  + ILDE DSGLDI
Sbjct: 159 EFYAYIMPKLEMLNMDPTFLNRNVNEGFSGGEKKRNEILQLAVLEADMAILDEIDSGLDI 218

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A+ VN LRS D   L++THY+RLL+YIKPD +H++  G+I+KTGD S+   LE 
Sbjct: 219 DALRDVAKAVNQLRSDDTGVLMVTHYKRLLDYIKPDFVHIMQAGEIVKTGDMSLVDQLEA 278

Query: 241 NGYAEL 246
            GYA L
Sbjct: 279 GGYATL 284


>gi|332687000|ref|YP_004456774.1| iron-sulfur cluster assembly ATPase protein SufC [Melissococcus
           plutonius ATCC 35311]
 gi|332371009|dbj|BAK21965.1| iron-sulfur cluster assembly ATPase protein SufC [Melissococcus
           plutonius ATCC 35311]
          Length = 257

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL   I   + EI++GLNL ++ +E+ AIMGPNG+GKSTLS  + G   YE+T+G
Sbjct: 3   VLEVKNLHVSI--ENKEILKGLNLTIKTNEIHAIMGPNGAGKSTLSAAIMGDPAYEVTSG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE+IL   + ERA  G+FLA QYP EI GI   +F++ A+N + + ++E ++ + 
Sbjct: 61  EILFDGENILALKVDERARLGLFLAMQYPSEITGITNAEFIRAAINSKYE-KDEDKISVM 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +++ K  A L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDI
Sbjct: 120 NFLKRLDKKMALLNMPEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVN +R ++   LIITHYQRLLNYI PD +H++ +G+++KTG   +A  LE 
Sbjct: 180 DALKVVAKGVNEMRGENFGALIITHYQRLLNYITPDVVHIMMDGRVVKTGTAELAKQLES 239

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 240 EGYAGISRE 248


>gi|319891826|ref|YP_004148701.1| Iron-sulfur cluster assembly ATPase protein SufC [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161522|gb|ADV05065.1| Iron-sulfur cluster assembly ATPase protein SufC [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323465018|gb|ADX77171.1| FeS assembly ATPase SufC [Staphylococcus pseudintermedius ED99]
          Length = 256

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 171/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--DDKEILKGVNLTINTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G ++L+  + ERA  G+FLA QYP EI G+    F++ A+N QR+  NE  L+   
Sbjct: 63  VLLDGVNVLELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAQREEGNEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L ++ DM +R LN GFSGGEKK  EILQ+ +L+P   ILDE DSGLDID
Sbjct: 121 FIKKLDKQMDFLDMDKDMAQRYLNEGFSGGEKKRNEILQLMMLQPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   LIITHYQRLLNYI PD +HV++NG ++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINEMRGEEFGSLIITHYQRLLNYITPDHVHVMYNGIVVKSGGAELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|33239537|ref|NP_874479.1| ABC-type transport system involved in Fe-S cluster assembly ATPase
           component [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|33237062|gb|AAP99131.1| ABC-type transport system involved in Fe-S cluster assembly ATPase
           component [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 263

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+KNL A I      I++G+NL +   E+ AIMG NGSGKSTL+ +++GH  YEI+ G
Sbjct: 15  LLEVKNLHAGI--DGNSILKGVNLTIYEGEIHAIMGRNGSGKSTLAKIIAGHSSYEISEG 72

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL + ESI      ER++KG+FL FQYPVE+ G+  + FL+ A+N +RK   E EL   
Sbjct: 73  EILLESESITSLEPEERSNKGLFLGFQYPVEVAGVKNIDFLRAAVNARRKELKESELDTF 132

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   V      + +N D L+R +N GFSGGEKK  EILQM LL+P + ILDETDSGLDI
Sbjct: 133 EFDEIVNNTLGIVQMNKDFLERGVNQGFSGGEKKRNEILQMALLKPIVSILDETDSGLDI 192

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I + G+N + S++++ ++ITHYQRLLN IKPD +HV+ +GKIIKTG   +A+ LE+
Sbjct: 193 DALRIISNGINKIHSKNKATILITHYQRLLNEIKPDYVHVMKDGKIIKTGTKELAIALEK 252

Query: 241 NGYAEL 246
           +GY  L
Sbjct: 253 SGYEGL 258


>gi|325856492|ref|ZP_08172181.1| FeS assembly ATPase SufC [Prevotella denticola CRIS 18C-A]
 gi|327313030|ref|YP_004328467.1| FeS assembly ATPase SufC [Prevotella denticola F0289]
 gi|325483461|gb|EGC86434.1| FeS assembly ATPase SufC [Prevotella denticola CRIS 18C-A]
 gi|326945473|gb|AEA21358.1| FeS assembly ATPase SufC [Prevotella denticola F0289]
          Length = 252

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 179/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A I     EI+RG+NL V+  EV AIMGPNGSGKSTLS +L+G+  YE+T G
Sbjct: 1   MLEVRNLHATI--AGKEILRGINLTVKDGEVHAIMGPNGSGKSTLSAVLTGNPLYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++ G+++L+    +R+ +G+FL+FQYPVEIPG+ M  F+K A+N +R  +  + L   
Sbjct: 59  MAVFNGKNLLEMKPEDRSHEGLFLSFQYPVEIPGVSMTNFMKAAVNAKRAYQGLEPLKAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    +G++ ++ +R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 EFMALMREKRRLVGMDSNLSRRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A+GVN + + + S ++ITHY+RLL+ IKPD +HVL+ G+I+KT    +A ++E+
Sbjct: 179 DAMRIVAEGVNKMHTDETSTIVITHYERLLDMIKPDVVHVLYKGRIVKTAGPELAKEIEQ 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|227530411|ref|ZP_03960460.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus vaginalis ATCC 49540]
 gi|227349643|gb|EEJ39934.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus vaginalis ATCC 49540]
          Length = 265

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 175/253 (69%), Gaps = 6/253 (2%)

Query: 1   MLEIKNLRAKIVDTDT----EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYE 56
           +L+IK+L   + D +T    EI++G+NLK++  E+ AIMGPNG+GKSTLS  + G  +Y 
Sbjct: 3   ILQIKDLHVAVEDEETHQQKEILKGVNLKMQTGEIHAIMGPNGTGKSTLSQTIMGQPNYH 62

Query: 57  ITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
           +T GDIL  GESIL+  + ERA KG+FLA QYP EI G+   +FL+ A+N +R    + +
Sbjct: 63  VTQGDILLNGESILEMPVDERARKGLFLAMQYPAEIQGVTNAEFLRAAMNARRP--KDDQ 120

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
           + I DF +++ +  A L +   M +R LN GFSGGEKK  EILQ+ +++PS  ILDE DS
Sbjct: 121 ISIMDFLQELDQKLALLDMKESMTERYLNEGFSGGEKKRNEILQLLMIKPSFAILDEIDS 180

Query: 177 GLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIAL 236
           GLDIDALK+ ++GVN++R  +   LIITHYQRLLNYI PDT+HV+  G+I+K G   +A 
Sbjct: 181 GLDIDALKVVSRGVNSMRGANFGSLIITHYQRLLNYIVPDTVHVMMGGRIVKDGGPELAK 240

Query: 237 DLEENGYAELIKE 249
            LE  GYA L  E
Sbjct: 241 KLEAEGYAGLRDE 253


>gi|55981807|ref|YP_145104.1| SufC protein ATP-binding protein [Thermus thermophilus HB8]
 gi|82408311|pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc
           From Thermus Thermophilus Hb8
 gi|82408312|pdb|2D2F|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc
           From Thermus Thermophilus Hb8
 gi|55773220|dbj|BAD71661.1| SufC protein (ATP-binding protein) [Thermus thermophilus HB8]
          Length = 250

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 179/248 (72%), Gaps = 7/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEI++L A I D +T I++G+NL V   EV A+MGPNG+GKSTL  +L+G  +Y +  G+
Sbjct: 4   LEIRDLWASI-DGET-ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  GE+IL+ S  ERA KG+FLAFQYPVE+PG+ +  FL++AL    +A+  +E+ + +
Sbjct: 62  ILLDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLAL----QAKLGREVGVAE 117

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F  KV+K    L  +   L R LN GFSGGEKK  EILQ+ +LEP+  +LDETDSGLDID
Sbjct: 118 FWTKVKKALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDID 177

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVNA+R  +   L+ITHYQR+LNYI+PD +HV+ +G+++ TG   +AL+LE  
Sbjct: 178 ALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELALELEAK 237

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 238 GY-EWLKE 244


>gi|239636563|ref|ZP_04677565.1| FeS assembly ATPase SufC [Staphylococcus warneri L37603]
 gi|239597918|gb|EEQ80413.1| FeS assembly ATPase SufC [Staphylococcus warneri L37603]
 gi|330684729|gb|EGG96425.1| FeS assembly ATPase SufC [Staphylococcus epidermidis VCU121]
          Length = 253

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--DDKEILKGVNLTINTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKEMDFLDIDQDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R +D   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGEDFGALMITHYQRLLNYITPDKVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|149071992|ref|YP_001293542.1| iron-sulfur cluster formation ABC transporter [Rhodomonas salina]
 gi|134302943|gb|ABO70747.1| iron-sulfur cluster formation ABC transporter [Rhodomonas salina]
          Length = 253

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 169/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+IK+L A +    T+II GLNL V+  E+ AIMG NGSGKSTL+ +++GH  Y + +G
Sbjct: 9   ILDIKDLVATV--GTTQIINGLNLSVKEGEIHAIMGKNGSGKSTLAKIIAGHPAYTVNSG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL++GES+L+    ERA +GIFL FQYP+EIPG+    FL+++ N +RK +   EL   
Sbjct: 67  DILFEGESVLEIPAEERAQQGIFLGFQYPIEIPGVSNADFLRLSYNARRKFQKLPELEPL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + K    +G+    L R +N GFSGGEKK  EILQM +L+  + ILDETDSGLDI
Sbjct: 127 EFFEFINKKLEVVGMESSFLNRNVNEGFSGGEKKRNEILQMAVLDTKIAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A G+N L +     ++ITHYQRLL+YI PD +HV+ NG+IIKTGD S+A +LE 
Sbjct: 187 DALKTVASGINKLATAANGIVLITHYQRLLDYISPDYVHVMRNGEIIKTGDSSLAKELEL 246

Query: 241 NGY 243
            GY
Sbjct: 247 KGY 249


>gi|46199789|ref|YP_005456.1| ABC transporter ATP-binding protein [Thermus thermophilus HB27]
 gi|46197416|gb|AAS81829.1| ABC transporter ATP-binding protein [Thermus thermophilus HB27]
          Length = 250

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 179/248 (72%), Gaps = 7/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEI++L A I D +T I++G+NL V   EV A+MGPNG+GKSTL  +L+G  +Y +  G+
Sbjct: 4   LEIRDLWASI-DGET-ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  GE+IL+ S  ERA KG+FLAFQYPVE+PG+ +  FL++AL    +A+  +E+ + +
Sbjct: 62  ILLDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLAL----QAKLGREVGVAE 117

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F  KV+K    L  +   L R LN GFSGGEKK  EILQ+ +LEP+  +LDETDSGLDID
Sbjct: 118 FWTKVKKALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDID 177

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVNA+R  +   L+ITHYQR+LNYI+PD +HV+ +G+++ TG   +AL+LE  
Sbjct: 178 ALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDRVHVMMDGRVVATGGPELALELEAK 237

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 238 GY-EWLKE 244


>gi|313680301|ref|YP_004058040.1| iron-regulated ABC transporter atpase subunit sufc [Oceanithermus
           profundus DSM 14977]
 gi|313153016|gb|ADR36867.1| Iron-regulated ABC transporter ATPase subunit SufC [Oceanithermus
           profundus DSM 14977]
          Length = 249

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 172/248 (69%), Gaps = 6/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEI++L   +   DT I++G+NL +   EV A+MGPNG+GKSTL  +++G   YE+  G 
Sbjct: 5   LEIRDLWVNV--EDTPILKGVNLTLPRGEVHALMGPNGAGKSTLGKVIAGDPGYEVVRGQ 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  GE I      ERA KG+FLAFQYPVE+PG+ +  FL++AL    +AR  KE+ + +
Sbjct: 63  ILLDGEDIAGLEPDERARKGLFLAFQYPVEVPGVTIANFLRLAL----QARYGKEVPLTE 118

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F  K+++    L  +   + R LN GFSGGEKK  EILQ+ +LEP+  ILDETDSGLDID
Sbjct: 119 FYGKLQRAIETLEWDEAYVTRYLNEGFSGGEKKRNEILQLMVLEPAYAILDETDSGLDID 178

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVNA+R  D   L+ITHYQRLLNYI PD +HV+ +G+I+KTG   +AL+LEE 
Sbjct: 179 ALKVVAKGVNAMRGPDFGALVITHYQRLLNYIVPDVVHVMMDGRIVKTGGRELALELEER 238

Query: 242 GYAELIKE 249
           GY  L +E
Sbjct: 239 GYDWLKEE 246


>gi|149196444|ref|ZP_01873499.1| Iron-regulated ABC transporter ATPase subunit SufC [Lentisphaera
           araneosa HTCC2155]
 gi|149140705|gb|EDM29103.1| Iron-regulated ABC transporter ATPase subunit SufC [Lentisphaera
           araneosa HTCC2155]
          Length = 250

 Score =  244 bits (624), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 175/252 (69%), Gaps = 6/252 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL AK+   D  I++GL+ +V   EV AIMGPNG+GKSTLS +++GH DYE+T G
Sbjct: 1   MLKIKNLHAKV--ADKTILKGLDFEVNEGEVHAIMGPNGAGKSTLSKIIAGHPDYEVTEG 58

Query: 61  DILY----KGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
            + Y    K + + D    + A +G+FL+FQYPVE+PG+  + FLK + N   + +   E
Sbjct: 59  TVSYEVNFKEKDLTDMEPEDIAREGVFLSFQYPVEVPGVSNLGFLKASFNAICRHQGVPE 118

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
           +    F   VR+   +L I    L RP+N+ FSGGEKK  EILQM +L P L +LDETDS
Sbjct: 119 MEDAAFVDFVREKMDDLKIKRGFLDRPVNVDFSGGEKKRNEILQMAVLNPRLKLLDETDS 178

Query: 177 GLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIAL 236
           GLD+D++KI A+G+N LRS++ S +++THYQRLL+Y+KPD +HVL  G+I+K+G   +AL
Sbjct: 179 GLDVDSMKIVAEGINTLRSKNSSTILVTHYQRLLDYVKPDYVHVLAEGRIVKSGGPELAL 238

Query: 237 DLEENGYAELIK 248
           ++EE GY  L+K
Sbjct: 239 EVEEKGYDWLVK 250


>gi|19745414|ref|NP_606550.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS8232]
 gi|73921095|sp|Q8P2M5|Y273_STRP8 RecName: Full=Probable ABC transporter ATP-binding protein
           spyM18_0273
 gi|19747524|gb|AAL97049.1| putative ABC transporter (ATP-binding protein) [Streptococcus
           pyogenes MGAS8232]
          Length = 256

 Score =  244 bits (624), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I     EI++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   ILEINNLHVSI--EGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  G +ILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  +   +E ++ + 
Sbjct: 61  QILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAAMNADKA--DEDKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +  A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALATRLEK 238

Query: 241 NGYAELIKE 249
            GYA + ++
Sbjct: 239 EGYAGIAQD 247


>gi|225871207|ref|YP_002747154.1| ABC transporter, ATP-binding protein [Streptococcus equi subsp.
           equi 4047]
 gi|225700611|emb|CAW95148.1| putative ABC transporter, ATP-binding protein [Streptococcus equi
           subsp. equi 4047]
          Length = 260

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + G+ +Y++T G
Sbjct: 7   ILEINNLHVSI--EDKEILKGVNLTLRTGEIAAIMGPNGTGKSTLSAAIMGNPNYQVTEG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++ R++  + + 
Sbjct: 65  EILLDGVNILELEVDERARLGLFLAMQYPSEIPGITNAEFMRAAMNAGKEDRDK--ISVR 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +  A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 123 DFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R Q    +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A+ LE+
Sbjct: 183 DALKVVSKGVNEMRGQAFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALAIRLEK 242

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 243 EGYAGIAEE 251


>gi|72383271|ref|YP_292626.1| FeS assembly ATPase SufC [Prochlorococcus marinus str. NATL2A]
 gi|72003121|gb|AAZ58923.1| FeS assembly ATPase SufC [Prochlorococcus marinus str. NATL2A]
          Length = 263

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 173/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IK+L A +   D EI+ G+NL V+  E+ AIMG NGSGKSTLS +++GH  Y++ +G
Sbjct: 9   ILSIKDLHASV--EDQEILHGVNLLVKEGEIHAIMGRNGSGKSTLSKVIAGHPSYKVLSG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +KG++IL+    ERA  GIFL FQYPVEIPG+  ++FL++A N +RK   + EL   
Sbjct: 67  SIQFKGKNILELEPEERARIGIFLGFQYPVEIPGVSNLEFLRVATNSRRKELLKSELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   V++    + +N   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 QFEDLVKQRLKIVEMNPAFLERSVNEGFSGGEKKRNEILQMALLEPVISILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+N L   + + ++ITHYQRLLN I PD +H++ +GKIIKTG+  +A+DLE+
Sbjct: 187 DALRIVASGINRLSQPNSATILITHYQRLLNEITPDFVHIMADGKIIKTGNKELAIDLEK 246

Query: 241 NGY 243
           +GY
Sbjct: 247 SGY 249


>gi|330997785|ref|ZP_08321620.1| FeS assembly ATPase SufC [Paraprevotella xylaniphila YIT 11841]
 gi|329569673|gb|EGG51438.1| FeS assembly ATPase SufC [Paraprevotella xylaniphila YIT 11841]
          Length = 251

