RPSBLAST alignment for GI: 254781060 and conserved domain: PRK15134

>gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional. Length = 529
 Score = 52.8 bits (127), Expect = 8e-08
 Identities = 72/259 (27%), Positives = 114/259 (44%), Gaps = 55/259 (21%)

Query: 1   MLEIKNLRAKIV--DTDTEIIRGLNLKVEPSEVVAIMGPNGSGKS--TLSYL-LSGHKDY 55
           +L I+NL        T   ++  ++L++E  E +A++G +GSGKS   LS L L      
Sbjct: 5   LLAIENLSVAFRQQQTVRTVVNDVSLQIEAGETLALVGESGSGKSVTALSILRLLPSPPV 64

Query: 56  EITAGDILYKGESILDWSIVERASKG-----IFLAFQYPVEIPGIIMMQFLKIALNEQRK 110
              +GDI + GES+L  S  E+  +G     I + FQ P+            ++LN    
Sbjct: 65  VYPSGDIRFHGESLLHAS--EQTLRGVRGNKIAMIFQEPM------------VSLNPLHT 110

Query: 111 ARNEKELL-IPDFTRKVRKITAELGINMDMLKR-------------PLNLGFSGGEKKIA 156
              EK+L  +    R +R+  A   I ++ L R             P  L  SGGE++  
Sbjct: 111 L--EKQLYEVLSLHRGMRREAARGEI-LNCLDRVGIRQAAKRLTDYPHQL--SGGERQRV 165

Query: 157 EILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQDR----SFLIITHYQRLLNY 212
            I    L  P L I DE  + LD+    + AQ +  LR   +      L ITH    L+ 
Sbjct: 166 MIAMALLTRPELLIADEPTTALDV---SVQAQILQLLRELQQELNMGLLFITHN---LSI 219

Query: 213 IK--PDTIHVLHNGKIIKT 229
           ++   D + V+ NG+ ++ 
Sbjct: 220 VRKLADRVAVMQNGRCVEQ 238