RPSBLAST alignment for GI: 254781060 and conserved domain: PRK10419

>gnl|CDD|182444 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional. Length = 268
 Score = 62.8 bits (153), Expect = 9e-11
 Identities = 60/227 (26%), Positives = 109/227 (48%), Gaps = 35/227 (15%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVER 77
           ++  ++L ++  E VA++G +G GKSTL+ LL G +    + G++ ++GE +   + + R
Sbjct: 27  VLNNVSLSLKSGETVALLGRSGCGKSTLARLLVGLE--SPSQGNVSWRGEPL---AKLNR 81

Query: 78  ASKGIF-----LAFQYPV-------EIPGIIM--MQFLKIALNEQRKARNEKELLIPDFT 123
           A +  F     + FQ  +        +  II   ++ L ++L++  +     E+L     
Sbjct: 82  AQRKAFRRDIQMVFQDSISAVNPRKTVREIIREPLRHL-LSLDKAERLARASEML----- 135

Query: 124 RKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDAL 183
           R V  +         + KRP  L  SGG+ +   + +   +EP L ILDE  S LD+   
Sbjct: 136 RAV-DLDDS-----VLDKRPPQL--SGGQLQRVCLARALAVEPKLLILDEAVSNLDLVLQ 187

Query: 184 KIAAQGVNALRSQ-DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKT 229
               + +  L+ Q   + L ITH  RL+       + V+ NG+I++T
Sbjct: 188 AGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVM-VMDNGQIVET 233