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 119/243 (48%), Positives = 171/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V P E+ A+MG NG+GKSTLS +L G+  YE+T+G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVNPGEIHALMGQNGAGKSTLSNVLVGNPAYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L     ERA +G+FL+FQ PVEIPG+ M+ F++ A+N +RK    + +   
Sbjct: 59  SVTFNGKDLLAMKPEERAHEGLFLSFQQPVEIPGVSMVNFMRAAINAKRKYHGMEPMSAG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 DFLKMMREKRKVVELDSKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+G N LR+ + S L+ITHYQRLL+Y+KPD +HVL  G+I+K+G   +A+++E 
Sbjct: 179 DALRIVAEGFNKLRTPETSALVITHYQRLLDYLKPDVVHVLLGGRIVKSGGPELAVEIEN 238

Query: 241 NGY 243
            G+
Sbjct: 239 KGF 241


>gi|15674460|ref|NP_268634.1| putative ABC transporter ATP-binding protein [Streptococcus
           pyogenes M1 GAS]
 gi|21909744|ref|NP_664012.1| putative ABC transporter ATP-binding protein [Streptococcus
           pyogenes MGAS315]
 gi|28895126|ref|NP_801476.1| ABC transporter ATP-binding protein [Streptococcus pyogenes SSI-1]
 gi|50913619|ref|YP_059591.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS10394]
 gi|56808476|ref|ZP_00366218.1| COG0396: ABC-type transport system involved in Fe-S cluster
           assembly, ATPase component [Streptococcus pyogenes M49
           591]
 gi|71910056|ref|YP_281606.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS5005]
 gi|94987875|ref|YP_595976.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS9429]
 gi|94989751|ref|YP_597851.1| ATP-dependent transporter sufC [Streptococcus pyogenes MGAS10270]
 gi|94991758|ref|YP_599857.1| ATP-dependent transporter sufC [Streptococcus pyogenes MGAS2096]
 gi|139473099|ref|YP_001127814.1| ABC transporter, ATP-binding protein [Streptococcus pyogenes str.
           Manfredo]
 gi|209558805|ref|YP_002285277.1| Iron-sulfur cluster assembly ATPase protein SufC [Streptococcus
           pyogenes NZ131]
 gi|306828012|ref|ZP_07461278.1| FeS assembly ATPase SufC [Streptococcus pyogenes ATCC 10782]
 gi|73921080|sp|Q7CFG9|Y208_STRP3 RecName: Full=Probable ABC transporter ATP-binding protein
           SpyM3_0208/SPs0214
 gi|73921094|sp|Q5XDV5|Y273_STRP6 RecName: Full=Probable ABC transporter ATP-binding protein
           M6_Spy0273
 gi|73921096|sp|Q9A1G5|Y285_STRP1 RecName: Full=Probable ABC transporter ATP-binding protein
           SPy_0285/M5005_Spy0242
 gi|13621557|gb|AAK33355.1| putative ABC transporter (ATP-binding protein) [Streptococcus
           pyogenes M1 GAS]
 gi|21903928|gb|AAM78815.1| putative ABC transporter, ATP-binding protein [Streptococcus
           pyogenes MGAS315]
 gi|28810371|dbj|BAC63309.1| putative ABC transporter (ATP-binding protein) [Streptococcus
           pyogenes SSI-1]
 gi|50902693|gb|AAT86408.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS10394]
 gi|71852838|gb|AAZ50861.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS5005]
 gi|94541383|gb|ABF31432.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS9429]
 gi|94543259|gb|ABF33307.1| ATP-dependent transporter sufC [Streptococcus pyogenes MGAS10270]
 gi|94545266|gb|ABF35313.1| ATP-dependent transporter sufC [Streptococcus pyogenes MGAS2096]
 gi|134271345|emb|CAM29563.1| putative ABC transporter, ATP-binding protein [Streptococcus
           pyogenes str. Manfredo]
 gi|209540006|gb|ACI60582.1| Iron-sulfur cluster assembly ATPase protein SufC [Streptococcus
           pyogenes NZ131]
 gi|304429793|gb|EFM32836.1| FeS assembly ATPase SufC [Streptococcus pyogenes ATCC 10782]
          Length = 256

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I     EI++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   ILEINNLHVSI--EGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  G +ILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  +   +E ++ + 
Sbjct: 61  QILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAAMNAGKA--DEDKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +  A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALATRLEK 238

Query: 241 NGYAELIKE 249
            GYA + ++
Sbjct: 239 EGYAGIAQD 247


>gi|94993635|ref|YP_601733.1| ATP-dependent transporter sufC [Streptococcus pyogenes MGAS10750]
 gi|94547143|gb|ABF37189.1| ATP-dependent transporter sufC [Streptococcus pyogenes MGAS10750]
          Length = 256

 Score =  244 bits (623), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I     EI++G+NL ++  EV AIMGPNG+GKSTLS ++ G+ +YE+T G
Sbjct: 3   ILEINNLYVSI--EGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAVIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  G +ILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  +   +E ++ + 
Sbjct: 61  QILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAAMNAGKA--DEDKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +  A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALATRLEK 238

Query: 241 NGYAELIKE 249
            GYA + ++
Sbjct: 239 EGYAGIAQD 247


>gi|259047102|ref|ZP_05737503.1| SUF system FeS assembly ATPase [Granulicatella adiacens ATCC 49175]
 gi|259036152|gb|EEW37407.1| SUF system FeS assembly ATPase [Granulicatella adiacens ATCC 49175]
          Length = 256

 Score =  244 bits (623), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 175/248 (70%), Gaps = 4/248 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL   I   D EI++G+NL +   E+ A+MGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 4   LEIKNLHVSI--EDKEILKGVNLTINTGEIHAVMGPNGTGKSTLSAAIMGHPSYEVTQGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  GE++L+  + ERA  G+FLA QYP EI G+   +F++ A+N +R+  ++  + + +
Sbjct: 62  ILLDGENVLEMEVDERARAGLFLAMQYPSEIVGVTNAEFMRSAINARREEGDK--MGVRE 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ +  A L +  +M +R LN GFSGGEKK  EILQ+ ++EP+  ILDE DSGLDID
Sbjct: 120 FIKKLDEKMALLDMPEEMAERYLNEGFSGGEKKRNEILQLLMIEPTFAILDEIDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++GVNA+R  +   LIITHYQRLLNYI+PD +H++ +G+++ TGD S+A  LE  
Sbjct: 180 ALKVVSRGVNAMRGDNFGSLIITHYQRLLNYIEPDVVHIMMDGRVVMTGDASLARRLEAE 239

Query: 242 GYAELIKE 249
           GY  + +E
Sbjct: 240 GYKGISEE 247


>gi|320449482|ref|YP_004201578.1| FeS assembly ATPase SufC [Thermus scotoductus SA-01]
 gi|320149651|gb|ADW21029.1| FeS assembly ATPase SufC [Thermus scotoductus SA-01]
          Length = 250

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 131/248 (52%), Positives = 177/248 (71%), Gaps = 7/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEI++L A I D +T I++G+NL V   +V A+MGPNG+GKSTL  +L+G  +Y +  GD
Sbjct: 4   LEIRDLWASI-DGET-ILKGVNLVVPKGQVHALMGPNGAGKSTLGKILAGDPEYTVERGD 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           IL  GESILD S  ERA KG+FLAFQYPVE+PG+ +  FL++AL    +A+  +E+ + +
Sbjct: 62  ILLDGESILDLSPDERARKGLFLAFQYPVEVPGVTIANFLRLAL----QAKLGREVGVAE 117

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F  KV++    L  +   L R LN GFSGGEKK  EILQ+ +LEP+  +LDETDSGLDID
Sbjct: 118 FWAKVKRALELLDWDEGYLSRYLNEGFSGGEKKRNEILQLLVLEPAYAVLDETDSGLDID 177

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVNA+R  +   L+ITHYQRLLNYI PD +HV+ +G+I+  G   +AL+LE  
Sbjct: 178 ALKVVARGVNAMRGPNFGALVITHYQRLLNYIVPDRVHVMMDGRIVAEGGPELALELEAK 237

Query: 242 GYAELIKE 249
           GY E ++E
Sbjct: 238 GY-EWLRE 244


>gi|253577639|ref|ZP_04854948.1| FeS assembly ATPase SufC [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251842966|gb|EES71005.1| FeS assembly ATPase SufC [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 267

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 171/246 (69%), Gaps = 5/246 (2%)

Query: 4   IKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL 63
           ++ L+A I   + EI++G+NL+++  E+ AIMGPNG+GKSTL+  L GH  YE+T G + 
Sbjct: 14  VEGLKATI--EEKEILKGINLEIKGGEIHAIMGPNGTGKSTLASALMGHPKYEVTDGKVT 71

Query: 64  YKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFT 123
             GE +L+ ++ ERA  G+FLA QYP EI G+    FL+ A+N +R   NE  L+   F 
Sbjct: 72  LNGEDVLEMAVDERARAGMFLAMQYPSEIAGVTNADFLRSAINARRGEGNEISLI--KFI 129

Query: 124 RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDAL 183
           R++ +    L +N +   R LN GFSGGEKK  EILQM LL+P + ILDE DSGLDIDAL
Sbjct: 130 RQMEEQMKVLEMNPEFAHRYLNEGFSGGEKKRNEILQMLLLDPKIVILDEIDSGLDIDAL 189

Query: 184 KIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGY 243
           +I A GVN++RS+DR FLIITHYQRLLNYIKPD +HV+  G+I+K+G   +A  LE  GY
Sbjct: 190 RIVANGVNSMRSEDRGFLIITHYQRLLNYIKPDYVHVMMQGRIVKSGGPELAERLEAEGY 249

Query: 244 AELIKE 249
            + +KE
Sbjct: 250 -DWVKE 254


>gi|124808412|ref|XP_001348306.1| SufC ATPase, putative [Plasmodium falciparum 3D7]
 gi|23497198|gb|AAN36745.1| SufC ATPase, putative [Plasmodium falciparum 3D7]
          Length = 347

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 178/249 (71%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L A  ++ + EI++G+NL++   E   IMG NGSGKSTL+ +++GH  Y+IT G
Sbjct: 99  LLEIKDLHAIEIEGEKEILKGINLEIYLGEKHTIMGRNGSGKSTLAKVIAGHPYYKITKG 158

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I YKG  +++  +  R+  GIFLAFQYPVE+P +   +FL+ ALN  R+ RNE+E+ + 
Sbjct: 159 IIKYKGLDLINLPVNVRSLCGIFLAFQYPVELPMVKNNEFLRAALNSHRRHRNEEEISVS 218

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +   ++G++ + L RP+N GFSGGEKK  EILQM +L+P+ CILDETDSGLD+
Sbjct: 219 EFNLMMIEEIKKVGLSSEFLDRPVNYGFSGGEKKRNEILQMLILKPTFCILDETDSGLDV 278

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           D+ K+ +  +    + + SFLI+THY++LL  +KP+ IH++H GKII++GD+S+   +E 
Sbjct: 279 DSFKLTSNVITNFSNDNNSFLIVTHYKKLLELLKPNFIHIMHQGKIIESGDFSLVDKIEN 338

Query: 241 NGYAELIKE 249
            GY++ +KE
Sbjct: 339 KGYSQFLKE 347


>gi|118411025|ref|YP_874420.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Phaeodactylum tricornutum]
 gi|116739772|gb|ABK20643.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Phaeodactylum tricornutum]
          Length = 252

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 168/246 (68%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL+  I   + +I++ LNL +   E+ AIMGPNGSGKST S +L+GH  Y I  G
Sbjct: 7   LLEIKNLQVSI--NENQILKNLNLTINKGEIHAIMGPNGSGKSTFSKVLAGHPAYSILGG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+KG SILD    ER+  GIFLAFQYPVEIPG+    FL++A N ++K  N+ E+   
Sbjct: 65  DILFKGSSILDLEPEERSHLGIFLAFQYPVEIPGVSNEDFLRLAYNSKQKFYNKVEVDPI 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +    + ++   L R +N GFSGGEKK  EILQM LL+  L ILDETDSGLDI
Sbjct: 125 EFLTIITQKLQLVNMSARFLGRNVNEGFSGGEKKRNEILQMILLDSELSILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI + G+N     ++S ++ITHYQRLL+Y+ P+ +HV+ NGKIIKTG   +A +LE 
Sbjct: 185 DALKIISNGINNFMGPEKSIILITHYQRLLDYVNPNYVHVMQNGKIIKTGSAELAKELEA 244

Query: 241 NGYAEL 246
            GY  L
Sbjct: 245 KGYEWL 250


>gi|257883795|ref|ZP_05663448.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,501]
 gi|257819633|gb|EEV46781.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,501]
          Length = 257

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   + EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVSI--EEKEILKGVNLTMKTGEIHAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ G+++LD  + ERA  G+FLA QYP EIPGI   +F++ A+N +R   N+K + + 
Sbjct: 61  EILFDGKNVLDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAAINAKRD-ENDK-ISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+ +  A L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDI
Sbjct: 119 AFLKKLDEKMALLNMPEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVN +R  +   LIITHYQRLLNYI PD +H++  G+I+ TG+  +A  LE 
Sbjct: 179 DALKVVAKGVNEMRGDNFGALIITHYQRLLNYITPDVVHIMMEGRIVMTGNADLAKRLEA 238

Query: 241 NGYAELIKE 249
            GYA + KE
Sbjct: 239 EGYAGISKE 247


>gi|124024849|ref|YP_001013965.1| ABC transporter, ATP binding component [Prochlorococcus marinus
           str. NATL1A]
 gi|123959917|gb|ABM74700.1| ABC transporter, ATP binding component [Prochlorococcus marinus
           str. NATL1A]
          Length = 263

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 173/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IK+L A +   D EI+ G+NL V+  E+ AIMG NGSGKSTLS +++GH  Y++ +G
Sbjct: 9   ILSIKDLHASV--EDQEILHGVNLLVKEGEIHAIMGRNGSGKSTLSKVIAGHPAYKVLSG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +KG++IL+    ERA  GIFL FQYPVEIPG+  ++FL++A N +RK   + EL   
Sbjct: 67  SIQFKGKNILELEPEERARIGIFLGFQYPVEIPGVSNLEFLRVATNSRRKELLKSELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   V++    + +N   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 QFEDLVKQRLKIVEMNPAFLERSVNEGFSGGEKKRNEILQMALLEPVISILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+N L   + + ++ITHYQRLLN I PD +H++ +GKIIKTG+  +A+DLE+
Sbjct: 187 DALRIVASGINRLSQPNSATILITHYQRLLNEITPDFVHIMADGKIIKTGNKELAIDLEK 246

Query: 241 NGY 243
           +GY
Sbjct: 247 SGY 249


>gi|282892127|ref|ZP_06300602.1| hypothetical protein pah_c207o066 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498022|gb|EFB40366.1| hypothetical protein pah_c207o066 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 253

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 171/248 (68%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M++I NL A +      I++GLNL V P E+ AIMGPNG+GKSTL+ +L+GH  YE+T G
Sbjct: 1   MIKIINLHASV--EGKPILKGLNLTVHPGEIHAIMGPNGAGKSTLAKVLAGHPAYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+  + +L+    ERA  G+F++FQYPVEI G+  +QFL  A N  RKA+NE  L + 
Sbjct: 59  QILFNDQDVLELEPEERAHLGLFMSFQYPVEISGVSNIQFLHTAYNANRKAKNEPTLSLE 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + + +    + I  +  +R LN GFSGGEKK  EILQM +L P L ILDETDSGLDI
Sbjct: 119 EFDQLLDEKMKLMEIKPEFKERSLNEGFSGGEKKRNEILQMAILTPKLAILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A+GVN L + +   ++ITHYQRLL+YIKP  +HV+  GKI+++G   +AL+LE 
Sbjct: 179 DAMRIVARGVNQLMTPETEIILITHYQRLLDYIKPTYVHVMLEGKIVQSGGPELALELES 238

Query: 241 NGYAELIK 248
            GY  LI+
Sbjct: 239 KGYDWLIE 246


>gi|332969522|gb|EGK08541.1| FeS assembly ATPase SufC [Desmospora sp. 8437]
          Length = 274

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 169/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L I +L   I   D EI++G+NL+V+  E+ AIMGPNG+GKSTL+  L GH  YE+T G 
Sbjct: 19  LTINDLHVSI--EDKEILKGVNLEVKGGEIHAIMGPNGTGKSTLAQALMGHPRYEVTGGS 76

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +   GE +L+  + ERA KG+FLA QYP EI G+    FL+ A+N +R   NE  L I  
Sbjct: 77  VSLDGEDLLEMEVDERARKGLFLAMQYPSEISGVTNSDFLRSAVNARRGEGNE--LSIMK 134

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +++ K   +LG++     R LN GFSGGEKK  EILQM +LEP + ILDE DSGLDID
Sbjct: 135 FIKQLDKKMDQLGMDESFASRYLNEGFSGGEKKRNEILQMMMLEPRITILDEIDSGLDID 194

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVN++RS    FLIITHYQRLLNY+KPD +HV+  G+I+K+G   +A  LE  
Sbjct: 195 ALKVVAEGVNSMRSPQAGFLIITHYQRLLNYVKPDFVHVVMKGRIVKSGGPELAERLEAE 254

Query: 242 GYAELIKE 249
           GY + +KE
Sbjct: 255 GY-DWVKE 261


>gi|308068312|ref|YP_003869917.1| Vegetative protein 296 (VEG296) [Paenibacillus polymyxa E681]
 gi|305857591|gb|ADM69379.1| Vegetative protein 296 (VEG296) [Paenibacillus polymyxa E681]
          Length = 260

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 171/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
            +I+ L+A I     EI++G+NL+++  E+ AIMGPNG+GKSTL+  L GH  YE+T G 
Sbjct: 5   FKIEGLKATI--EGKEILKGINLEMKGGEIHAIMGPNGTGKSTLASALMGHPKYEVTDGK 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +   GE +LD  + ERA  G+FLA QYP EI G+    FL+ A+N +R+   E  L+   
Sbjct: 63  VTLDGEDVLDMEVDERARAGLFLAMQYPSEIAGVTNSDFLRSAINARREEGQEISLI--K 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R++     EL +N +   R LN GFSGGEKK  EILQM +++P + ILDE DSGLDID
Sbjct: 121 FIRQMESKMKELEMNPEFAHRYLNEGFSGGEKKRNEILQMMMIDPKIVILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL+I A GVNA+RS++R FLIITHYQRLLNY+KPD +HV+  G+I+K+G   +A  LE +
Sbjct: 181 ALRIVASGVNAMRSEERGFLIITHYQRLLNYVKPDYVHVMMQGRIVKSGGPELAERLEAD 240

