RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR03796

>gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin. Length = 710
 Score = 51.5 bits (124), Expect = 2e-07
 Identities = 21/66 (31%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 2   LEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGD 61
           +E++N+       +  +I   +L ++P + VA++G +GSGKST++ L++G   Y+  +G+
Sbjct: 478 VELRNITFGYSPLEPPLIENFSLTLQPGQRVALVGGSGSGKSTIAKLVAGL--YQPWSGE 535

Query: 62  ILYKGE 67
           IL+ G 
Sbjct: 536 ILFDGI 541