RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR02211

>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina. Length = 221
 Score = 70.8 bits (174), Expect = 3e-13
 Identities = 67/234 (28%), Positives = 109/234 (46%), Gaps = 53/234 (22%)

Query: 15  DTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSI 74
           DT +++G++L +   E+VAI+G +GSGKSTL +LL G  +   T+G++L+ G+S+   S 
Sbjct: 17  DTRVLKGVSLSIGKGEIVAIVGSSGSGKSTLLHLLGGLDN--PTSGEVLFNGQSLSKLSS 74

Query: 75  VERAS-KGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFT---------- 123
            ERA  +   L F Y          QF                 L+PDFT          
Sbjct: 75  NERAKLRNKKLGFIY----------QF---------------HHLLPDFTALENVAMPLL 109

Query: 124 ----------RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDE 173
                      +  ++  ++G+   +  RP  L  SGGE++   I +  + +PSL + DE
Sbjct: 110 IGKKSVKEAKERAYEMLEKVGLEHRINHRPSEL--SGGERQRVAIARALVNQPSLVLADE 167

Query: 174 TDSGLDIDALKIAAQGVNAL-RSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKI 226
               LD +  KI    +  L R  + SFL++TH   L    K D +  + +G++
Sbjct: 168 PTGNLDNNNAKIIFDLMLELNRELNTSFLVVTHDLELAK--KLDRVLEMKDGQL 219