RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR01277

>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found. Length = 213
 Score = 56.4 bits (136), Expect = 7e-09
 Identities = 56/213 (26%), Positives = 95/213 (44%), Gaps = 22/213 (10%)

Query: 23  NLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERASKGI 82
           +L V   E+VAIMGP+G+GKSTL  L++G    E  +G I    +S    +  +R    +
Sbjct: 18  DLNVADGEIVAIMGPSGAGKSTLLNLIAGFI--EPASGSIKVNDQSHTGLAPYQRP---V 72

Query: 83  FLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINMDMLKR 142
            + FQ       + + Q + + L+   K   E++        KV     ++GI   + + 
Sbjct: 73  SMLFQENNLFAHLTVRQNIGLGLHPGLKLNAEQQ-------EKVVDAAQQVGIADYLDRL 125

Query: 143 PLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD----IDALKIAAQGVNALRSQDR 198
           P  L  SGG+++   + +  +    + +LDE  S LD     + L +  Q       + R
Sbjct: 126 PEQL--SGGQRQRVALARCLVRPNPILLLDEPFSALDPLLREEMLALVKQ---LCSERQR 180

Query: 199 SFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGD 231
           + L++TH+      I    I V+  GKI    D
Sbjct: 181 TLLMVTHHLSDARAIA-SQIAVVSQGKIKVVSD 212