Query: 242 GYAELIKE 249
           GY + IKE
Sbjct: 241 GY-DWIKE 247


>gi|69245842|ref|ZP_00603659.1| FeS assembly ATPase SufC [Enterococcus faecium DO]
 gi|227552275|ref|ZP_03982324.1| iron-sulfur ABC superfamily ATP binding cassette transporter, ABC
           protein [Enterococcus faecium TX1330]
 gi|257879169|ref|ZP_05658822.1| FeS assembly ATPase SufC [Enterococcus faecium 1,230,933]
 gi|257882024|ref|ZP_05661677.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,502]
 gi|257886559|ref|ZP_05666212.1| FeS assembly ATPase SufC [Enterococcus faecium 1,141,733]
 gi|257889999|ref|ZP_05669652.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,410]
 gi|257892761|ref|ZP_05672414.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,408]
 gi|257895147|ref|ZP_05674800.1| FeS assembly ATPase SufC [Enterococcus faecium Com12]
 gi|257897759|ref|ZP_05677412.1| FeS assembly ATPase SufC [Enterococcus faecium Com15]
 gi|258615555|ref|ZP_05713325.1| ABC transporter, ATP-binding protein [Enterococcus faecium DO]
 gi|260560184|ref|ZP_05832361.1| FeS assembly ATPase SufC [Enterococcus faecium C68]
 gi|293377865|ref|ZP_06624046.1| FeS assembly ATPase SufC [Enterococcus faecium PC4.1]
 gi|293553783|ref|ZP_06674400.1| FeS assembly ATPase SufC [Enterococcus faecium E1039]
 gi|293563478|ref|ZP_06677926.1| FeS assembly ATPase SufC [Enterococcus faecium E1162]
 gi|293569076|ref|ZP_06680388.1| FeS assembly ATPase SufC [Enterococcus faecium E1071]
 gi|293571250|ref|ZP_06682284.1| FeS assembly ATPase SufC [Enterococcus faecium E980]
 gi|294615164|ref|ZP_06695048.1| FeS assembly ATPase SufC [Enterococcus faecium E1636]
 gi|294619917|ref|ZP_06699293.1| FeS assembly ATPase SufC [Enterococcus faecium E1679]
 gi|294620809|ref|ZP_06700013.1| FeS assembly ATPase SufC [Enterococcus faecium U0317]
 gi|314938395|ref|ZP_07845686.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133a04]
 gi|314942320|ref|ZP_07849168.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133C]
 gi|314947747|ref|ZP_07851154.1| FeS assembly ATPase SufC [Enterococcus faecium TX0082]
 gi|314951454|ref|ZP_07854504.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133A]
 gi|314993135|ref|ZP_07858521.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133B]
 gi|314996018|ref|ZP_07861096.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133a01]
 gi|68195544|gb|EAN09986.1| FeS assembly ATPase SufC [Enterococcus faecium DO]
 gi|227178605|gb|EEI59577.1| iron-sulfur ABC superfamily ATP binding cassette transporter, ABC
           protein [Enterococcus faecium TX1330]
 gi|257813397|gb|EEV42155.1| FeS assembly ATPase SufC [Enterococcus faecium 1,230,933]
 gi|257817682|gb|EEV45010.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,502]
 gi|257822613|gb|EEV49545.1| FeS assembly ATPase SufC [Enterococcus faecium 1,141,733]
 gi|257826359|gb|EEV52985.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,410]
 gi|257829140|gb|EEV55747.1| FeS assembly ATPase SufC [Enterococcus faecium 1,231,408]
 gi|257831712|gb|EEV58133.1| FeS assembly ATPase SufC [Enterococcus faecium Com12]
 gi|257835671|gb|EEV60745.1| FeS assembly ATPase SufC [Enterococcus faecium Com15]
 gi|260073751|gb|EEW62076.1| FeS assembly ATPase SufC [Enterococcus faecium C68]
 gi|291588257|gb|EFF20093.1| FeS assembly ATPase SufC [Enterococcus faecium E1071]
 gi|291591984|gb|EFF23609.1| FeS assembly ATPase SufC [Enterococcus faecium E1636]
 gi|291593854|gb|EFF25352.1| FeS assembly ATPase SufC [Enterococcus faecium E1679]
 gi|291599594|gb|EFF30607.1| FeS assembly ATPase SufC [Enterococcus faecium U0317]
 gi|291602076|gb|EFF32311.1| FeS assembly ATPase SufC [Enterococcus faecium E1039]
 gi|291604480|gb|EFF33966.1| FeS assembly ATPase SufC [Enterococcus faecium E1162]
 gi|291608657|gb|EFF37945.1| FeS assembly ATPase SufC [Enterococcus faecium E980]
 gi|292643412|gb|EFF61541.1| FeS assembly ATPase SufC [Enterococcus faecium PC4.1]
 gi|313589772|gb|EFR68617.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133a01]
 gi|313592375|gb|EFR71220.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133B]
 gi|313596411|gb|EFR75256.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133A]
 gi|313598937|gb|EFR77782.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133C]
 gi|313642293|gb|EFS06873.1| FeS assembly ATPase SufC [Enterococcus faecium TX0133a04]
 gi|313645727|gb|EFS10307.1| FeS assembly ATPase SufC [Enterococcus faecium TX0082]
          Length = 257

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   + EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVSI--EEKEILKGVNLTMKTGEIHAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ G+++LD  + ERA  G+FLA QYP EIPGI   +F++ A+N +R   N+K + + 
Sbjct: 61  EILFDGKNVLDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAAINAKRD-ENDK-ISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+ +  A L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDI
Sbjct: 119 AFLKKLDEKMALLNMPEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVN +R  +   LIITHYQRLLNYI PD +H++  G+++ TG+  +A  LE 
Sbjct: 179 DALKVVAKGVNEMRGDNFGALIITHYQRLLNYITPDVVHIMMEGRVVMTGNADLAKRLEA 238

Query: 241 NGYAELIKE 249
            GYA + KE
Sbjct: 239 EGYAGISKE 247


>gi|332881713|ref|ZP_08449361.1| FeS assembly ATPase SufC [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332680352|gb|EGJ53301.1| FeS assembly ATPase SufC [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 251

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/243 (48%), Positives = 171/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G+NL V P E+ A+MG NG+GKSTLS +L G+  YE+T+G
Sbjct: 1   MLEIKDLHASI--NGKEILKGINLTVNPGEIHALMGQNGAGKSTLSNVLVGNPAYEVTSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + + G+ +L     ERA +G+FL+FQ PVEIPG+ M+ F++ A+N +RK    + +   
Sbjct: 59  SVTFNGKDLLAMKPEERAHEGLFLSFQQPVEIPGVSMVNFMRAAINGKRKYHGMEPMSAG 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 DFLKMMREKRKVVELDSKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+G N LR+ + S L+ITHYQRLL+Y+KPD +HVL  G+I+K+G   +A+++E 
Sbjct: 179 DALRIVAEGFNKLRTPETSALVITHYQRLLDYLKPDVVHVLLGGRIVKSGGPELAVEIEN 238

Query: 241 NGY 243
            G+
Sbjct: 239 KGF 241


>gi|78183984|ref|YP_376419.1| FeS assembly ATPase SufC [Synechococcus sp. CC9902]
 gi|78168278|gb|ABB25375.1| FeS assembly ATPase SufC [Synechococcus sp. CC9902]
          Length = 262

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I +L A +   D  I++G+NL+V   E+ A+MG NGSGKSTLS +L+GH  Y +T+G
Sbjct: 9   LLDITDLHASV--EDQPILKGVNLQVRSGEIHAVMGRNGSGKSTLSKVLAGHPAYRVTSG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+GE++ +    ERA  G+FL FQYPVEIPG+  ++FL++A N +R  +N +EL   
Sbjct: 67  TVRYRGENLFELEAEERARLGVFLGFQYPVEIPGVSNLEFLRVATNARRLKQNLEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V +    + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 DFEDHVHERLKVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLEPVVAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L + D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVAGGVNQLANADNATLLITHYQRLLDEITPDYVHVMAAGRILRTGGRELALELEQ 246

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 247 IGYDWVDKE 255


>gi|294675012|ref|YP_003575628.1| FeS assembly ATPase SufC [Prevotella ruminicola 23]
 gi|294473215|gb|ADE82604.1| FeS assembly ATPase SufC [Prevotella ruminicola 23]
          Length = 251

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 177/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL AKI   D EI++G++L +   E  AIMGPNGSGKSTLS +L G+  YE+T G
Sbjct: 1   MLEVKNLHAKI--GDKEILKGIDLVINDGETHAIMGPNGSGKSTLSAVLVGNPLYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +  + G+++L+    +RA +G+FL+FQYPVEIPG+ M  F+K A+NE+RK +  + +   
Sbjct: 59  EAFFNGKNLLEMKPEDRAHEGLFLSFQYPVEIPGVSMTNFMKAAINEKRKYQGLEPMNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +  R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 EFLKLQREKRKIVELDSKLANRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A+GVN L++ + S ++ITHY RLL  IKP  +HVL+ G+I+KTG   +A+ ++E
Sbjct: 179 DAMRIVAEGVNKLQTPETSCIVITHYDRLLEMIKPQFVHVLYKGRIVKTGGPELAVQIQE 238

Query: 241 NGYAELIKE 249
           +GY + IKE
Sbjct: 239 HGY-DWIKE 246


>gi|261208054|ref|ZP_05922729.1| FeS assembly ATPase SufC [Enterococcus faecium TC 6]
 gi|289565515|ref|ZP_06445963.1| FeS assembly ATPase SufC [Enterococcus faecium D344SRF]
 gi|260077638|gb|EEW65354.1| FeS assembly ATPase SufC [Enterococcus faecium TC 6]
 gi|289162713|gb|EFD10565.1| FeS assembly ATPase SufC [Enterococcus faecium D344SRF]
          Length = 256

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   + EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVSI--EEKEILKGVNLTMKTGEIHAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ G+++LD  + ERA  G+FLA QYP EIPGI   +F++ A+N +R   N+K + + 
Sbjct: 61  EILFDGKNVLDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAAINAKRD-ENDK-ISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+ +  A L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDI
Sbjct: 119 AFLKKLDEKMALLNMPEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVN +R  +   LIITHYQRLLNYI PD +H++  G+++ TG+  +A  LE 
Sbjct: 179 DALKVVAKGVNEMRGDNFGALIITHYQRLLNYITPDVVHIMMEGRVVMTGNADLAKRLEA 238

Query: 241 NGYAELIKE 249
            GYA + KE
Sbjct: 239 EGYAGISKE 247


>gi|159896945|ref|YP_001543192.1| FeS assembly ATPase SufC [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889984|gb|ABX03064.1| FeS assembly ATPase SufC [Herpetosiphon aurantiacus ATCC 23779]
          Length = 263

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/254 (49%), Positives = 177/254 (69%), Gaps = 9/254 (3%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L I+NL   +     EI++G+NL +E  ++ AIMGPNGSGKSTL+Y L+GH  YE+T G+
Sbjct: 6   LVIRNLHVAV--DGKEILKGINLTIEEGKIHAIMGPNGSGKSTLAYTLAGHPRYEVTEGE 63

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQR--KARNEKELLI 119
           + YKG+ +LD    +R+  G+FLAFQYPV + G+ +  FL+ ALN  R  +  + K   I
Sbjct: 64  VWYKGQDVLDLEPNDRSKLGLFLAFQYPVAVAGVTVANFLRAALNAHRAQEGVDPKSTAI 123

Query: 120 P--DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           P  ++ + ++     L +  D  +R LN GFSGGEKK  EILQM +L+P++ I+DETDSG
Sbjct: 124 PMAEYRKVIKARMDMLEMAPDFARRYLNEGFSGGEKKRLEILQMAMLQPAMAIMDETDSG 183

Query: 178 LDIDALKIAAQGVNALRSQ--DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIA 235
           LDIDALKI A+GVN ++++  +   L+ITHYQRLLNYIKPD +HVL NG+I++ G   +A
Sbjct: 184 LDIDALKIVAEGVNKVKAEKPELGVLVITHYQRLLNYIKPDYVHVLMNGQIVREGGPDMA 243

Query: 236 LDLEENGYAELIKE 249
           L+LEE GY + I+E
Sbjct: 244 LELEEKGY-DFIRE 256


>gi|194477106|ref|YP_002049285.1| FeS assembly ATPase SufC [Paulinella chromatophora]
 gi|171192113|gb|ACB43075.1| FeS assembly ATPase SufC [Paulinella chromatophora]
          Length = 264

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI +L A++   +  I++G+NL++   E+ AIMG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLEITDLHAQV--ENQPILKGVNLRIRAGEIHAIMGRNGSGKSTLSKILAGHPAYTVTDG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I+Y+G  +   S  ERA  GIFL FQYP+EIPG+  ++FL++A N +R  + E+EL   
Sbjct: 67  SIIYRGNDLTQLSPEERARAGIFLGFQYPIEIPGVSNLEFLRVATNARRLGKGEEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V++    + ++   L+R +N GFSGGEKK  EILQM LLEP L ILDETDSGLDI
Sbjct: 127 DFEDLVQEKIKIVQMDPTFLERSVNEGFSGGEKKRNEILQMALLEPVLSILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L + D + ++ITHYQRLL  I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVAKGVNQLATADSAIVLITHYQRLLEIITPDYVHVMAGGRILRTGGNLLALELEK 246

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 247 IGYDWVDKE 255


>gi|257432961|ref|ZP_05609321.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257282376|gb|EEV12511.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           E1410]
          Length = 253

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 171/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTKGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM++R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKNMDFLDIDKDMVQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKHLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|254432300|ref|ZP_05046003.1| FeS assembly ATPase SufC [Cyanobium sp. PCC 7001]
 gi|197626753|gb|EDY39312.1| FeS assembly ATPase SufC [Cyanobium sp. PCC 7001]
          Length = 271

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 169/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI++L A +   D  I++G+NL +   E+ A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLEIQDLHASV--EDQPILKGVNLTIRAGEIHAVMGRNGSGKSTLSKVLAGHPAYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+GE++LD    +RA  G+FL FQYPVEIPG+  ++FL+++ N +R  R E+EL   
Sbjct: 67  SVQYRGENLLDLDPEQRARVGLFLGFQYPVEIPGVSNLEFLRVSTNARRAERGEEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   V++    + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 AFEDLVKERLKVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLEPVVAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S D + L+ITHYQRLL  I PD +HV+  G+I+++G   +AL+LE 
Sbjct: 187 DALRIVAGGVNHLASPDNATLLITHYQRLLGLITPDHVHVMAAGRILRSGGKELALELER 246

Query: 241 NGY 243
            GY
Sbjct: 247 TGY 249


>gi|33864856|ref|NP_896415.1| ABC transporter, ATP-binding component [Synechococcus sp. WH 8102]
 gi|33632379|emb|CAE06835.1| ABC transporter, ATP-binding component [Synechococcus sp. WH 8102]
          Length = 303

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 172/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I NL A +   D  I++G+NL+V   E+ A+MG NGSGKSTLS +L+GH  Y +TAG
Sbjct: 50  LLDINNLHASV--EDQPILKGVNLQVRAGEIHAVMGRNGSGKSTLSKVLAGHPAYRVTAG 107

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G  + +    ERA  G+FL FQYPVEIPG+  ++FL++A N +R  +  +EL   
Sbjct: 108 TVRYRGSDLFELEPEERARLGVFLGFQYPVEIPGVSNLEFLRVAANARRSKQGLEELDTF 167

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V++    + ++   L+R +N GFSGGEKK  EILQM LL+P + ILDETDSGLDI
Sbjct: 168 DFEDHVQQKLQVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLDPVVAILDETDSGLDI 227

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L + D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 228 DALRIVAGGVNQLATPDNATLLITHYQRLLDEITPDYVHVMAAGRILRTGSRDLALELEK 287

Query: 241 NGYAELIKE 249
            GY  + KE
Sbjct: 288 TGYDWVDKE 296


>gi|242242205|ref|ZP_04796650.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus epidermidis W23144]
 gi|242234378|gb|EES36690.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus epidermidis W23144]
 gi|319401807|gb|EFV90015.1| feS assembly ATPase SufC [Staphylococcus epidermidis FRI909]
          Length = 253

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELDVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKQMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGEEFGALMITHYQRLLNYITPDQVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|27467524|ref|NP_764161.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis
           ATCC 12228]
 gi|57866417|ref|YP_188088.1| FeS assembly ATPase SufC [Staphylococcus epidermidis RP62A]
 gi|251810283|ref|ZP_04824756.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875594|ref|ZP_06284465.1| FeS assembly ATPase SufC [Staphylococcus epidermidis SK135]
 gi|293368290|ref|ZP_06614918.1| FeS assembly ATPase SufC [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315067|gb|AAO04203.1|AE016745_302 ABC transporter (ATP-binding protein) [Staphylococcus epidermidis
           ATCC 12228]
 gi|57637075|gb|AAW53863.1| FeS assembly ATPase SufC [Staphylococcus epidermidis RP62A]
 gi|251806165|gb|EES58822.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295621|gb|EFA88144.1| FeS assembly ATPase SufC [Staphylococcus epidermidis SK135]
 gi|291317537|gb|EFE57955.1| FeS assembly ATPase SufC [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329726775|gb|EGG63235.1| FeS assembly ATPase SufC [Staphylococcus epidermidis VCU144]
 gi|329736761|gb|EGG73026.1| FeS assembly ATPase SufC [Staphylococcus epidermidis VCU028]
 gi|329737580|gb|EGG73826.1| FeS assembly ATPase SufC [Staphylococcus epidermidis VCU045]
          Length = 253

