RPSBLAST alignment for GI: 254781060 and conserved domain: PRK10851

>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional. Length = 353
 Score = 39.3 bits (92), Expect = 0.001
 Identities = 17/54 (31%), Positives = 36/54 (66%), Gaps = 2/54 (3%)

Query: 16 TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESI 69
          T+++  ++L +   ++VA++GP+GSGK+TL  +++G +    T+G I + G  +
Sbjct: 15 TQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQ--TSGHIRFHGTDV 66