RPSBLAST alignment for GI: 254781060 and conserved domain: PRK10789

>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional. Length = 569
 Score = 52.0 bits (125), Expect = 1e-07
 Identities = 63/241 (26%), Positives = 105/241 (43%), Gaps = 53/241 (21%)

Query: 13  DTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDW 72
            TD   +  +N  ++P +++ I GP GSGKSTL  L+  H  ++++ GDI +    +   
Sbjct: 325 QTDHPALENVNFTLKPGQMLGICGPTGSGKSTLLSLIQRH--FDVSEGDIRFHDIPLTKL 382

Query: 73  SIVERASKGIFLAF--QYPVEIPGIIMMQFL-------KIALNEQRKARNEKELLIPDFT 123
            +    S+   LA   Q P          FL        IAL              PD T
Sbjct: 383 QLDSWRSR---LAVVSQTP----------FLFSDTVANNIALGR------------PDAT 417

Query: 124 RKVRKITAELG-INMDMLKRP----LNLG-----FSGGEKKIAEILQMRLLEPSLCILDE 173
           ++  +  A L  ++ D+L+ P      +G      SGG+K+   I +  LL   + ILD+
Sbjct: 418 QQEIEHVARLASVHDDILRLPQGYDTEVGERGVMLSGGQKQRISIARALLLNAEILILDD 477

Query: 174 TDSGLDIDALKIAAQGVNALRS--QDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGD 231
             S +D    +   Q ++ LR   + R+ +I  H  RL    +   I V+ +G I + G+
Sbjct: 478 ALSAVD---GRTEHQILHNLRQWGEGRTVIISAH--RLSALTEASEILVMQHGHIAQRGN 532

Query: 232 Y 232
           +
Sbjct: 533 H 533