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELDVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKQMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGEEFGALMITHYQRLLNYITPDKVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|125624752|ref|YP_001033235.1| ATP-dependent transporter [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124493560|emb|CAL98544.1| Probable ATP-dependent transporter [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300071551|gb|ADJ60951.1| ATP-dependent transporter [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 256

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 176/248 (70%), Gaps = 4/248 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL   I   D EI++G+NL +  +E+ AIMGPNG+GKSTLS  + G+ +Y +T G+
Sbjct: 4   LEIKNLHVAI--EDKEILKGVNLVINTNEIHAIMGPNGTGKSTLSAAIMGNPNYTVTEGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L+ G+++L+  + ERA  G+FLA QYP EIPGI   +FL+ A+N +R A ++K + + +
Sbjct: 62  VLFDGQNVLEMEVDERARLGLFLAMQYPSEIPGITNAEFLRAAMNAKR-AEDDK-VSVME 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDID
Sbjct: 120 FIKKLDKNMDVLSMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVN++R +    LIITHYQRLL+YI PD +H++ +G+++KTG   +A  LE  
Sbjct: 180 ALKVVAKGVNSMRGEKFGALIITHYQRLLDYITPDVVHIMMDGRVVKTGGAELAKRLETE 239

Query: 242 GYAELIKE 249
           GY  + +E
Sbjct: 240 GYVNIAEE 247


>gi|222152524|ref|YP_002561699.1| ABC transporter ATP-binding protein [Streptococcus uberis 0140J]
 gi|222113335|emb|CAR40928.1| putative ABC transporter, ATP-binding protein [Streptococcus uberis
           0140J]
          Length = 256

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 176/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL   I   + EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVSI--EEKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G +ILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++  ++ ++ + 
Sbjct: 61  EILLDGVNILDLEVDERARMGLFLAMQYPSEIPGITNAEFMRAAMNAGKE--DDDKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDQKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD  +A  LE+
Sbjct: 179 DALKVVSKGVNDMRQKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAQLAQRLEK 238

Query: 241 NGYAELIKE 249
            GY+ + +E
Sbjct: 239 EGYSGIAEE 247


>gi|87301372|ref|ZP_01084213.1| FeS assembly ATPase SufC [Synechococcus sp. WH 5701]
 gi|87284340|gb|EAQ76293.1| FeS assembly ATPase SufC [Synechococcus sp. WH 5701]
          Length = 262

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 173/243 (71%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI +L+A++   D  I++G+NL ++  E+ A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLEIVDLQARV--EDKPILKGVNLTIKAGEIHAVMGRNGSGKSTLSKVLAGHPAYTVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +LY+G ++LD    +RA  G+FL FQYPVEIPG+  ++FL+++ N +R  + E+EL   
Sbjct: 67  SVLYRGANLLDLEPEQRARSGLFLGFQYPVEIPGVSNLEFLRVSTNARRMEKGEEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   VR+    + ++   L+R +N GFSGGEKK  EILQM LL+P + ILDETDSGLDI
Sbjct: 127 AFEDLVRERLEVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLDPLVAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S + + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVAGGVNHLASPENATLLITHYQRLLDVITPDYVHVMAGGRILRTGGKELALELED 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|325269679|ref|ZP_08136292.1| FeS assembly ATPase SufC [Prevotella multiformis DSM 16608]
 gi|324988047|gb|EGC20017.1| FeS assembly ATPase SufC [Prevotella multiformis DSM 16608]
          Length = 252

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 179/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A I     EI++G+NL V+  EV AIMGPNGSGKSTLS +L+G+  YE+T G
Sbjct: 1   MLEVRNLHATI--AGKEILKGINLTVKDGEVHAIMGPNGSGKSTLSAVLTGNPLYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++ G+++L+    +R+ +G+FL+FQYPVEIPG+ M  F+K A+N +R  +  + L   
Sbjct: 59  MAVFNGKNLLEMKPEDRSHEGLFLSFQYPVEIPGVSMTNFMKAAVNAKRAYQGLEPLKAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    +G++ ++ +R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 EFMVLMREKRRLVGMDSNLSRRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A+GVN + + + S ++ITHY+RLL+ IKPD +HVL+ G+I+KT    +A ++E+
Sbjct: 179 DAMRIVAEGVNKMHTDETSTIVITHYERLLDMIKPDVVHVLYKGRIVKTAGPELAKEIEQ 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|71902903|ref|YP_279706.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS6180]
 gi|71801998|gb|AAX71351.1| ABC transporter ATP-binding protein [Streptococcus pyogenes
           MGAS6180]
          Length = 256

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 174/249 (69%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I     EI++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   ILEINNLHVSI--EGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  G +ILD  + ERA  G+FLA QYP EIPGI   +F++ A+N  +  +++  + + 
Sbjct: 61  QILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAAMNAGKADKDK--ISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +  A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R +D   +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALATRLEK 238

Query: 241 NGYAELIKE 249
            GYA + ++
Sbjct: 239 EGYAGIAQD 247


>gi|87125293|ref|ZP_01081139.1| ABC transporter, ATP-binding component [Synechococcus sp. RS9917]
 gi|86167062|gb|EAQ68323.1| ABC transporter, ATP-binding component [Synechococcus sp. RS9917]
          Length = 255

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 167/243 (68%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI +L A +   D  I++G+NL+V   E+ A+MG NGSGKSTLS +L+GH  Y +TAG
Sbjct: 2   LLEISDLHASV--EDQPILKGVNLQVRAGEIHAVMGRNGSGKSTLSKVLAGHPAYRVTAG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G  + +    ERA  G+FL FQYPVEI G+  ++FL++A N +R+ R   EL   
Sbjct: 60  TVRYRGRDLFELEPEERARLGVFLGFQYPVEIAGVSNLEFLRVATNARRQCRELDELDTF 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR+    + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 120 EFEDHVREKLQVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLEPVVAILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L   D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 180 DALRIVAAGVNQLAGPDNATLLITHYQRLLDEITPDYVHVMAAGRILRTGGRELALELEQ 239

Query: 241 NGY 243
            GY
Sbjct: 240 TGY 242


>gi|288801642|ref|ZP_06407084.1| FeS assembly ATPase SufC [Prevotella melaninogenica D18]
 gi|288335684|gb|EFC74117.1| FeS assembly ATPase SufC [Prevotella melaninogenica D18]
          Length = 252

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 177/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A I     EI+RG+NL ++  E+ AIMGPNGSGKSTLS +L+G+  YE+T G
Sbjct: 1   MLEVRNLHATIAGK--EILRGINLTIKDGEIHAIMGPNGSGKSTLSAVLTGNPLYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             L+ G+++L+    +R+ +G+FL+FQYPVEIPG+ M  F+K A+N +R     + +   
Sbjct: 59  MALFNGKNLLEMKPEDRSHEGLFLSFQYPVEIPGVSMTNFMKAAINAKRAYEGLEPMKAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    +G++  + +R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 EFMALMREKRQLVGMDSTLSRRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A+GVN + ++  S ++ITHY+RLL+ IKPD IHVL+ G+I+KT    +A ++E+
Sbjct: 179 DAMRIVAEGVNKMHNETTSAIVITHYERLLDMIKPDVIHVLYKGRIVKTAGPELAKEIEQ 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|257870754|ref|ZP_05650407.1| FeS assembly ATPase SufC [Enterococcus gallinarum EG2]
 gi|257804918|gb|EEV33740.1| FeS assembly ATPase SufC [Enterococcus gallinarum EG2]
          Length = 257

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL  +I   D +I++G++L ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVQI--EDKKILKGVDLVLKTGEIHAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE++L+  + ERA  G+FLA QYP EIPGI   +F++ A+N +R    E ++ + 
Sbjct: 61  EILFDGENVLEMEVDERARLGLFLAMQYPSEIPGITNAEFMRAAINAKRD--EEDKISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDI
Sbjct: 119 DFLKKLDQKMDLLNMPEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVN +R +    LIITHYQRLLNYI PD +H++  G+++ TG   +A  LE 
Sbjct: 179 DALKVVAKGVNEMRGEGFGALIITHYQRLLNYITPDVVHIMMEGRVVMTGSADLAKRLEA 238

Query: 241 NGYAELIKE 249
            GYA + KE
Sbjct: 239 EGYAGISKE 247


>gi|157150929|ref|YP_001450994.1| FeS assembly ATPase SufC [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283282|ref|ZP_06061048.1| FeS assembly ATPase SufC [Streptococcus sp. 2_1_36FAA]
 gi|157075723|gb|ABV10406.1| FeS assembly ATPase SufC [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262260773|gb|EEY79473.1| FeS assembly ATPase SufC [Streptococcus sp. 2_1_36FAA]
          Length = 256

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     EI++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVEI--EGKEILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +E+++ + 
Sbjct: 61  EILFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DEEKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 119 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+  GK++ +G   +A+ LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDKVHVMMEGKVVLSGGPELAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 239 EGYAKLAEE 247


>gi|71892139|ref|YP_277871.1| Fe-S cluster assembly ABC transporter ATP-binding protein
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|71796245|gb|AAZ40996.1| putative transport protein associated with Fe-S cluster assembly
           (ABC superfamily, atp_bind) [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 246

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML +KNL   +   +  I++ LNL++ P E+  IMGPNGSGKSTLS  LSG ++Y +T G
Sbjct: 1   MLLVKNLNVSV--KNISILKKLNLEINPGEIHIIMGPNGSGKSTLSATLSGQQNYTVTNG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+K +++L     ERA +GIF+AFQ+PV+IPGI    FL  A+N  RK R++  +   
Sbjct: 59  EILFKNKNLLLLKPEERAGEGIFVAFQHPVDIPGISNQSFLHHAVNAVRKYRHQPLMDRF 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F + V+K  A L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 119 HFIQLVQKNMALLKMPNDLLNRSVNVGFSGGEKKRNDILQMMMLEPLLCILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+KI   G+N L  + RSF+IITHYQR+L YIKP+ +HVLH G I+K+GD S+   LEE
Sbjct: 179 DAIKIVYNGLNILNDKIRSFVIITHYQRILEYIKPNYVHVLHKGHIVKSGDISLVKQLEE 238

Query: 241 NGYAEL 246
            GY  L
Sbjct: 239 KGYGWL 244


>gi|312870254|ref|ZP_07730385.1| FeS assembly ATPase SufC [Lactobacillus oris PB013-T2-3]
 gi|311094277|gb|EFQ52590.1| FeS assembly ATPase SufC [Lactobacillus oris PB013-T2-3]
          Length = 265

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 164/232 (70%), Gaps = 2/232 (0%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVER 77
           I++G+NLK++  E+ AIMGPNG+GKSTLS  + G   Y +T GDIL  GESI+D  + ER
Sbjct: 24  ILKGVNLKMQTGEIHAIMGPNGTGKSTLSQTIMGQPGYHVTQGDILLNGESIVDMPVDER 83

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINM 137
           A KG+FLA QYP EI G+   +FL+ A+N +R    + ++ + DF +K+ K    L ++ 
Sbjct: 84  ARKGLFLAMQYPAEIQGVTNAEFLRAAINARRP--EDDQISVMDFIKKLDKNLDLLDMSQ 141

Query: 138 DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQD 197
            M +R LN GFSGGEKK  EILQ+ ++EP+  ILDE DSGLDIDALK+ A+GVN++R   
Sbjct: 142 KMTERYLNEGFSGGEKKRNEILQLLMIEPTFAILDEIDSGLDIDALKVVAKGVNSMRGDS 201

Query: 198 RSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELIKE 249
              LIITHYQRLLNYI PDT+HV+ +G+I+KTG   +A  LE+ GYA L  E
Sbjct: 202 FGSLIITHYQRLLNYIVPDTVHVMMDGQIVKTGGPELAKKLEDEGYAGLRDE 253


>gi|70727040|ref|YP_253954.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus
           JCSC1435]
 gi|68447764|dbj|BAE05348.1| ABC transporter ATP-binding protein [Staphylococcus haemolyticus
           JCSC1435]
          Length = 253

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTGEIHAIMGPNGTGKSTLSSAIMGHPSYEVTQGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKEMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINEMRGEEFGALMITHYQRLLNYITPDKVHVMYGGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|114331236|ref|YP_747458.1| FeS assembly ATPase SufC [Nitrosomonas eutropha C91]
 gi|114308250|gb|ABI59493.1| FeS assembly ATPase SufC [Nitrosomonas eutropha C91]
          Length = 263

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 168/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+ +L A +  +  EI++G+++ V   E+ AIMG NGSGKST + +L+GH  YE+T G
Sbjct: 9   LLEVHDLHATV--SGAEILKGVDITVRSGEIHAIMGLNGSGKSTFAKVLAGHPSYEVTRG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +L+ G+ +   +  ERA  GIFLAFQYPVEIPG+   QFL++A N  +  R E+EL   
Sbjct: 67  TLLFDGQDLSALAPEERARAGIFLAFQYPVEIPGVANNQFLRLAYNTVQGQRGEEELDPL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR+    L +N D L R +N GFSGGEKK  EILQM LLEP L +LDETDSGLDI
Sbjct: 127 EFDDFVREKMKLLKMNPDFLDRSVNEGFSGGEKKRNEILQMALLEPRLALLDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L ++D + +++THYQRLL+YI PD +HV+  G+II+T    +A  LE 
Sbjct: 187 DALRIVANGVNQLSNKDNALILVTHYQRLLDYIVPDYVHVMEAGRIIRTSGKELAQALET 246

Query: 241 NGY 243
           +GY
Sbjct: 247 HGY 249


>gi|260436762|ref|ZP_05790732.1| FeS assembly ATPase SufC [Synechococcus sp. WH 8109]
 gi|260414636|gb|EEX07932.1| FeS assembly ATPase SufC [Synechococcus sp. WH 8109]
          Length = 262

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 170/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I++L A +   D  I++G+NL+V   EV A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLDIQDLHASV--EDKPILKGVNLQVRAGEVHAVMGRNGSGKSTLSKVLAGHPAYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G+ + +    ERA  G+FL FQYPVEIPG+  ++FL+++ N +R+ + E+EL   
Sbjct: 67  TVRYRGQDLFELEPEERARLGVFLGFQYPVEIPGVSNLEFLRVSTNARREKQGEEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   V      + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 AFEDHVHDKLKVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLEPVVAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L ++D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVAGGVNQLATEDNATLLITHYQRLLDEITPDYVHVMAAGRILRTGGRELALELEQ 246

Query: 241 NGY 243
            GY
Sbjct: 247 TGY 249


>gi|227504373|ref|ZP_03934422.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Corynebacterium striatum ATCC 6940]
 gi|227199021|gb|EEI79069.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Corynebacterium striatum ATCC 6940]
          Length = 252

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 174/253 (68%), Gaps = 10/253 (3%)

Query: 2   LEIKNLRAKIVDTD-----TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYE 56
           LEIKNL A+++  D      EI++G+NL +   E  A+MGPNGSGKSTLSY+++GH  YE
Sbjct: 4   LEIKNLHAQVLPNDENGEPKEILKGVNLTINSGETHAVMGPNGSGKSTLSYVIAGHPKYE 63

Query: 57  ITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
           +T G+IL  GE+IL+  + ERA  G+FLA QYP E+PG+ M QF++ A+      R E  
Sbjct: 64  VTEGEILLDGENILEMEVDERARAGLFLAMQYPTEVPGVKMAQFMRSAVT---AVRGEAP 120

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
            L  ++ +++ +   +L I+     R +N GFSGGEKK  E++Q+ LL+P   I+DETDS
Sbjct: 121 KL-REWNKELTEAREKLSIDKSFAHRAVNEGFSGGEKKRHEVMQLDLLKPKFAIMDETDS 179

Query: 177 GLDIDALKIAAQGVNALRSQ-DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIA 235
           GLD+DAL++ ++G+N  + + +   L+ITHY+R+LNY+KPD +HV  NG++IKTG   +A
Sbjct: 180 GLDVDALRVVSEGINRFQEETNGGILMITHYKRILNYVKPDFVHVFANGQVIKTGGAELA 239

Query: 236 LDLEENGYAELIK 248
             LEE+GY + +K
Sbjct: 240 DQLEESGYDQFVK 252


>gi|257424961|ref|ZP_05601388.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427629|ref|ZP_05604028.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430263|ref|ZP_05606646.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257435865|ref|ZP_05611913.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus M876]
 gi|282913685|ref|ZP_06321474.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus M899]
 gi|282923601|ref|ZP_06331281.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus C101]
 gi|293500728|ref|ZP_06666579.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293509678|ref|ZP_06668389.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus M809]
 gi|293524265|ref|ZP_06670952.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           M1015]
 gi|257272531|gb|EEV04654.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275822|gb|EEV07295.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279040|gb|EEV09651.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257285056|gb|EEV15175.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus M876]
 gi|282314469|gb|EFB44859.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus C101]
 gi|282322717|gb|EFB53039.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus M899]
 gi|290921228|gb|EFD98289.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095733|gb|EFE25994.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467775|gb|EFF10290.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus M809]
          Length = 253

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTKGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKHLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|325977506|ref|YP_004287222.1| phosphate import ATP-binding protein pstB [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
 gi|325177434|emb|CBZ47478.1| phosphate import ATP-binding protein pstB [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 256

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 177/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GE+IL+  + ERA  G+FLA QYP EI GI   +F++ A+N  ++  ++ ++ + 
Sbjct: 61  EILLDGENILELEVDERARLGLFLAMQYPSEITGITNAEFIRAAMNAGKE--DDDKISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMEFLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVNA+R  +   +IITHYQRLLNYI PD +H++ +G+++ +GD  +A  LE+
Sbjct: 179 DALKIVSKGVNAMRGDNFGAMIITHYQRLLNYITPDVVHIMMDGRVVLSGDAELAARLEK 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAKIAEE 247


>gi|116073824|ref|ZP_01471086.1| ABC transporter, ATP-binding component [Synechococcus sp. RS9916]
 gi|116069129|gb|EAU74881.1| ABC transporter, ATP-binding component [Synechococcus sp. RS9916]
          Length = 264

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 169/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI +L A +   D  I++G+NL+V   E+ A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLEINDLHASV--EDQPILKGVNLEVRAGEIHAVMGRNGSGKSTLSKVLAGHPAYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G  +L+    ER+  G+FL FQYPVEIPG+  ++FL+++ N +R+ +   EL   
Sbjct: 67  SVRYRGTDLLELEPEERSRLGVFLGFQYPVEIPGVSNLEFLRVSSNARRQQQGLDELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 DFEDHVRERLNVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLEPVVSILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVAGGVNQLASTDNATLLITHYQRLLDEITPDYVHVMAAGRILRTGGRELALELEK 246

Query: 241 NGY 243
            GY
Sbjct: 247 TGY 249


>gi|302344947|ref|YP_003813300.1| FeS assembly ATPase SufC [Prevotella melaninogenica ATCC 25845]
 gi|302149918|gb|ADK96180.1| FeS assembly ATPase SufC [Prevotella melaninogenica ATCC 25845]
          Length = 252

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 176/249 (70%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A I     EI+RG+NL ++  E+ AIMGPNGSGKSTLS +L+G+  YE+T G
Sbjct: 1   MLEVRNLHATIAGK--EILRGINLTIKDGEIHAIMGPNGSGKSTLSAVLTGNPLYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             L+ G+++L+    +R+ +G+FL+FQYPVEIPG+ M  F+K A+N +R     + +   
Sbjct: 59  MALFNGKNLLEMKPEDRSHEGLFLSFQYPVEIPGVSMTNFMKAAINAKRAYEGLEPMKAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    +G++  + +R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 EFMALMREKRQLVGMDSTLSRRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A+GVN + ++  S ++ITHY+RLL  IKPD IHVL+ G+I+KT    +A ++E+
Sbjct: 179 DAMRIVAEGVNKMHNETTSAIVITHYERLLEMIKPDVIHVLYKGRIVKTAGPELAKEIEQ 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|225867879|ref|YP_002743827.1| ABC transporter ATP-binding protein [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701155|emb|CAW98043.1| putative ABC transporter, ATP-binding protein [Streptococcus equi
           subsp. zooepidemicus]
          Length = 260

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + G+ +Y++T G
Sbjct: 7   ILEINNLHVSI--EDKEILKGVNLTLRTGEIAAIMGPNGTGKSTLSAAIMGNPNYQVTEG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++ +++  + + 
Sbjct: 65  EILLDGVNILELEVDERARLGLFLAMQYPSEIPGITNAEFMRAAMNAGKEDKDK--ISVR 122

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +  A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 123 DFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 182

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R Q    +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 183 DALKVVSKGVNEMRGQAFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALATRLEK 242

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 243 EGYAGIAEE 251


>gi|283769980|ref|ZP_06342872.1| Fe-S cluster assembly ATP-binding protein [Staphylococcus aureus
           subsp. aureus H19]
 gi|283460127|gb|EFC07217.1| Fe-S cluster assembly ATP-binding protein [Staphylococcus aureus
           subsp. aureus H19]
          Length = 253

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 171/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTKGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP + ILDE DSGLDID
Sbjct: 121 FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKIAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|325982998|ref|YP_004295400.1| FeS assembly ATPase SufC [Nitrosomonas sp. AL212]
 gi|325532517|gb|ADZ27238.1| FeS assembly ATPase SufC [Nitrosomonas sp. AL212]
          Length = 264

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 171/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L ++ LRA I    TEI+RG++L ++  E+ AIMG NGSGKSTL+ +L+GH  YEITAG
Sbjct: 9   LLVVQGLRASI--NGTEILRGIDLTIKSGEIHAIMGLNGSGKSTLAKVLAGHAAYEITAG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++ + +L+ +  +RA  G+FLAFQYP+EIPG+   QFL++A N  +  R ++EL   
Sbjct: 67  TVRFEDKDLLEMAPEDRARAGLFLAFQYPIEIPGVANTQFLRLAYNTIQAQRGKEELDPL 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR+    L +N D L R +N GFSGGEKK  EILQM LLEP L ILDE DSGLDI
Sbjct: 127 EFDDFVREKMKLLDMNPDFLDRSVNEGFSGGEKKRNEILQMALLEPKLSILDEMDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A GVN + ++D + +++THYQRLL+Y+ PD +H++ +G I+ TG   +AL+LE 
Sbjct: 187 DALKTVANGVNHITNKDNATILVTHYQRLLDYVVPDFVHIMQSGHIVLTGGKELALELET 246

Query: 241 NGY 243
            GY
Sbjct: 247 RGY 249


>gi|195978803|ref|YP_002124047.1| iron-sulfur cluster assembly ABC transporter ATP-binding protein
           SufC [Streptococcus equi subsp. zooepidemicus MGCS10565]
 gi|195975508|gb|ACG63034.1| iron-sulfur cluster assembly ABC transporter ATP-binding protein
           SufC [Streptococcus equi subsp. zooepidemicus MGCS10565]
          Length = 256

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + G+ +Y++T G
Sbjct: 3   ILEINNLHVSI--EDKEILKGVNLTLRTGEIAAIMGPNGTGKSTLSAAIMGNPNYQVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  G +IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  ++ +++  + + 
Sbjct: 61  EILLDGVNILELEVDERARLGLFLAMQYPSEIPGITNAEFMRAAMNAGKEDKDK--ISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +  A LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R Q    +IITHYQRLLNYI PD +HV+ +G+I+ +GD ++A  LE+
Sbjct: 179 DALKVVSKGVNEMRGQAFGAMIITHYQRLLNYITPDLVHVMMDGRIVLSGDAALATRLEK 238

Query: 241 NGYAELIKE 249
            GYA + +E
Sbjct: 239 EGYAGIAEE 247


>gi|15923832|ref|NP_371366.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926502|ref|NP_374035.1| hypothetical protein SA0774 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282524|ref|NP_645612.1| hypothetical protein MW0795 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49483074|ref|YP_040298.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49485689|ref|YP_042910.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57651604|ref|YP_185785.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus COL]
 gi|82750524|ref|YP_416265.1| ATP-binding ABC transporter protein [Staphylococcus aureus RF122]
 gi|87160894|ref|YP_493518.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194605|ref|YP_499401.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267277|ref|YP_001246220.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus JH9]
 gi|150393327|ref|YP_001316002.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus JH1]
 gi|151220997|ref|YP_001331819.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156979169|ref|YP_001441428.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|161509111|ref|YP_001574770.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141905|ref|ZP_03566398.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253316872|ref|ZP_04840085.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253731451|ref|ZP_04865616.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253732733|ref|ZP_04866898.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005630|ref|ZP_05144231.2| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257794861|ref|ZP_05643840.1| FeS assembly ATPase SufC [Staphylococcus aureus A9781]
 gi|258418177|ref|ZP_05682442.1| ATP-binding ABC transporter [Staphylococcus aureus A9763]
 gi|258421474|ref|ZP_05684399.1| FeS assembly ATPase SufC [Staphylococcus aureus A9719]
 gi|258423466|ref|ZP_05686357.1| FeS assembly ATPase SufC [Staphylococcus aureus A9635]
 gi|258439184|ref|ZP_05690228.1| FeS assembly ATPase SufC [Staphylococcus aureus A9299]
 gi|258440888|ref|ZP_05690723.1| FeS assembly ATPase SufC [Staphylococcus aureus A8115]
 gi|258445718|ref|ZP_05693895.1| FeS assembly ATPase SufC [Staphylococcus aureus A6300]
 gi|258448953|ref|ZP_05697062.1| FeS assembly ATPase SufC [Staphylococcus aureus A6224]
 gi|258452134|ref|ZP_05700150.1| FeS assembly ATPase SufC [Staphylococcus aureus A5948]
 gi|258453931|ref|ZP_05701903.1| FeS assembly ATPase SufC [Staphylococcus aureus A5937]
 gi|262049609|ref|ZP_06022477.1| hypothetical protein SAD30_1192 [Staphylococcus aureus D30]
 gi|262052915|ref|ZP_06025096.1| hypothetical protein SA930_0127 [Staphylococcus aureus 930918-3]
 gi|269202467|ref|YP_003281736.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus ED98]
 gi|282894652|ref|ZP_06302879.1| FeS assembly ATPase SufC [Staphylococcus aureus A8117]
 gi|282903450|ref|ZP_06311341.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus C160]
 gi|282905229|ref|ZP_06313086.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908209|ref|ZP_06316040.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910490|ref|ZP_06318294.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282916162|ref|ZP_06323925.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus D139]
 gi|282918612|ref|ZP_06326349.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus C427]
 gi|282922192|ref|ZP_06329887.1| FeS assembly ATPase SufC [Staphylococcus aureus A9765]
 gi|282929252|ref|ZP_06336825.1| FeS assembly ATPase SufC [Staphylococcus aureus A10102]
 gi|283957651|ref|ZP_06375104.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284023841|ref|ZP_06378239.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus 132]
 gi|294850187|ref|ZP_06790923.1| FeS assembly ATPase SufC [Staphylococcus aureus A9754]
 gi|295406546|ref|ZP_06816352.1| FeS assembly ATPase SufC [Staphylococcus aureus A8819]
 gi|295427397|ref|ZP_06820032.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296276586|ref|ZP_06859093.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus MR1]
 gi|297208452|ref|ZP_06924882.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297245272|ref|ZP_06929146.1| FeS assembly ATPase SufC [Staphylococcus aureus A8796]
 gi|300912528|ref|ZP_07129971.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus TCH70]
 gi|304381534|ref|ZP_07364184.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|13700716|dbj|BAB42013.1| SA0774 [Staphylococcus aureus subsp. aureus N315]
 gi|14246611|dbj|BAB57004.1| ABC transporter ATP-binding protein homologue [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|21203961|dbj|BAB94660.1| MW0795 [Staphylococcus aureus subsp. aureus MW2]
 gi|49241203|emb|CAG39882.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49244132|emb|CAG42558.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57285790|gb|AAW37884.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus COL]
 gi|82656055|emb|CAI80462.1| ATP-binding ABC transporter protein [Staphylococcus aureus RF122]
 gi|87126868|gb|ABD21382.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202163|gb|ABD29973.1| ABC transporter, ATP-binding protein, putative [Staphylococcus
           aureus subsp. aureus NCTC 8325]
 gi|147740346|gb|ABQ48644.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus JH9]
 gi|149945779|gb|ABR51715.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus JH1]
 gi|150373797|dbj|BAF67057.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156721304|dbj|BAF77721.1| ABC transporter ATP-binding protein homologue [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|160367920|gb|ABX28891.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|253724694|gb|EES93423.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253729344|gb|EES98073.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|257788833|gb|EEV27173.1| FeS assembly ATPase SufC [Staphylococcus aureus A9781]
 gi|257838970|gb|EEV63449.1| ATP-binding ABC transporter [Staphylococcus aureus A9763]
 gi|257842400|gb|EEV66824.1| FeS assembly ATPase SufC [Staphylococcus aureus A9719]
 gi|257846527|gb|EEV70550.1| FeS assembly ATPase SufC [Staphylococcus aureus A9635]
 gi|257847756|gb|EEV71753.1| FeS assembly ATPase SufC [Staphylococcus aureus A9299]
 gi|257852402|gb|EEV76323.1| FeS assembly ATPase SufC [Staphylococcus aureus A8115]
 gi|257855294|gb|EEV78232.1| FeS assembly ATPase SufC [Staphylococcus aureus A6300]
 gi|257857849|gb|EEV80741.1| FeS assembly ATPase SufC [Staphylococcus aureus A6224]
 gi|257860349|gb|EEV83181.1| FeS assembly ATPase SufC [Staphylococcus aureus A5948]
 gi|257863796|gb|EEV86552.1| FeS assembly ATPase SufC [Staphylococcus aureus A5937]
 gi|259159166|gb|EEW44229.1| hypothetical protein SA930_0127 [Staphylococcus aureus 930918-3]
 gi|259162251|gb|EEW46825.1| hypothetical protein SAD30_1192 [Staphylococcus aureus D30]
 gi|262074757|gb|ACY10730.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus ED98]
 gi|269940416|emb|CBI48793.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282317746|gb|EFB48118.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus C427]
 gi|282320110|gb|EFB50457.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus D139]
 gi|282325882|gb|EFB56190.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327874|gb|EFB58156.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331636|gb|EFB61148.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282589128|gb|EFB94226.1| FeS assembly ATPase SufC [Staphylococcus aureus A10102]
 gi|282593482|gb|EFB98476.1| FeS assembly ATPase SufC [Staphylococcus aureus A9765]
 gi|282596405|gb|EFC01366.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus C160]
 gi|282762929|gb|EFC03062.1| FeS assembly ATPase SufC [Staphylococcus aureus A8117]
 gi|283470113|emb|CAQ49324.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283791102|gb|EFC29917.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285816521|gb|ADC37008.1| Iron-sulfur cluster assembly ATPase protein SufC [Staphylococcus
           aureus 04-02981]
 gi|294822961|gb|EFG39394.1| FeS assembly ATPase SufC [Staphylococcus aureus A9754]
 gi|294968691|gb|EFG44714.1| FeS assembly ATPase SufC [Staphylococcus aureus A8819]
 gi|295128785|gb|EFG58416.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887191|gb|EFH26094.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297177943|gb|EFH37192.1| FeS assembly ATPase SufC [Staphylococcus aureus A8796]
 gi|298694152|gb|ADI97374.1| ATP-binding ABC transporter protein [Staphylococcus aureus subsp.
           aureus ED133]
 gi|300886774|gb|EFK81976.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus TCH70]
 gi|302332527|gb|ADL22720.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus JKD6159]
 gi|302750741|gb|ADL64918.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304339897|gb|EFM05841.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|312438725|gb|ADQ77796.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312829310|emb|CBX34152.1| feS assembly ATPase SufC [Staphylococcus aureus subsp. aureus ECT-R
           2]
 gi|315128966|gb|EFT84963.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus CGS03]
 gi|315197262|gb|EFU27600.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus CGS01]
 gi|320141270|gb|EFW33117.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143042|gb|EFW34833.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323438408|gb|EGA96165.1| ATP-binding ABC transporter protein [Staphylococcus aureus O11]
 gi|323442000|gb|EGA99637.1| ATP-binding ABC transporter protein [Staphylococcus aureus O46]
 gi|329313581|gb|AEB87994.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329724576|gb|EGG61083.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           21172]
 gi|329726176|gb|EGG62646.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           21189]
 gi|329733922|gb|EGG70244.1| FeS assembly ATPase SufC [Staphylococcus aureus subsp. aureus
           21193]
          Length = 253

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTKGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|324989897|gb|EGC21839.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK353]
 gi|324992349|gb|EGC24270.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK405]
 gi|324996128|gb|EGC28039.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK678]
 gi|325697558|gb|EGD39444.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK160]
 gi|327460578|gb|EGF06913.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK1]
 gi|327462870|gb|EGF09192.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK1057]
 gi|327488935|gb|EGF20732.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK1058]
 gi|332366184|gb|EGJ43939.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK355]
          Length = 268

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 15  VLEIKDLHVEI--EGKKILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 72

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +E+++ + 
Sbjct: 73  EVLFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DEEKISVR 130

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 131 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 190

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 191 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMDGKVVLSGGPELAVRLEK 250

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 251 EGYAKLAEE 259


>gi|329770473|ref|ZP_08261852.1| vegetative protein 296 [Gemella sanguinis M325]
 gi|328836328|gb|EGF85994.1| vegetative protein 296 [Gemella sanguinis M325]
          Length = 246

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 172/249 (69%), Gaps = 6/249 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+IKNL   I   D +I++GLNL+++  E+ A+MGPNG+GKSTL+  + GH  YE+  G
Sbjct: 3   VLDIKNLEVSI--NDKKILKGLNLEIKSGEIHAVMGPNGAGKSTLASAIMGHPKYEVDGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL   E +LD  + ERA  G+FLA QYP E+PG+   +F+K A+N  R    E+ + + 
Sbjct: 61  SILLDNEEVLDMEVDERARAGLFLAMQYPSEVPGVPTSEFIKSAINAGR----EESIPLM 116

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            + +K+ K    L +++ M +R +N GFSGGEKK  EILQM +LEP   ILDE DSGLDI
Sbjct: 117 KYIKKLDKTMNFLEMDLKMSQRYVNDGFSGGEKKRNEILQMMMLEPKFAILDEIDSGLDI 176

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVN +R +D   LIITHYQRLL+YI+PD +HVL +GKI+KTG   +AL LE+
Sbjct: 177 DALKIVSKGVNKMRGEDFGCLIITHYQRLLDYIEPDFVHVLMDGKIVKTGGPELALRLEK 236

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 237 EGYDWLKEE 245


>gi|261881038|ref|ZP_06007465.1| FeS assembly ATPase SufC [Prevotella bergensis DSM 17361]
 gi|270332220|gb|EFA43006.1| FeS assembly ATPase SufC [Prevotella bergensis DSM 17361]
          Length = 250

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 178/249 (71%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL A I     EI++G++L V   EV AIMGPNGSGKSTLS +L+G+  Y +T G
Sbjct: 1   MLEVKNLHATI--AGKEILKGIDLTVNEGEVHAIMGPNGSGKSTLSAVLTGNPLYTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +++ G+++L+    ERA +G+FL+FQYPVEIPG+ M  F++ A+N +RK   ++ + + 
Sbjct: 59  SVMFNGKNLLEMPPEERACEGLFLSFQYPVEIPGVSMTNFMRAAVNARRKYNGQEPMNVS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + ++     + ++  + +R +N GFSGGEKK  EI QM +L+P L ILDETDSGLD+
Sbjct: 119 EFMQLMKDRRQIVELDAKLSRRSVNEGFSGGEKKRNEIFQMAMLDPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A+GVN L +  +S ++ITHY+RLL  IKPD IHVL++G+I+KT    +A ++E+
Sbjct: 179 DAMRIVAEGVNKLFTPQKSIIVITHYERLLEMIKPDVIHVLYDGRIVKTEGPELAKEIEK 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|116512662|ref|YP_811569.1| ABC-type transport system for Fe-S cluster assembly, ATPase
           component [Lactococcus lactis subsp. cremoris SK11]
 gi|116108316|gb|ABJ73456.1| Iron-regulated ABC transporter ATPase subunit SufC [Lactococcus
           lactis subsp. cremoris SK11]
          Length = 256

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 175/248 (70%), Gaps = 4/248 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIKNL   I   D EI++G+NL +  +E+ AIMGPNG+GKSTLS  + G+ +Y +T G+
Sbjct: 4   LEIKNLHVAI--EDKEILKGVNLVINTNEIHAIMGPNGTGKSTLSAAIMGNPNYTVTEGE 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L+ G+++L+  + ERA  G+FLA QYP EIPGI   +FL+ A+N +R A ++K + +  
Sbjct: 62  VLFDGQNVLEMEVDERARLGLFLAMQYPSEIPGITNAEFLRAAMNAKR-AEDDK-VSVMG 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDID
Sbjct: 120 FIKKLDKNMDVLSMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ A+GVN++R +    LIITHYQRLL+YI PD +H++ +G+++KTG   +A  LE  
Sbjct: 180 ALKVVAKGVNSMRGEKFGALIITHYQRLLDYITPDVVHIMMDGRVVKTGGAELAKRLETE 239

Query: 242 GYAELIKE 249
           GY  + +E
Sbjct: 240 GYVNIAEE 247


>gi|259501891|ref|ZP_05744793.1| SUF system FeS assembly ATPase [Lactobacillus antri DSM 16041]
 gi|259170068|gb|EEW54563.1| SUF system FeS assembly ATPase [Lactobacillus antri DSM 16041]
          Length = 265

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 122/232 (52%), Positives = 165/232 (71%), Gaps = 2/232 (0%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVER 77
           I++G+NL+++  E+ AIMGPNG+GKSTLS  + G   Y +T GDIL  GESIL+  + ER
Sbjct: 24  ILKGVNLQMQTGEIHAIMGPNGTGKSTLSQTIMGQPGYHVTQGDILLNGESILEMPVDER 83

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINM 137
           A KG+FLA QYP EI G+   +FL+ A+N +R    + ++ + DF +K+ K  + L ++ 
Sbjct: 84  ARKGLFLAMQYPAEIQGVTNAEFLRAAINARRP--EDDQISVMDFIKKLDKNLSLLDMSQ 141

Query: 138 DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQD 197
            M +R LN GFSGGEKK  EILQ+ ++EP+  ILDE DSGLDIDALK+ A+GVN++R  +
Sbjct: 142 KMTERYLNEGFSGGEKKRNEILQLLMIEPTFAILDEIDSGLDIDALKVVAKGVNSMRGDN 201

Query: 198 RSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELIKE 249
              LIITHYQRLLNYI PDT+HV+  G+I+KTG   +A  LE+ GYA L  E
Sbjct: 202 FGSLIITHYQRLLNYIVPDTVHVMMGGQIVKTGGPELAKKLEDEGYAGLRDE 253


>gi|78213791|ref|YP_382570.1| FeS assembly ATPase SufC [Synechococcus sp. CC9605]
 gi|78198250|gb|ABB36015.1| FeS assembly ATPase SufC [Synechococcus sp. CC9605]
          Length = 262

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 170/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I++L A +   D  I++G+NL+V   EV A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLDIQDLHASV--EDKPILKGVNLQVRAGEVHAVMGRNGSGKSTLSKVLAGHPAYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G+ + +    ERA  G+FL FQYPVEIPG+  ++FL+++ N +R+ + E+EL   
Sbjct: 67  TVRYRGQGLFELEPEERARLGVFLGFQYPVEIPGVSNLEFLRVSTNARREKQGEEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   V      + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 AFEDHVNDKLKVVQMDPAFLERSVNEGFSGGEKKRNEILQMALLEPVVAILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L ++D + L+ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVAGGVNQLATKDNATLLITHYQRLLDEITPDYVHVMAAGRILRTGGRELALELEQ 246

Query: 241 NGY 243
            GY
Sbjct: 247 TGY 249


>gi|302840511|ref|XP_002951811.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
 gi|300263059|gb|EFJ47262.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
          Length = 292

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 166/246 (67%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL AKI  T   I++G+NL +   EV AIMG NGSGKSTLS +L GH DYE+T G
Sbjct: 41  MLEVKNLEAKIAATGQPILKGVNLTIRNGEVHAIMGKNGSGKSTLSKVLVGHPDYEVTGG 100

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              +KG+ + +    ER+  G+FL+FQ P+E+PG+  + FL++A N +RKA  + EL   
Sbjct: 101 TATFKGKDLFELEPEERSHAGLFLSFQTPIEVPGVSNVDFLRMACNARRKALGQSELDPL 160

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +      L ++   L R +N GFSGGEKK  EILQ+ +LE  + ILDE DSGLDI
Sbjct: 161 EFYAYIMPKLEMLNMDPTFLNRNVNEGFSGGEKKRNEILQLAVLEADMAILDEIDSGLDI 220

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+  A+ VN L+++D   L++THY+RLL+YIKPD +H++  G+I+KTGD  +   LE 
Sbjct: 221 DALRDVAKAVNQLKNEDTGVLMVTHYKRLLDYIKPDFVHIMQAGEIVKTGDMGLVDQLEA 280

Query: 241 NGYAEL 246
            GYA L
Sbjct: 281 GGYATL 286


>gi|323350411|ref|ZP_08086074.1| FeS assembly ATPase SufC [Streptococcus sanguinis VMC66]
 gi|322123348|gb|EFX95026.1| FeS assembly ATPase SufC [Streptococcus sanguinis VMC66]
 gi|325689085|gb|EGD31093.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK115]
 gi|327468255|gb|EGF13740.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK330]
 gi|327472306|gb|EGF17737.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK408]
 gi|332359197|gb|EGJ37018.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK49]
          Length = 256

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVEI--EGKKILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +E+++ + 
Sbjct: 61  EVLFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DEEKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 119 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMDGKVVLSGGPELAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 239 EGYAKLAEE 247


>gi|325686786|gb|EGD28811.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK72]
 gi|328944936|gb|EGG39094.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK1087]
          Length = 268

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 15  VLEIKDLHVEI--EGKKILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 72

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +E+++ + 
Sbjct: 73  EVLFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DEEKISVR 130

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 131 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 190

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 191 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMDGKVVLSGGPELAVRLEK 250

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 251 EGYAKLAEE 259


>gi|182415975|ref|YP_001821041.1| FeS assembly ATPase SufC [Opitutus terrae PB90-1]
 gi|177843189|gb|ACB77441.1| FeS assembly ATPase SufC [Opitutus terrae PB90-1]
          Length = 252

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/235 (51%), Positives = 164/235 (69%), Gaps = 2/235 (0%)

Query: 15  DTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSI 74
           D  I++GL L +   EV AIMGPNG+GKSTL+  ++GH DY IT+GD++  G+SIL+   
Sbjct: 15  DKPIVKGLTLTINQGEVHAIMGPNGTGKSTLAKAIAGHPDYTITSGDVVIDGKSILELEP 74

Query: 75  VERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELG 134
            ERA  GIFLAFQYP EIPG+ +  FL+ AL  Q +    +EL    + +++      L 
Sbjct: 75  DERARAGIFLAFQYPSEIPGVTIANFLRAAL--QARLSEGEELDATAYYKRLYSKMDLLK 132

Query: 135 INMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALR 194
           I+     R +N GFSGGEKK  EILQM ++EP+  ++DETDSGLDIDAL+I A GVNALR
Sbjct: 133 IDRKFTSRAVNDGFSGGEKKRCEILQMAMIEPAFALMDETDSGLDIDALRIVADGVNALR 192

Query: 195 SQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELIKE 249
            +    L+ITHYQRLLN+I PD +HV+++G+I+K+GD  +AL LEE+GY  + KE
Sbjct: 193 GEKLGILLITHYQRLLNHIIPDFVHVMYDGRIVKSGDKDLALHLEEHGYDWVKKE 247


>gi|329767030|ref|ZP_08258558.1| hypothetical protein HMPREF0428_00255 [Gemella haemolysans M341]
 gi|328837755|gb|EGF87380.1| hypothetical protein HMPREF0428_00255 [Gemella haemolysans M341]
          Length = 246

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 173/249 (69%), Gaps = 6/249 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+IKNL   I   + +I++GLNL+++  E+ A+MGPNG+GKSTL+  + GH  YE+  G
Sbjct: 3   VLDIKNLEVSI--NEKQILKGLNLEIKSGEIHAVMGPNGAGKSTLASAIMGHPKYEVDGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  GE +L+  + ERA  G+FLA QYP E+PG+   +F+K A+N QR    E  + + 
Sbjct: 61  SILLDGEEVLEMEVDERARAGLFLAMQYPSEVPGVPTSEFIKSAINAQR----EDSIPLM 116

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            + +K+ K    L +++ M +R +N GFSGGEKK  EILQM +LEP   ILDE DSGLDI
Sbjct: 117 QYIKKLDKTMVFLDMDLKMSQRYVNDGFSGGEKKRNEILQMMMLEPKFAILDEIDSGLDI 176

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVN +R ++   LIITHYQRLL+YI+PD +HVL +GKI+K+G   +AL LE+
Sbjct: 177 DALKVVSKGVNKMRGENFGCLIITHYQRLLDYIEPDFVHVLMDGKIVKSGGPELALRLEK 236

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 237 EGYDWLKEE 245


>gi|319900397|ref|YP_004160125.1| FeS assembly ATPase SufC [Bacteroides helcogenes P 36-108]
 gi|319415428|gb|ADV42539.1| FeS assembly ATPase SufC [Bacteroides helcogenes P 36-108]
          Length = 250

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEIK+L A I     EI++G++L +   EV A+MG NG+GKSTLS +L GH  YE+T G
Sbjct: 1   MLEIKDLHASI--NGKEILKGIDLVIRDGEVHALMGQNGAGKSTLSNVLVGHPAYEVTKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            +++ G+ +L     +RA +GIFL+FQ PVEIPG+ M+ F++ A+NEQRK R+   L   
Sbjct: 59  SVIFNGKDLLAMPPEDRAHEGIFLSFQSPVEIPGVSMVNFMRAAVNEQRKYRHLPALSAS 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F + +R+  A + ++  +  R +N GFSGGEKK  EI QM +LEP+  ILDETDSGLD+
Sbjct: 119 EFLKLMREKRAIVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLEPAFAILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G N L++   S ++ITHYQRLL+Y++PD +HVL  G+I+KTG   +A ++E+
Sbjct: 179 DALRIVADGFNKLKTPHTSAMVITHYQRLLDYLRPDIVHVLLGGRIVKTGGPELAQEIEK 238

Query: 241 NGYAELIKE 249
            G+  + KE
Sbjct: 239 RGFDWIKKE 247


>gi|88807204|ref|ZP_01122716.1| FeS assembly ATPase SufC [Synechococcus sp. WH 7805]
 gi|88788418|gb|EAR19573.1| FeS assembly ATPase SufC [Synechococcus sp. WH 7805]
          Length = 262

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 169/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I +L A +   D  I++G+NL+V   EV A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLDISDLHASV--EDQPILKGVNLQVRAGEVHAVMGRNGSGKSTLSKILAGHPSYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G+ +      ERA  G+FL FQYPVEIPG+  ++FL++A N +R  + ++EL   
Sbjct: 67  SVRYRGDDLFALEPEERARLGVFLGFQYPVEIPGVSNLEFLRVATNARRDTQGQEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   VR+    + ++   L+R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 EFEDHVREKLKVVQMDPAFLERSVNQGFSGGEKKRNEILQMALLEPVISILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S D + ++ITHYQRLL+ I PD +HV+  G+I++TG   +A++LE+
Sbjct: 187 DALRIVAGGVNQLSSPDTASILITHYQRLLDEITPDYVHVMAAGRILRTGGRELAVELEQ 246

Query: 241 NGY 243
            GY
Sbjct: 247 IGY 249


>gi|325695646|gb|EGD37546.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK150]
          Length = 256

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVEI--EGKKILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +E+++ + 
Sbjct: 61  EVLFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DEEKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 119 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMDGKVVLSGGPELAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 239 EGYAKLAEE 247


>gi|319760493|ref|YP_004124431.1| FeS assembly ATPase SufC [Candidatus Blochmannia vafer str. BVAF]
 gi|318039207|gb|ADV33757.1| FeS assembly ATPase SufC [Candidatus Blochmannia vafer str. BVAF]
          Length = 246

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 168/244 (68%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L I+NL   I   +T I++  NL++   E+  IMGPNGSGKSTLS ++SG ++Y +T G
Sbjct: 2   LLSIQNLNVNI--QETSILKKFNLEINFGEIHIIMGPNGSGKSTLSSVISGQQNYIVTNG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL+KG+ +L     ERA +GIF+A QYPVEIPGI    FL  A+N  RK R +  +   
Sbjct: 60  KILFKGKDLLSLKPEERAGEGIFVALQYPVEIPGISNQLFLYSAVNALRKYRKQPPIDRF 119

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   V++    L +  D+L R +N+GFSGGEKK  +ILQM +LEP LCILDETDSGLDI
Sbjct: 120 TFLNSVQEKMKLLKMPEDLLSRSVNVGFSGGEKKRNDILQMMMLEPILCILDETDSGLDI 179

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+KI   G+N LR++ R+F+IITHY+R+L YIKPD +H+L+ G I K+GD ++   LEE
Sbjct: 180 DAIKIVYNGLNFLRNKTRAFIIITHYERILEYIKPDYVHILYKGHIRKSGDLTLVTKLEE 239

Query: 241 NGYA 244
            GY 
Sbjct: 240 KGYG 243


>gi|262340815|ref|YP_003283670.1| putative FeS assembly ATPase SufC [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272152|gb|ACY40060.1| putative FeS assembly ATPase SufC [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 251

 Score =  241 bits (616), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 175/249 (70%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML IKNL   I   D  +++G+NL+++  E   IMGPNGSGKSTL+ +++G K+Y IT G
Sbjct: 1   MLSIKNLHVSI--EDKRVLQGINLEIKTGETHVIMGPNGSGKSTLASIIAGKKEYHITEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I +  ++++++S  ERA  GIFL+FQ+P+EIPGI ++ F+K A+N  RK RN  ++   
Sbjct: 59  EIYFLNKNLVNFSPEERAHLGIFLSFQHPIEIPGISIINFIKTAINSIRKERNLNKMSAK 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +   K++  ++ L I  D + R LN GFSGGEKK  EI QM +L P L ILDE DSGLDI
Sbjct: 119 EILFKIKNTSSRLNIENDFIYRSLNEGFSGGEKKRNEIFQMMMLNPLLSILDEVDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTI-HVLHNGKIIKTGDYSIALDLE 239
           DAL++ +QG+NA R++  S LIITHY+RLL++I  D I H+L+NGKII++GD  ++  LE
Sbjct: 179 DALRVVSQGINAFRNKKNSILIITHYKRLLDHILSDYIVHILYNGKIIQSGDKKLSEKLE 238

Query: 240 ENGYAELIK 248
           + GY  + K
Sbjct: 239 KEGYDWIAK 247


>gi|299830563|ref|YP_003735011.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Durinskia baltica]
 gi|297384927|gb|ADI40226.1| iron-sulfur cluster formation ABC transporter ATP-binding subunit
           [Durinskia baltica]
          Length = 251

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 166/246 (67%), Gaps = 2/246 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE+K+L   I   +TEI++ LNL +   E+ AIMGPNGSGKST S +L+GH  Y I  G
Sbjct: 7   LLEVKDLHVSI--NETEILKNLNLTINKGEIHAIMGPNGSGKSTFSKVLAGHPAYSILKG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DIL+KG SILD    +R+  GIFLAFQYP+EIPG+    FL++A N ++K  N+ E+   
Sbjct: 65  DILFKGLSILDLEPEQRSHLGIFLAFQYPIEIPGVSNEDFLRLAYNSKQKFYNKPEIDPL 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +    + ++   L R +N GFSGGEKK  EILQM LL+  L ILDETDSGLDI
Sbjct: 125 EFLTVINEKLKLVNMSPVFLSRNVNEGFSGGEKKRNEILQMILLDSELAILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  + G+N      +S L+ITHYQRLL+YIKPD +HV  +GKIIKTG   +A +LE 
Sbjct: 185 DALKTISMGINNFMDSSKSILLITHYQRLLDYIKPDYVHVFQDGKIIKTGSSELAKELEN 244

Query: 241 NGYAEL 246
            GY  L
Sbjct: 245 KGYEWL 250


>gi|307128679|ref|YP_003880709.1| putative FeS assembly ATPase SufC [Candidatus Sulcia muelleri CARI]
 gi|306483141|gb|ADM90011.1| putative FeS assembly ATPase SufC [Candidatus Sulcia muelleri CARI]
          Length = 246

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 170/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML+IKNL   +     +I++ +NL +   E+  IMGPNGSGKSTL+ +++G KDY+I  G
Sbjct: 1   MLKIKNLSVSV--KQKKILKNVNLTINKGEIHVIMGPNGSGKSTLASIIAGKKDYKINKG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL++ + +   +  ERA  GIFL+FQ PVEIPGI ++ F++I+LN  RKA  +KE+   
Sbjct: 59  KILFENKELNFLAPEERAHLGIFLSFQDPVEIPGISILNFIRISLNSIRKANCKKEIDSY 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F +K+R ++  L I+ + L R LN GFSGGEKK  EI QM ++ P L ILDE DSGLDI
Sbjct: 119 QFLKKIRNVSDLLKIDKNFLSRDLNEGFSGGEKKRNEIFQMCMINPKLSILDEMDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+K  + G+N L++++ S LIITHYQRLLNYI PD +HVL  GKI+K+G+  +AL +E 
Sbjct: 179 DAMKTLSLGINKLKNKNNSILIITHYQRLLNYIIPDYVHVLDKGKIVKSGNKELALKIES 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|241889899|ref|ZP_04777197.1| FeS assembly ATPase SufC [Gemella haemolysans ATCC 10379]
 gi|241863521|gb|EER67905.1| FeS assembly ATPase SufC [Gemella haemolysans ATCC 10379]
          Length = 246

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 173/249 (69%), Gaps = 6/249 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+IKNL   I   + +I++GLNL+++  E+ A+MGPNG+GKSTL+  + GH  YE+  G
Sbjct: 3   VLDIKNLEVSI--NEKQILKGLNLEIKSGEIHAVMGPNGAGKSTLASAIMGHPKYEVDGG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL  GE +L+  + ERA  G+FLA QYP E+PG+   +F+K A+N QR    E  + + 
Sbjct: 61  SILLDGEEVLEMEVDERARAGLFLAMQYPSEVPGVPTSEFIKSAINAQR----EDSIPLM 116

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            + +K+ K    L +++ M +R +N GFSGGEKK  EILQM +LEP   ILDE DSGLDI
Sbjct: 117 QYIKKLDKTMEFLEMDLKMSQRYVNDGFSGGEKKRNEILQMMMLEPKFAILDEIDSGLDI 176

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI ++GVN +R ++   LIITHYQRLL+YI+PD +HVL +GKI+K+G   +AL LE+
Sbjct: 177 DALKIVSKGVNKMRGENFGCLIITHYQRLLDYIEPDFVHVLMDGKIVKSGGPELALRLEK 236

Query: 241 NGYAELIKE 249
            GY  L +E
Sbjct: 237 EGYDWLKEE 245


>gi|196230992|ref|ZP_03129852.1| FeS assembly ATPase SufC [Chthoniobacter flavus Ellin428]
 gi|196224822|gb|EDY19332.1| FeS assembly ATPase SufC [Chthoniobacter flavus Ellin428]
          Length = 254

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/242 (52%), Positives = 166/242 (68%), Gaps = 4/242 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L+I++L  +I   + EIIRGL L++   EV AIMGPNGSGKSTLS  + GH DY IT+GD
Sbjct: 4   LKIQDLHVRI--GEKEIIRGLTLEIPKGEVHAIMGPNGSGKSTLSKAIGGHPDYTITSGD 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G SIL     ERA +G+FLAFQYP+EIPG+    FL+ ALN ++    E E +  D
Sbjct: 62  VLLDGVSILGMEPDERARQGLFLAFQYPMEIPGVSNANFLRAALNSRQSEGEEIEAV--D 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F   + +   +L +  +   R +N GFSGGEKK  EILQM +L+P   ILDETDSGLDID
Sbjct: 120 FYEHLYEEMDKLEMRREFTSRAVNEGFSGGEKKRNEILQMAMLKPKYAILDETDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALKI + GVNA R  +   L+ITHYQRLL+YI PD +HV+ +G+I++ G   +AL+LEE 
Sbjct: 180 ALKIVSAGVNAQRGPNIGCLVITHYQRLLDYIVPDVVHVMVDGRIVRNGPKELALELEEK 239

Query: 242 GY 243
           GY
Sbjct: 240 GY 241


>gi|227511590|ref|ZP_03941639.1| iron-sulfur ABC superfamily ATP binding cassette transporter, ABC
           protein [Lactobacillus buchneri ATCC 11577]
 gi|227523796|ref|ZP_03953845.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus hilgardii ATCC 8290]
 gi|227085235|gb|EEI20547.1| iron-sulfur ABC superfamily ATP binding cassette transporter, ABC
           protein [Lactobacillus buchneri ATCC 11577]
 gi|227089111|gb|EEI24423.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus hilgardii ATCC 8290]
          Length = 269

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 172/252 (68%), Gaps = 8/252 (3%)

Query: 2   LEIKNLRAKIVDTDT----EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           L++ +L   + D +T    EI++G+NL +   E  AIMGPNG+GKSTLS  + G+ +Y +
Sbjct: 4   LKVTDLHVAVEDEETKKRQEILKGVNLVINTGETHAIMGPNGTGKSTLSETIMGNPNYHV 63

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T GDI   GESIL+  + ERA  G+FLA QYPVEI GI  ++F++ A+N  R    EK L
Sbjct: 64  TQGDITLDGESILNKKVDERARAGLFLAMQYPVEIKGITNLEFMRTAVNATR----EKPL 119

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            I  F +K+ +    L ++ +M +R LN GFSGGEKK  EILQ+ +++P   ILDE DSG
Sbjct: 120 PIRKFLKKLDENLKVLNMSDEMTERYLNEGFSGGEKKRNEILQLMMIQPKFAILDEIDSG 179

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL++ A+GVN + S D   L+ITHYQRLLNYI+PD +HV+ +G+I+KTGD S+A  
Sbjct: 180 LDIDALQVVAKGVNHMESPDFGTLMITHYQRLLNYIRPDQVHVMMDGRIVKTGDASLAEK 239

Query: 238 LEENGYAELIKE 249
           LE  GYA L  E
Sbjct: 240 LEAEGYAGLKDE 251


>gi|322392116|ref|ZP_08065578.1| FeS assembly ATPase SufC [Streptococcus peroris ATCC 700780]
 gi|321145016|gb|EFX40415.1| FeS assembly ATPase SufC [Streptococcus peroris ATCC 700780]
          Length = 256

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 177/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI+NL   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIRNLHVAI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +++++ + 
Sbjct: 61  EILFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DDEKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F +K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 119 EFLKKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+  G+++ +G   +A  LE 
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGRVVLSGGPELAARLER 238

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 239 EGYAKLAEE 247


>gi|297590245|ref|ZP_06948884.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus MN8]
 gi|297576544|gb|EFH95259.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus MN8]
          Length = 253

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 170/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTKGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I+ DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRWENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|156102250|ref|XP_001616818.1| ATP-dependent transporter [Plasmodium vivax SaI-1]
 gi|148805692|gb|EDL47091.1| ATP-dependent transporter, putative [Plasmodium vivax]
          Length = 351

 Score =  241 bits (616), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 174/249 (69%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI NL A  V+   EI++G+NL +   E   IMG NGSGKSTL+ +++GH  Y++T+G
Sbjct: 102 LLEITNLHAMEVEGGKEILKGINLTIFLGEKHTIMGRNGSGKSTLAKVIAGHPYYKVTSG 161

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I +KG ++ +  +  R+  GIFLAFQYPVE+P +   +FL+ ALN  R+ RNE E+   
Sbjct: 162 TIKFKGLNLSELPVNVRSLCGIFLAFQYPVELPMVKNNEFLRAALNSHRRQRNEPEISAT 221

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   + +   ++G++ + L RP+N GFSGGEKK  EILQM +L+PS CILDETDSGLD+
Sbjct: 222 EFDLLMIEEIKKVGLSSEFLDRPVNYGFSGGEKKRNEILQMLILKPSFCILDETDSGLDV 281

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           D+ K+ +  +    ++  SFLI+THY++LL  ++P+ IH++H GKII++GDYS+   +E 
Sbjct: 282 DSFKLTSNVITNFSNEKNSFLIVTHYKKLLELLRPNFIHIMHQGKIIESGDYSLVDKIEA 341

Query: 241 NGYAELIKE 249
            GYA+ +K+
Sbjct: 342 KGYAQFVKD 350


>gi|332359815|gb|EGJ37629.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK1056]
          Length = 256

 Score =  241 bits (615), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   ILEIKDLHVEI--EGKKILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++   E+++ + 
Sbjct: 61  EVLFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--EEEKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 119 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMDGKVVLSGGPELAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 239 EGYAKLAEE 247


>gi|125718748|ref|YP_001035881.1| ABC transporter ATPase [Streptococcus sanguinis SK36]
 gi|125498665|gb|ABN45331.1| ABC-type Fe-S cluster assembly transporter, ATPase component,
           putative [Streptococcus sanguinis SK36]
          Length = 256

 Score =  241 bits (615), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKDLHVEI--EGKKILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++   E+++ + 
Sbjct: 61  EVLFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--EEEKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 119 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMDGKVVLSGGPELAVRLEK 238

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 239 EGYAKLAEE 247


>gi|332365492|gb|EGJ43252.1| FeS assembly ATPase SufC [Streptococcus sanguinis SK1059]
          Length = 276

 Score =  241 bits (615), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  EV AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 23  VLEIKDLHVEI--EGKKILKGVNLTLKTGEVAAIMGPNGTGKSTLSAAIMGNPNYEVTQG 80

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +E+++ + 
Sbjct: 81  EVLFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DEEKISVR 138

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 139 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 198

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +GK++ +G   +A+ LE+
Sbjct: 199 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDVVHVMMDGKVVLSGGPELAVRLEK 258

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 259 EGYAKLAEE 267


>gi|257866760|ref|ZP_05646413.1| FeS assembly ATPase SufC [Enterococcus casseliflavus EC30]
 gi|257872723|ref|ZP_05652376.1| FeS assembly ATPase SufC [Enterococcus casseliflavus EC10]
 gi|257800718|gb|EEV29746.1| FeS assembly ATPase SufC [Enterococcus casseliflavus EC30]
 gi|257806887|gb|EEV35709.1| FeS assembly ATPase SufC [Enterococcus casseliflavus EC10]
          Length = 257

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIKNL  +I   D +I++G++L ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 3   VLEIKNLHVQI--EDKKILKGVDLVLKTGEIHAIMGPNGTGKSTLSAAIMGNPNYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL+ GE++L+  + ERA  G+FLA QYP EIPGI   +F++ A+N +R    + ++ + 
Sbjct: 61  EILFDGENVLEMEVDERARLGLFLAMQYPSEIPGITNAEFMRAAINAKRD--EDDKISVM 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF +K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  ILDE DSGLDI
Sbjct: 119 DFLKKLDEKMDLLNMPEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ A+GVN +R +    LIITHYQRLLNYI PD +H++  G+++ TG   +A  LE 
Sbjct: 179 DALKVVAKGVNEMRGEGFGALIITHYQRLLNYITPDVVHIMMEGRVVMTGSADLAKRLEA 238

Query: 241 NGYAELIKE 249
            GYA + KE
Sbjct: 239 EGYAGISKE 247


>gi|24378756|ref|NP_720711.1| putative ABC transporter, ATP-binding protein [Streptococcus mutans
           UA159]
 gi|290581236|ref|YP_003485628.1| putative ABC transporter ATP-binding protein [Streptococcus mutans
           NN2025]
 gi|24376625|gb|AAN58017.1|AE014874_3 putative ABC transporter, ATP-binding protein [Streptococcus mutans
           UA159]
 gi|254998135|dbj|BAH88736.1| putative ABC transporter ATP-binding protein [Streptococcus mutans
           NN2025]
          Length = 256

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 177/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L   I   D EI++G+NL ++  E+ AIMGPNG+GKSTLS  + G+  +E+T G
Sbjct: 3   VLEIKDLHVSI--EDKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPIFEVTQG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +IL  GE+IL+  + ERA  G+FLA QYP EIPGI   +F++ A+N  +K  +++++ + 
Sbjct: 61  EILLDGENILEMEVDERARLGLFLAMQYPSEIPGITNAEFIRAAMNAGKK--DDEKISVR 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    LG+  +M +R LN GFSGGEKK  EILQ+ +LEP   +LDE DSGLDI
Sbjct: 119 DFIMKLDEKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +HV+ +G+++ +G   +A  LE+
Sbjct: 179 DALKVVSKGVNAMRGEGFGAMIITHYQRLLNYITPDIVHVMMDGRVVLSGGPELAARLEK 238

Query: 241 NGYAELIKE 249
            GYA++ +E
Sbjct: 239 EGYAQIAEE 247


>gi|148240485|ref|YP_001225872.1| FeS assembly ATPase SufC [Synechococcus sp. WH 7803]
 gi|147849024|emb|CAK24575.1| FeS assembly ATPase SufC [Synechococcus sp. WH 7803]
          Length = 262

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 170/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L+I +L A +   D  I++G+NL+V   E+ A+MG NGSGKSTLS +L+GH  Y +T G
Sbjct: 9   LLDISDLHASV--EDQPILKGVNLQVRAGEIHAVMGRNGSGKSTLSKVLAGHPAYRVTGG 66

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + Y+G+ +L     +RA  G+FL FQYPVEIPG+  ++FL+++ N +R+ + ++EL   
Sbjct: 67  SVRYRGDDLLTLEPEQRARLGVFLGFQYPVEIPGVSNLEFLRVSTNARRETQGQEELDTF 126

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   VR+    + ++   L R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 127 DFEDHVRERLKVVQMDPAFLDRSVNQGFSGGEKKRNEILQMALLEPVVSILDETDSGLDI 186

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L S + + ++ITHYQRLL+ I PD +HV+  G+I++TG   +AL+LE+
Sbjct: 187 DALRIVASGVNQLSSPETASILITHYQRLLDEITPDYVHVMAAGRILRTGGRELALELEQ 246

Query: 241 NGY 243
            GY
Sbjct: 247 IGY 249


>gi|323343778|ref|ZP_08084005.1| FeS assembly ATPase SufC [Prevotella oralis ATCC 33269]
 gi|323095597|gb|EFZ38171.1| FeS assembly ATPase SufC [Prevotella oralis ATCC 33269]
          Length = 250

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 118/243 (48%), Positives = 175/243 (72%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A I     EI++G+NL +   EV AIMGPNGSGKSTLS +L+G+  Y +T G
Sbjct: 1   MLEVRNLHATIAGK--EILKGINLTIHDGEVHAIMGPNGSGKSTLSAVLTGNPLYTVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           + ++ G+++L+    +RA +G+FL+FQYPVEIPG+ M  F++ A+N +R+ +  + +   
Sbjct: 59  EAIFNGKNLLEMKPEDRAREGLFLSFQYPVEIPGVSMTNFMRAAINAKREYQGLEPMSAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +++    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLDI
Sbjct: 119 DFIKLMKEKRKLVELDATLSHRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDI 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A+GVN L++ D S ++ITHY+RLL+ IKP+ IH+L+ G+I+KTG   +A ++E+
Sbjct: 179 DALRIVAEGVNKLKTPDTSIIVITHYERLLDIIKPEFIHILYQGRIVKTGGPLLAKEIEK 238

Query: 241 NGY 243
            GY
Sbjct: 239 KGY 241


>gi|311031785|ref|ZP_07709875.1| SufC [Bacillus sp. m3-13]
          Length = 260

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 166/242 (68%), Gaps = 4/242 (1%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L IK+L   I   D EI++G+NL+V+  E+ AIMGPNG+GKSTLS  + GH  YE+T+G 
Sbjct: 5   LTIKDLHVSI--NDKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTSGS 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           I + GE +L+  + ERA  G+FLA QYP EI G+    FL+ A+N +R+  +E  L+   
Sbjct: 63  ITFDGEDVLEMEVDERAQVGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLM--K 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F RK+ K    L ++  M +R LN GFSGGEKK  EILQ+ ++EP + ILDE DSGLDID
Sbjct: 121 FIRKMDKNMDFLEMDQAMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +RS D   LIITHYQRLLNYI PD +HV+  G+I+K+G   +A  LE  
Sbjct: 181 ALKVVSKGINQMRSDDFGCLIITHYQRLLNYITPDHVHVMMQGRIVKSGGKELAQRLEAE 240

Query: 242 GY 243
           GY
Sbjct: 241 GY 242


>gi|254526807|ref|ZP_05138859.1| FeS assembly ATPase SufC [Prochlorococcus marinus str. MIT 9202]
 gi|221538231|gb|EEE40684.1| FeS assembly ATPase SufC [Prochlorococcus marinus str. MIT 9202]
          Length = 257

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 170/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE++NL A     D  I++G++L V P E+ AIMG NG GKSTLS +++GH  Y IT G
Sbjct: 7   ILEVENLSAST--DDLPILKGVSLTVYPGEIHAIMGRNGCGKSTLSKIIAGHPSYNITNG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I + GE+I      ERA  GIFL FQYP+EIPG+  ++FL+++ N +RK  N++EL   
Sbjct: 65  NIKFLGENINSLEPEERAQSGIFLGFQYPIEIPGVSNLEFLRVSTNARRKFLNKEELDTF 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V+K    + ++   L R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 125 DFEELVKKKLELVKMDHAFLSRSVNQGFSGGEKKRNEILQMALLEPKIAILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+  + +Q    ++ITHYQRLL+ I+P+ +HV+ +G+IIKTG+  +AL+LE+
Sbjct: 185 DALRIVASGIKKISNQQTGIILITHYQRLLDEIEPNYVHVMSDGQIIKTGESDLALELEK 244

Query: 241 NGY 243
            GY
Sbjct: 245 KGY 247


>gi|148243116|ref|YP_001228273.1| FeS assembly ATPase SufC [Synechococcus sp. RCC307]
 gi|147851426|emb|CAK28920.1| FeS assembly ATPase SufC [Synechococcus sp. RCC307]
          Length = 265

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 168/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEI +LRA + D   EI+ G+NL V   E+ A+MG NGSGKSTLS +++GH  Y IT G
Sbjct: 7   LLEITDLRASVADQ--EILCGVNLTVRAGEIHAVMGRNGSGKSTLSKVIAGHPTYTITGG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            + ++G+ I +    ER+  G+FL FQYPVEIPG+  ++FL+++ N +R+A+  +EL   
Sbjct: 65  SVRFRGQDIAELPPEERSRAGVFLGFQYPVEIPGVSNLEFLRVSTNARRQAQELEELDTF 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   +++    + ++   L+R LN GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 125 SFEEHLQQRLELVQMDPSFLERSLNEGFSGGEKKRNEILQMALLEPVVAILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A GVN L   D + L+ITHYQRLL+ I P  +HV+ +G+I++TG   +AL+LE 
Sbjct: 185 DALRIVAAGVNHLAGPDNATLLITHYQRLLDAITPQFVHVMAHGRILRTGGPELALELER 244

Query: 241 NGY 243
            GY
Sbjct: 245 RGY 247


>gi|19552775|ref|NP_600777.1| ABC-type transporter, ATPase component [Corynebacterium glutamicum
           ATCC 13032]
 gi|62390445|ref|YP_225847.1| Iron-regulated ABC transporter ATPase subunit [Corynebacterium
           glutamicum ATCC 13032]
 gi|145295686|ref|YP_001138507.1| hypothetical protein cgR_1613 [Corynebacterium glutamicum R]
 gi|21324330|dbj|BAB98955.1| ABC-type transporter, ATPase component [Corynebacterium glutamicum
           ATCC 13032]
 gi|41325782|emb|CAF21571.1| Iron-regulated ABC transporter ATPase subunit [Corynebacterium
           glutamicum ATCC 13032]
 gi|140845606|dbj|BAF54605.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 252

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 172/253 (67%), Gaps = 10/253 (3%)

Query: 2   LEIKNLRAKIVDTD-----TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYE 56
           LEI+NL A+++ +D      EI++G+NL +   E+ AIMGPNGSGKSTL+Y L GH  YE
Sbjct: 4   LEIRNLHAQVLPSDESAEPKEILKGVNLTINSGEIHAIMGPNGSGKSTLAYTLGGHPRYE 63

Query: 57  ITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKE 116
           +TAG++L  GE+IL+  + ERA  G+FLA QYP EIPG+ +  FL+ A    R    +  
Sbjct: 64  VTAGEVLLDGENILEMEVDERARAGLFLAMQYPTEIPGVSVANFLRSAATAIRGEAPK-- 121

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
             + ++ ++VR     L I+ +   R +N GFSGGEKK  E+LQ+ LL+P   I+DETDS
Sbjct: 122 --LREWVKEVRTAQEALAIDPEFSNRSVNEGFSGGEKKRHEVLQLDLLKPKFAIMDETDS 179

Query: 177 GLDIDALKIAAQGVNALRSQ-DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIA 235
           GLD+DAL+I ++G+N+ + + +   L+ITHY+R+LNY+KPD IHV  NG+I+ TG   +A
Sbjct: 180 GLDVDALRIVSEGINSYKQETEGGILMITHYKRILNYVKPDFIHVFANGQIVTTGGAELA 239

Query: 236 LDLEENGYAELIK 248
             LE +GY + IK
Sbjct: 240 DKLEADGYDQFIK 252


>gi|315194442|gb|EFU24834.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Staphylococcus aureus subsp. aureus CGS00]
          Length = 253

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 169/248 (68%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           LEIK+L   I   D EI++G+NL +   E+ AIMGPNG+GKSTLS  + GH  YE+T G+
Sbjct: 5   LEIKDLHVSI--EDKEILKGVNLTINTDEIHAIMGPNGTGKSTLSSAIMGHPSYEVTKGE 62

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +L  G +IL+  + ERA  G+FLA QYP EI G+    F++ A+N +R+   E  L+   
Sbjct: 63  VLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRSAINAKREEGQEINLM--Q 120

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F +K+ K    L I  DM +R LN GFSGGEKK  EILQ+ +LEP   ILDE DSGLDID
Sbjct: 121 FIKKLDKNMDFLDIYKDMAQRYLNEGFSGGEKKRNEILQLMMLEPKFAILDEIDSGLDID 180

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           ALK+ ++G+N +R ++   L+ITHYQRLLNYI PD +HV++ GK++K+G   +A  LEE 
Sbjct: 181 ALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYAGKVVKSGGPELAKRLEEE 240

Query: 242 GYAELIKE 249
           GY E +KE
Sbjct: 241 GY-EWVKE 247


>gi|283794873|ref|YP_003359226.1| sulfate ABC transporter protein [Cryptomonas paramecium]
 gi|253981845|gb|ACT46762.1| sulfate ABC transporter protein [Cryptomonas paramecium]
          Length = 254

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 168/244 (68%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           + E+++L A++      +++G+NL V   E+ AIMG NGSGKSTL+ +++GH  Y IT G
Sbjct: 7   LFEVRDLHARV--GSIPVLKGVNLCVRCGEIHAIMGRNGSGKSTLAKVVAGHPSYTITFG 64

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           D+L++G SIL  +  ERA  GIFL FQYPVEIPG+    FL+++ N  RK R   EL   
Sbjct: 65  DVLFRGASILSKTPEERAQLGIFLGFQYPVEIPGVSNSDFLRLSFNTVRKHRGLSELDPI 124

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   ++     + +    L R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 125 EFLEVIKSKLDIVKMEQTFLNRCVNEGFSGGEKKRNEILQMALLEPWVSILDETDSGLDI 184

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ A GVN L + + S ++ITHYQRLL+YI P  +HV+ +G+I+KTG   +AL+LE+
Sbjct: 185 DALRVVASGVNKLLTSETSIVLITHYQRLLDYIIPSYVHVMRDGRIVKTGSKELALELEK 244

Query: 241 NGYA 244
           NGY+
Sbjct: 245 NGYS 248


>gi|157412423|ref|YP_001483289.1| ABC transporter ATP-binding protein [Prochlorococcus marinus str.
           MIT 9215]
 gi|157386998|gb|ABV49703.1| ABC transporter, ATP binding component [Prochlorococcus marinus
           str. MIT 9215]
          Length = 261

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 170/243 (69%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE++NL A     D  I++G++L V P E+ AIMG NG GKSTLS +++GH  Y IT G
Sbjct: 11  ILEVENLSAST--DDLPILKGVSLTVYPGEIHAIMGRNGCGKSTLSKIIAGHPSYNITNG 68

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +I + GE+I      ERA  GIFL FQYP+EIPG+  ++FL+++ N +RK  N++EL   
Sbjct: 69  NIKFLGENINSLEPEERAQSGIFLGFQYPIEIPGVSNLEFLRVSTNARRKFLNKEELDTF 128

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF   V+K    + ++   L R +N GFSGGEKK  EILQM LLEP + ILDETDSGLDI
Sbjct: 129 DFEELVKKKLELVKMDHAFLSRSVNQGFSGGEKKRNEILQMALLEPKIAILDETDSGLDI 188

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL+I A G+  + +     ++ITHYQRLL+ I+P+ +HV+ +G+IIKTGD ++AL+LE+
Sbjct: 189 DALRIVASGIKKISNAQTGIILITHYQRLLDEIEPNYVHVMSDGQIIKTGDSNLALELEK 248

Query: 241 NGY 243
            GY
Sbjct: 249 KGY 251


>gi|315222031|ref|ZP_07863942.1| FeS assembly ATPase SufC [Streptococcus anginosus F0211]
 gi|315188997|gb|EFU22701.1| FeS assembly ATPase SufC [Streptococcus anginosus F0211]
          Length = 265

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LEIK+L  +I     +I++G+NL ++  E+ AIMGPNG+GKSTLS  + G+ +YE+T G
Sbjct: 12  VLEIKDLHVEI--EGKKILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTKG 69

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           ++L+ G +IL+  + ERA  G+FLA QYP EIPGI   +FL+ A+N  ++  +++++ I 
Sbjct: 70  EVLFDGVNILELDVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKE--DDEKISIR 127

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF  K+ +    L +  +M +R LN GFSGGEKK  EILQ+ +LEP+  +LDE DSGLDI
Sbjct: 128 DFIMKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDI 187

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+ ++GVNA+R +    +IITHYQRLLNYI PD +H++ +G+++ +G   +A+ LE+
Sbjct: 188 DALKVVSKGVNAMRGEHFGAMIITHYQRLLNYITPDVVHIMMDGRVVASGGSELAVRLEQ 247

Query: 241 NGYAELIKE 249
            GYA+L +E
Sbjct: 248 EGYAKLAEE 256


>gi|310643921|ref|YP_003948679.1| abc-type transport system atpase component [Paenibacillus polymyxa
           SC2]
 gi|309248871|gb|ADO58438.1| ABC-type transport system ATPase component [Paenibacillus polymyxa
           SC2]
          Length = 258

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 166/248 (66%), Gaps = 5/248 (2%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           L+I+ LR+KI     EI++GL L++   E+ AIMGPNG+GKSTL+  L GH  YE+T G 
Sbjct: 4   LKIEKLRSKI--EGKEILKGLTLEIHGGEIHAIMGPNGTGKSTLASALMGHPKYEVTGGK 61

Query: 62  ILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPD 121
           +    E +L+  + ERA  G+FLA QYP EI G+    FL+ A+N +R+  +E  L+   
Sbjct: 62  VTLDNEDLLEMEVDERAQAGLFLAMQYPSEIAGVTNSDFLRTAINARREEGDEISLI--R 119

Query: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           F R++      L +N + + R LN GFSGGEKK  EILQM LLEP   ILDE DSGLDID
Sbjct: 120 FIREMESKMKGLEMNPEFMHRYLNEGFSGGEKKRNEILQMMLLEPKFVILDEVDSGLDID 179

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
           AL+I A GVN +RS DR FLIITHYQRLLNYI PD +HV+  G+I+K+G   +A  LE  
Sbjct: 180 ALRIVANGVNEMRSPDRGFLIITHYQRLLNYITPDFVHVMMQGRIVKSGGPELAHRLEAE 239

Query: 242 GYAELIKE 249
           GY + +KE
Sbjct: 240 GY-DWVKE 246


>gi|227508611|ref|ZP_03938660.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
 gi|227191943|gb|EEI72010.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
          Length = 269

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 171/252 (67%), Gaps = 8/252 (3%)

Query: 2   LEIKNLRAKIVDTDT----EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           L++ +L   + D +T    EI++G+NL +   E  AIMGPNG+GKSTLS  + G+ +Y +
Sbjct: 4   LKVTDLHVAVEDEETKKRQEILKGVNLVINTGETHAIMGPNGTGKSTLSETIMGNPNYHV 63

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           T GDI   GESIL+  + ERA  G+FLA QYPVEI GI  ++F++ A+N  R    EK L
Sbjct: 64  TQGDITLDGESILNKKVDERARAGLFLAMQYPVEIKGITNLEFMRTAVNATR----EKPL 119

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            I  F +K+ +    L ++ +M +R LN GFSGGEKK  EILQ+ +++P   ILDE DSG
Sbjct: 120 PIRKFLKKLDENLKVLNMSDEMTERYLNEGFSGGEKKRNEILQLMMIQPKFAILDEIDSG 179

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL++ A+GVN + S D   L+ITHYQRLLNYI PD +HV+ +G+I+KTGD S+A  
Sbjct: 180 LDIDALQVVAKGVNHMESPDFGTLMITHYQRLLNYIHPDQVHVMMDGRIVKTGDASLAEK 239

Query: 238 LEENGYAELIKE 249
           LE  GYA L  E
Sbjct: 240 LEAEGYAGLKDE 251


>gi|86157271|ref|YP_464056.1| FeS assembly ATPase SufC [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773782|gb|ABC80619.1| Iron-regulated ABC transporter ATPase subunit SufC
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 268

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 169/244 (69%), Gaps = 2/244 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           ML I+ LRAK+   D EI++G++L++   EV AIMGPNGSGKSTL+ +L+G + YE+T G
Sbjct: 8   MLSIQGLRAKV--ADREILKGVDLEIRAGEVHAIMGPNGSGKSTLAGVLAGREAYEVTGG 65

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
              Y G+ +L  +   RA+ G+FL FQYPVEIPG+  + FL+ ALN  R+AR E EL   
Sbjct: 66  TATYLGQDLLALAPEARAAAGVFLGFQYPVEIPGVGNLYFLRTALNAIRRARGEDELDAM 125

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF    R+    + ++     R +N GFSGGEKK  EI QM +LEP L ILDE DSGLDI
Sbjct: 126 DFLALAREKMKLVDLDPAFGSRSVNEGFSGGEKKRNEIFQMAVLEPRLAILDEIDSGLDI 185

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DAL++ ++GVNALR  DR+ L++THY+RLL ++ PD IHV+  G+I+++G   +A +LE 
Sbjct: 186 DALRVVSRGVNALRRADRAVLLVTHYKRLLEHVSPDRIHVMAGGRIVRSGGPELADELER 245

Query: 241 NGYA 244
            GYA
Sbjct: 246 TGYA 249


>gi|288925323|ref|ZP_06419257.1| FeS assembly ATPase SufC [Prevotella buccae D17]
 gi|288337794|gb|EFC76146.1| FeS assembly ATPase SufC [Prevotella buccae D17]
          Length = 251

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 116/243 (47%), Positives = 172/243 (70%), Gaps = 2/243 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE+KNL A I     EI+RG+NL ++  E+ AIMGPNGSGKSTLS +L+G+  YE+T G
Sbjct: 1   MLEVKNLHATIAGK--EILRGINLSIKDGEIHAIMGPNGSGKSTLSAVLTGNPLYEVTEG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++ G+++L+    +RA +G+FL+FQYPVEIPG+ M  F++ A+N +R+ +  + L   
Sbjct: 59  QAIFNGKNLLEMKPEDRAREGLFLSFQYPVEIPGVSMTNFMRAAINAKREYQGLEPLNAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF + +R+    + ++  +  R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 DFMKLMREKRKLVDLDSKLSHRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA+++ A GVN + + + S ++ITHY+RLL+ IKP  +HVL+ G+I+KT    +A ++E+
Sbjct: 179 DAMRVVADGVNKMHTPETSTIVITHYERLLDMIKPTVVHVLYKGRIVKTAGPELAREIEQ 238

Query: 241 NGY 243
            GY
Sbjct: 239 RGY 241


>gi|260591774|ref|ZP_05857232.1| FeS assembly ATPase SufC [Prevotella veroralis F0319]
 gi|260536058|gb|EEX18675.1| FeS assembly ATPase SufC [Prevotella veroralis F0319]
          Length = 251

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 175/249 (70%), Gaps = 3/249 (1%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A I     EI++G+NL ++  EV AIMGPNGSGKSTLS +L+G+  YE+T G
Sbjct: 1   MLEVRNLHATIAGK--EILKGINLTIKDGEVHAIMGPNGSGKSTLSAVLTGNPLYEVTDG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++ G+++L+    +R+ +G+FL+FQYPVEIPG+ M  F+K A+N +R       +   
Sbjct: 59  MAIFNGKNLLEMKPEDRSHEGLFLSFQYPVEIPGVSMTNFMKAAINAKRAYEGLDPMKAA 118

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           +F   +R+    +G++  + +R +N GFSGGEKK  EI QM +LEP L ILDETDSGLD+
Sbjct: 119 EFMALMREKRQLVGMDSTLSRRSVNEGFSGGEKKRNEIFQMAMLEPKLSILDETDSGLDV 178

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DA++I A GVN + +   S+++ITHY+RLL+ IKPD +HVL+ G+I+KT    +A ++E+
Sbjct: 179 DAMRIVADGVNKMHTDKTSYIVITHYERLLDMIKPDVVHVLYKGRIVKTAGPELAKEIEQ 238

Query: 241 NGYAELIKE 249
            GY + IKE
Sbjct: 239 RGY-DWIKE 246


>gi|398987|sp|Q02856|ABCX_ANTSP RecName: Full=Probable ATP-dependent transporter ycf16
 gi|14178|emb|CAA44985.1| ORF2 [Antithamnion sp.]
          Length = 251

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 168/248 (67%), Gaps = 2/248 (0%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +L IKNL   I   +T+I+  LNL ++P E+ AIMG NGSGKSTL+ +++GH  Y+IT G
Sbjct: 6   LLNIKNLDVTI--GETQILNSLNLSIKPGEIHAIMGKNGSGKSTLAKVIAGHPSYKITNG 63

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            IL++ + + +    +R+  GIFLAFQYPVEIPG+    FL+IA N +R   N++EL   
Sbjct: 64  QILFENQDVTEIEPEDRSHLGIFLAFQYPVEIPGVTNADFLRIAYNAKRAFDNKEELDPL 123

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
            F   +    + + +N   L R +N GFSGGEKK  EILQM LL   L ILDETDSGLDI
Sbjct: 124 SFFSFIENKISNIDLNSTFLSRNVNEGFSGGEKKKNEILQMSLLNSKLAILDETDSGLDI 183

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK  A+ +N+L++Q+ S ++ITHYQRLL+YIKPD IHV+  G+II TG    A+ LE+
Sbjct: 184 DALKTIAKQINSLKTQENSIILITHYQRLLDYIKPDYIHVMQKGEIIYTGGSDTAMKLEK 243

Query: 241 NGYAELIK 248
            GY  L K
Sbjct: 244 YGYDYLNK 251


>gi|168023786|ref|XP_001764418.1| ATP-binding cassette transporter, subfamily I, member 8, ABC
           component protein PpABCI8 [Physcomitrella patens subsp.
           patens]
 gi|162684282|gb|EDQ70685.1| ATP-binding cassette transporter, subfamily I, member 8, ABC
           component protein PpABCI8 [Physcomitrella patens subsp.
           patens]
          Length = 351

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 168/246 (68%), Gaps = 6/246 (2%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           +LE++ LRA + DT  EI+ G++L +   EV AIMG NGSGKSTLS +L GH DYE+T G
Sbjct: 101 ILEVQGLRAVVADTRQEILNGVDLVIREGEVHAIMGKNGSGKSTLSKVLVGHPDYEVTGG 160

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
             ++KGE++ D    ER+  G+FL+FQ PVEIPG+  M FL++A N +R AR  +EL   
Sbjct: 161 TAIFKGENLFDKEPEERSHCGLFLSFQSPVEIPGVSNMDFLRMACNARRNARGLEELGPL 220

Query: 121 DFTRKV-RKITAELGINMD--MLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
           +F   V  K+TA   +NMD   L R +N GFSGGEKK  EILQ+ +LE  + ILDE DSG
Sbjct: 221 EFYGFVAEKLTA---LNMDPRFLDRNVNEGFSGGEKKRNEILQLSVLEADMAILDEIDSG 277

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALD 237
           LDIDAL+  A  V  L+  + + L+ITHYQRLL+YI P  +H++  G+I+KTGD S+A  
Sbjct: 278 LDIDALRDVANAVVGLKKDNNAILMITHYQRLLDYIMPTYVHIMEAGRIVKTGDMSLAAQ 337

Query: 238 LEENGY 243
           LE  GY
Sbjct: 338 LEAGGY 343


>gi|29376891|ref|NP_816045.1| ABC transporter, ATP-binding protein [Enterococcus faecalis V583]
 gi|255972135|ref|ZP_05422721.1| FeS